MUSCLE (3.8) multiple sequence alignment

CAGL0B02299g       -------MPAIES--------------------------SVVRGGVQENRDVDIKEINSS
KNAG0G03410        -------MSDWESDE------------------------KSGVKGALVGDVSAPVELPHE
Smik_13.20         -------MTFRMSGSES----------------------GTQHTIVQLRRLPDLTEISHL
YML114C            -------MTSKTSESGT----------------------GTQSTIVQLRNLPDLTEISHL
Suva_13.29         -------MTSATPESGS----------------------GASQTMVQLTNLPDLTEVSHL
Skud_13.27         -------MTSTTSESGF----------------------GTRRTLVQLKNLPDLTEISHL
TBLA0D03250        ------MHSSSASIKKESNTSKLPIPDHKINQNVLKNSHPTSSNTQLLKNLPDLIQSPNR
KAFR0A02820        -------MTISIEDD---------------------------------MNVEPLEIRRQI
KLLA0D01617g       -------MTTSEDKDKNDAK------------I------ETDQRRVRLDKLPNLNEVPHA
KLTH0C03916g       -------MTKSAPDSPSSS--------------------SSELKGVQLRHLPNLEEIPRT
Kwal_27.10272      -------MTKPAPDAQTVS--------------------PDLQRVVQLKNLPTLHEIPKA
SAKL0D01518g       -------MTTEEASHKDAP--------------------APSRKQIRLKKLPTLHAAPHD
ABL128W            -------MTNGECNGIHNR--------------------AGAKEGIQLKKLPDLTEVTKS
Ecym_4609          -------MTTDIKSSDGST--------------------EGAKEFIQLKKLPGLQEVAKH
NDAI0E00300        -------MAS-----------------------------ANETENYDMNEVQPPREIAHN
NCAS0B00310        MAETVTSSSSPTLKKEQDLI------------L------NDTQEEPLMNELTNPTEIPSN
TPHA0I00230        MTAMVTNETIRTSDLLQGSDGDKAVEKFEHQDIGMDKEVTEQKKYVQLTKLPTLTEFKYE
Kpol_1068.10       -------MT------------------------------GEATKYIQLTELPTLTEYKYE
ZYRO0G14146g       -----------------------------------------MDNYIQITKLPTLQELQHE
TDEL0B00590        -------MED-----------------------------HSHERHIQLTHLPTLDEIDHG
                                                                               

CAGL0B02299g       NRMDYQMGELLKRAVGVQLQT------IDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRI
KNAG0G03410        P-WDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVEEQLSGMVTELHRI
Smik_13.20         E-IDAPVVEILKKTVLFQLNS------LNIC--ISNFALDELVNLVAVQMDGMFRNLHNL
YML114C            E-IDAPVVEILKKTVLFQLNS------LNIC--ISNFALDELVNLVTVQMDGMFRNLHNL
Suva_13.29         E-IDAPVLEILKKSVLFQLNS------LNIC--ISNFALDEMVNLVAVQMDGMFRNLHNL
Skud_13.27         K-IDAPVVEILRKTVLFQLNS------LDIC--ISNFALDELVNLVAVQMDGMFRNLHNL
TBLA0D03250        L-ESSCIGQLLAKSIALQLKP------MNDNTSISTVAFNRLLTLVDLQLNDMIYQLARL
KAFR0A02820        T-GNPQLDNLLVKSVAMRLKP------VNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRL
KLLA0D01617g       N----PMERLFAQAVLLQLKT------LNKNVVISQLAFDDLCYVSLLQLDDLLQSLKKI
KLTH0C03916g       A-LDDPLRKLLEKAVAIQLKA------VNSNVSISQFAFENLIILVEQMLSNMLVDLHKM
Kwal_27.10272      D-MDDPLKKLLEKAIAIQLKS------INADASISQLAFENLIILVEEMLSNMLMDLHKM
SAKL0D01518g       S-LEQPMHKILSQAVAIRLKP------MNKDVAMSQFAFENLVQLVSENLSFMLTTLHRF
ABL128W            N----PMQKLLAQAVGLHLKT------MRSDVGITQLGFENLVQFVELQLDDMLQILHRF
Ecym_4609          N----PMQILLSQSVALQLKT------MKSDFSITELGFNNMMQFIEMQMNDMFQILHRF
NDAI0E00300        H-MDMQIEKLLQKSIAIQLKA------FKVD--FSKLAFNQLTLLVDDQLNSLITELHRL
NCAS0B00310        S-SDEQVRKLLNKSIALQLKP------LNLE--LSQLAFNELSLLVNDQLDFLISELHRM
TPHA0I00230        D-TKGPMEVILAKAIALQLKL------MNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKL
Kpol_1068.10       E-TEPAIEKILAKAVALQLKS------MNCDTSITKFAFEHLMSLVVGQIDDMVLELHRL
ZYRO0G14146g       D-REPNVVKVLAKSVALQLKP------MNAQ--ITQFAFDRLLQLVDGQLNDMISQLHRM
TDEL0B00590        K-TEAAVVKILSKAVALQLKP------MKAD--ISKFAFEHLMILIDDQLNDMIGQLHRF
                         :  :: .:: ..:.             ..  .:  :  .    :. :.  : .:

CAGL0B02299g       SLLQRRQS-IAVSDLEIWMRGYNLLPSDLYMTAEESKFIREN-YRNDTSVVFKDINIDNP
KNAG0G03410        ATVQRRQH-ATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVP----REQTVQLQD
Smik_13.20         TLLQRRSE-ASQADLKLLFREFNVDAASLYQQFQVSEFIKSN-HAVE----YGKLVRLSS
YML114C            TLLQRRSQ-ASQADLKLLLREFNLDAPSLYQQFQASEFIKSK-HSTE----YEKLMSWSS
Suva_13.29         ALLQRRSQ-VSQADLKLLFREFNLNSASLFQQLQISEHIKSK-HSVE----YEKLVKSSS
Skud_13.27         ALLQRRSR-ATQADLKLLFKEFNLDPASLYQQLQISEFIKSN-HSVE----YEKLVSSSS
TBLA0D03250        SITQRRLT-IASNDLSLWLRSFNLNPSDLTLYLEESNFIKSK-FNKD----YNLLYELLR
KAFR0A02820        SLLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIKRL-YSED----EKKLSEDSI
KLLA0D01617g       TQVQRRTK-ISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGK-FKDE----ANALNETVL
KLTH0C03916g       VNIQRRHC-ISKKDLLLIIDGYNLTCADLMVELERSQYVRSH-NLER----VRKVREESE
Kwal_27.10272      ANIQRRHC-ISKKDLLLIIEGYNLSSSDLMLELERSRYVRSR-HLEQ----IKKVEEDSK
SAKL0D01518g       VDIQRRRE-ISKKDLLLLLKGYDLSNSELMRELESSQYIVSN-HPEK----VNKIAQKSK
ABL128W            ANVQRRNE-VSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQ-HAGA----VRSIEEQSA
Ecym_4609          ANIQRRNE-ISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKT-YEAE----FKNIERQSL
NDAI0E00300        SLLQRRNS-MAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKE----YRILRDLNE
NCAS0B00310        SVIQRRNA-AAKTDIELLLRGLNLNMSELHYQLQVSNFMKSK-NGKD----YDTLIKDSS
TPHA0I00230        AALQRRKE-VAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEK-YGGE----VTLLNRLAT
Kpol_1068.10       SSLQRRNT-VAKADISVWLRGFNLTPEDLEEQNQKSQYLSKL-YDKD----YESLTKIAT
ZYRO0G14146g       SNLQRRET-IAKGDISMLMEGFNISPSSIELQSRISEFYSQK-YFKE----FNHLHSLRD
TDEL0B00590        SNVQRRES-IAKGDVHLFLQGYNLTPADLDKQHQASQYYSKT-YGKE----FDSLHSLKE
                      ***    :  *: : :    :   .:      *                        

CAGL0B02299g       MESALGRINI-----QNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNL
KNAG0G03410        ATGSYDRFKL-----VENQQLIAS----GLSGSDMSQELPIAE--------------K--
Smik_13.20         -FPALAHNEE-----DEEDELSNI----EEQQSEINVLLPPSN--------------PLE
YML114C            -LAALPHNEE-----DEEDELNNI----EEQQNEINVLLPPSN--------------PLE
Suva_13.29         -FTAVSHIED-----DEEDEINNI----EEQQNEINVLLPPSN--------------PLE
Skud_13.27         -FSASSHNEE-----DEEDELNNI----EEQQNEISVLLPPSN--------------PLE
TBLA0D03250        DYNTETNHNF-----KNPNYSTSDLLNNKSSESSSSRIVPPSN--------------TIL
KAFR0A02820        HYNQHTDFV-------------------GPVETSSFQLLNPTN--------------PLK
KLLA0D01617g       KVKQQFMKEL-----EEKELLSSKHSEFFVQDVDILNLLPSSN--------------KSN
KLTH0C03916g       VVEAKEKTPL-----SEKELLESKHLEFFIQDKEILTLVPPTP--------------KNT
Kwal_27.10272      YVEKQEHTPL-----TQNELLSSTHPEFFVLDKDVLTLVPPSV--------------KDT
SAKL0D01518g       ELKSKLLKPM-----TEKELLNSAHSEFFFKDMDILDLVPPTN--------------KNN
ABL128W            SLMGHWHQPM-----SEEELLSSSHAEFFFKDVDILNLVPPTN--------------NNN
Ecym_4609          DLVEKWQKPL-----RDEELLSSNHAEFFFKDVDILNLVPPTN--------------INN
NDAI0E00300        EVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTN--------------PFK
NCAS0B00310        TIFDSSDTMA-----NPGHD--------SMVNNPSNILIKPNN--------------PFE
TPHA0I00230        DTNEVLTVFK-----KTDKTLK------DDSTLETLKLVPITN--------------TLE
Kpol_1068.10       TTTRTLSTYQ-------KLDLTHK----DTSTAQTSKLVPISN--------------PLQ
ZYRO0G14146g       LQSSLAHEMV-----PFEDQE-------AVRQNVSTVLVPPTN--------------PLQ
TDEL0B00590        TFTDAVVDED------------------NGSEDVINELVRPNN--------------PLI
                                                         :                     

CAGL0B02299g       RY-KPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL--MSNLDSI
KNAG0G03410        ---IPAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNL--VR-----
Smik_13.20         KL-IPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNL---------
YML114C            KQ-IPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNL---------
Suva_13.29         KL-IPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNL---------
Skud_13.27         KL-MPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNL---------
TBLA0D03250        RS-MPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKL--LEASTTS
KAFR0A02820        DA-IPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNL--IN-----
KLLA0D01617g       KY-VPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNM--LSQVV--
KLTH0C03916g       KY-VPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLS-----
Kwal_27.10272      KH-VPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLS-----
SAKL0D01518g       QY-IPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNL--LK-----
ABL128W            HY-VPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHM--L------
Ecym_4609          SY-VPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNM--LG-----
NDAI0E00300        GINISSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNF--LKNISNA
NCAS0B00310        IS-IPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNL--LN-----
TPHA0I00230        NI-IPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESE-----
Kpol_1068.10       KL-IPSWLPDFPPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNL--LR-----
ZYRO0G14146g       DF-LPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHL---------
TDEL0B00590        RY-IPKWMPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHL--LK-----
                       . *:* :**::**.:*. :   :     :.     *.   : :* ::         

CAGL0B02299g       STTKDNQKGTHLKQENNLILSEESNNLEVQSISTDKPDDVGSLEDINKQDDDKTQGNKIE
KNAG0G03410        --------------------NCDR------------------------------------
Smik_13.20         --------------------NKRL------------------------------------
YML114C            --------------------NKSL------------------------------------
Suva_13.29         --------------------NKRL------------------------------------
Skud_13.27         --------------------NKRL------------------------------------
TBLA0D03250        EINSLPTPETDRENDLEQNINIDT------------------------------------
KAFR0A02820        --------------------KIES------------------------------------
KLLA0D01617g       --------------------NQDP------------------------------------
KLTH0C03916g       --------------------HEES------------------------------------
Kwal_27.10272      --------------------HEEA------------------------------------
SAKL0D01518g       --------------------HHDS------------------------------------
ABL128W            --------------------GTAT------------------------------------
Ecym_4609          --------------------SAQA------------------------------------
NDAI0E00300        KKGTSIAPMTIPPSPSLS--NEGP------------------------------------
NCAS0B00310        --------------------DITE------------------------------------
TPHA0I00230        --------------------KITT------------------------------------
Kpol_1068.10       --------------------GGQE------------------------------------
ZYRO0G14146g       --------------------SQK-------------------------------------
TDEL0B00590        --------------------NMNP------------------------------------
                                                                               

CAGL0B02299g       VDAENKDQVVKIEENKESSTEKATETATETATEKQLSEEELADLEIKALLYRIE----NN
KNAG0G03410        ------------DADTKVDER---------ARETPPEELKRIDDEIVALYGPL-----EE
Smik_13.20         ------------SHLSSASHT----------SPPPVLDDADATEQQLEIWGNAL----QE
YML114C            ------------SHISSASNT----------PQPPGLDDEDAIEQQLEIWGNAL----EE
Suva_13.29         ------------FRISSASHT----------PSPRLPDASDAS-ERLEIWGNTL----HE
Skud_13.27         ------------LHISLASHA----------PPPRLPDDADAGEQQLEIWGNAL----QE
TBLA0D03250        ------------NTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSAL----QV
KAFR0A02820        ------------NEERNDLHY----------------DETLAKLESQALFGTV-----EE
KLLA0D01617g       --------LVALNKDSDQSAN----------NAALSEHIKESQLETDLIFDPH-----KT
KLTH0C03916g       ------------PSEGADSDE----------------IFKESQQDTQLIFGPA-----KK
Kwal_27.10272      ------------SSGPIDSDT----------------IYEEAQQETQLLFGPV-----KK
SAKL0D01518g       ------------TNQDLGNNE----------RVEKRSLYEETQEETFLIFGPE-----RK
ABL128W            ------------KKPRADDAQ-------------LPQIISDGQQENLLIYGPE-----RR
Ecym_4609          ------------KMLKVEDEE------------TIAQTYKESQEETQLIYGVE-----KQ
NDAI0E00300        --------ITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIE
NCAS0B00310        ------------QSSIENEET-------------SNFDSELAREENIAIYGYDA----MS
TPHA0I00230        ------------SKLLNLDKF-------------DSDDMDTAKLEMDALYSGGS----CD
Kpol_1068.10       ------------DRISRDLKF-------------SSSEMELATEETLATYSAIT----LR
ZYRO0G14146g       ------------KNPTDDIVN------------RSQYDSELAEQETLAIYGSQL----KK
TDEL0B00590        ------------PTPSSDADG-------------ASYDEALVREETAAIYGNEQ----KK
                                                               :               

CAGL0B02299g       KEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKY
KNAG0G03410        IAER---HEGPRTKRRTPLYLKKS------FDVQAYSLGRVKLARNAVQRFEWETKYRPR
Smik_13.20         RK---------------PTITATS---LNESNIEQYAKYRVELARERVAKFELNQLKRTK
YML114C            RK---------------PTITEKS---FNENNIEQYAKYRVELARERVTKFEVNQLKRTK
Suva_13.29         RK---------------PAIIAKS---FNEKNIEQYAKYRIELARERVSKFEVNQLKRTK
Skud_13.27         EK---------------RTAISKS---FNENNIEQYAKYRVELARERVSKFEVNQLKRTK
TBLA0D03250        RKIKKRFELMIDPKAETQLSEEFVYP--STFNVEEYARKQVQKIREQVLFYEEKQLQAQK
KAFR0A02820        K--------MNTNKKVYKSLNSIIVP-ITKFDIEEYSHKRVNIARNKVSKFENKMLALKY
KLLA0D01617g       I--PTDKEWGTTTVLHGIESFNLS-P-VKNFNVLEYCKKRDAIVKRRAERAENQVSNKRR
KLTH0C03916g       TK--------IAAINGASDLLRTL-P-QQNYNVEEYARNRVEIARRKVEEYERHQLLLQK
Kwal_27.10272      KK--------TAAINEVNDLLRTL-P-QQNFSVEEYARNRVEIARRRVNEYERHQLQLQK
SAKL0D01518g       KS---------HTTENSHELLRTL-P-LKNFSVEEYARNRVEIARRKVLEYEQYQLRLQK
ABL128W            R-----------------LAPEPA-P-TRGFNIEDYARCRVELARRRVEEFEQQKLQVQK
Ecym_4609          RPRRENAYVGGNSTNNDDLPLNSS-H-SKGFNIQEYARSRIGLARRKVEEFENHKLQAQK
NDAI0E00300        RDSSSKPNIISIHDEKIVNFFGHS-SSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEK
NCAS0B00310        RKKRKPPHLISIHDTE-QNFFNHP-QGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEK
TPHA0I00230        RKKRT----AFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQN
Kpol_1068.10       NK-------------HLTSFFEKE-PIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQR
ZYRO0G14146g       RK-------TQHPQANSADLLSKL-P-QTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQ
TDEL0B00590        RK---------KNASSSSDLLSKL-P-QTNFSIEEYARSRVEIARKKVVEYEERQMKLQR
                                                  .:  *   .    .  .   *        

CAGL0B02299g       NPLLRLAKMK-------------------------YYDAEE---------------SDFE
KNAG0G03410        NPFLCSHRAV----------------------------------------------PENS
Smik_13.20         NPFLKLSETL-------------------------YFSEGP-HQS----------HKTIQ
YML114C            NPFLKISETL-------------------------YLPESP-HQS----------HKTIQ
Suva_13.29         NPFLKISESL-------------------------YSFKNP-HQS----------HKVIQ
Skud_13.27         NPFLRISETL-------------------------YSSKSP-HQP----------HRAIQ
TBLA0D03250        NPFWKYSKMIVGPSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQIN
KAFR0A02820        NPFINLINDQ--------------------------------------------------
KLLA0D01617g       NPFIRGAMIC-------------------------SPYGQGSTKS----------RKSVE
KLTH0C03916g       GAFIKAAHLL-------------------------SPFAKK-R-N----------CKQVE
Kwal_27.10272      GAFIKAAHLL-------------------------SPFSKK-RTS----------CKQVE
SAKL0D01518g       NPFIKAANLC-------------------------SPLKKS-TMS----------RKAID
ABL128W            NPFIRAAAAC-------------------------SPYATT-RLS----------RKAIE
Ecym_4609          NPFIRASSIC-------------------------SPYGNAQKTT----------RKAAE
NDAI0E00300        NPFLKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDN-RLSPIR------KRAQIN
NCAS0B00310        NPFLRLSRMI----------------------------NDK-KVS----------RSDLK
TPHA0I00230        DPFLKMTALL-------------------------SEQTDK-KVS----------REVIN
Kpol_1068.10       NPFLKISRLI-------------------------SANNDN-KVS----------KSVAN
ZYRO0G14146g       DPFLKLSRIA-------------------------FTQCND-KFT----------KKQVH
TDEL0B00590        NPFIKYSKIA-------------------------LSNSSD-KSG----------RRQAT
                   ..:                                                         

CAGL0B02299g       TEYQKCIKRTMDRFKR-NIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKKEQEIV
KNAG0G03410        KKVYSMLENSLNELVQVDLPRLESRKAAAIAHAVEQR----DAKLAELRAKLKETTPSAT
Smik_13.20         SAIDLQFRKSMTLFMH-NLPKVQKLKKERIRMAKEERAKSLRRRQEELISERKKREQD--
YML114C            KTIELQFRKSMTLFMH-NLPKVQKLKKEKIRMAKEERAKSLKRRQEELISQRTKREQD--
Suva_13.29         RSIDLQLRKSVTLFMH-NLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQD--
Skud_13.27         RAIDLQFRKSMMLFAH-NLPKVQKLKKEKIRMAIEERSRSLKRRQEELILERKKREQD--
TBLA0D03250        HDIQQMFNRSLNNLIN-SLPNLAKEKASAREIAENER----EKKVQEMLKKKQKELNE--
KAFR0A02820        TDVKSYLNRSFQLMIN-SIPELTLEKKKAIRQAEIER----DERINRLREDHQTKLKQI-
KLLA0D01617g       NQLKTMLRRSYLGLID-SIPRVKEVRERARKEAEERE----RLLQEQRRIEKEK------
KLTH0C03916g       KEVRTLLHRSYIGLLK-SAPLLREQRKREVELAEENR----RLREEQIRQEREERLK---
Kwal_27.10272      KEIRTLLHRSRIGLLK-SAPSLKERRKREIALAEENR----RLRDEKLRKEREARSK---
SAKL0D01518g       KELKSMLQRSYIGLLR-SVPKLNEVKARERELANERR----REMLEKLNEERQRQAE---
ABL128W            REFGVLLHRSYIGVLH-AIPRLRRTKARELAAAYERE----RARQESMRNNTDL------
Ecym_4609          REFNILLRRSYVGVLK-SIPKLRQLKANEMAAAIERE----RIKQKEREMELEK------
NDAI0E00300        NEIISNLKRSFYSILN-NYPKLKKAKKQRVKLAIEKR----DQRLQELRKIQE-EERKVK
NCAS0B00310        LEIKNSLQRSYKSIFR-NYPKLKQERDRRLELARQKR----EEKIEKLKIQNEQLK----
TPHA0I00230        TNIENVLKRSFLQLIN-SIPTLNQNKKDTRERAMVEK----KRRHDEWLKRREEKLKKLE
Kpol_1068.10       TEIRKYLKRSLLNFIH-SIPKTQQERKEARERAEEEK----ERRLAEIKALKEEKLKEME
ZYRO0G14146g       REFQLALQRSFIHLVK-SIPELERNKLETEEKAKEER----SKRLQELRAQREEQE----
TDEL0B00590        REIHSMLQRSLQHLIK-SIPELQMTKQDARRKAEQKR----DERLQELRDKKAQKLKNFT
                         : .:   .     *     .      :                           

CAGL0B02299g       R----KSREMEAI-------------ENANKFGILPGEKPL-------------------
KNAG0G03410        KPF--QGMDINIG-------------GGGDDDAVDDDEVALFEELS--------------
Smik_13.20         -----EGHDLELL--------------LNNEH----------------------------
YML114C            -----EGHDLELL--------------LNNEH----------------------------
Suva_13.29         -----EGHDLELL--------------LNNEQ----------------------------
Skud_13.27         -----EGHDLELL--------------LHNEH----------------------------
TBLA0D03250        -----KQSSAGAL-------------DLHDLQKEND---GLFADLGSSDDDESSTR----
KAFR0A02820        -----DTISHDIL-----------------------------------------------
KLLA0D01617g       -----KMAEQEIL-------------DLNNLQTD-----PLLHGWDKDSE----------
KLTH0C03916g       -----NSKDYDVL-------------DLDNLNED-----PFFGGLGS-------------
Kwal_27.10272      -----SSNEFDVL-------------DLNNLNED-----PFFGGLGSSDSEDEQQQEE--
SAKL0D01518g       -----AGGGDEVL-------------DLNNLNED-----PLLAGFDSSDSEGE-------
ABL128W            -----TQQQHGVL-------------DLSALHDD-----PLLADLD--------------
Ecym_4609          -----KHLQQGVV-------------DLNALHED-----ALLADLD--------------
NDAI0E00300        EQKLLTKSENPLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSSEEEEEE------
NCAS0B00310        -----KDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIATNI-----------
TPHA0I00230        QEKNLRAQAFGAI-------------DLSSFTNIDDG--GFLDGFDSSENEQELEIRA--
Kpol_1068.10       AK---KSSDFNLL-------------DLSNYPNDSHG--GFFAALESSDEERELIIQPRL
ZYRO0G14146g       -----KKGERDVL-------------DLDE------------------------------
TDEL0B00590        DQQL-ENGDINLL-------------DLDENNDD-------FFNYSGSED----------
                                                                               

CAGL0B02299g       ----------------------EVLQDASNASTGESSTTTAQIPQGAPLLVNPVN---ST
KNAG0G03410        ----------------------GSSDDDDDGGIETVTKTTNLPNTQGNPMAGPRL---AV
Smik_13.20         ----------------------AREATDNNTTPNVANNSTIIINANANDEDDDMN---LF
YML114C            ----------------------ARDAADDTTTPNALNNSTIVINTNAEDEDDDIN---LF
Suva_13.29         ----------------------ARESTDNNTNLNALNVSTIDINANADGDDDDMN---LF
Skud_13.27         ----------------------ARESTENNTNPNAPSSFTIDINANADDEDDDMN---LF
TBLA0D03250        ----------------------HQNTSDKTQETHSPKLSQNEDQHANNNETQEIV---KH
KAFR0A02820        -----------------------------GTAADEMDEKTMDDIDLFSALELDAV---TK
KLLA0D01617g       ----------------------DDDENDDEKFLTQGPPEVQAITDTNISTLGELA---SE
KLTH0C03916g       ----------------------SDTEDEKEPPQQEGTNKSGNTAPSATPEISDRANTMSA
Kwal_27.10272      --------------------K-ATDGVSESEKQQITQDEAALDTVKASPPTEPHV---SN
SAKL0D01518g       ----------------------DGEAKALAGNAQHTELEQVEPSQTKSSQEQEQI---LF
ABL128W            ----------------------SSDSDDDRQPPSPRKPPDPTESDAPSPPTAD-------
Ecym_4609          ----------------------STDSEDDEPMMGSKKQELGFSEIANPLQAKKIL---AQ
NDAI0E00300        ----------------------EEEEEEGEQQTATTHNVLQQLGSQRKEKEGTMT---TT
NCAS0B00310        ----------------------EDVEDDGIGLFGDLESSDEDNDDKVNNTNTSID---NN
TPHA0I00230        --------------------KSSQNNSKDISSTGPGSWDKEEANPVAIGTSVNTK---SL
Kpol_1068.10       SSYTRNNSGVSSNETQADSVKNANENENENENEAIKAGKELENDTTDSVKDIPTE---EN
ZYRO0G14146g       ----------------------LDQNQEDFFAMESSDEEVMEPTVDKPPLEQPQQ---TE
TDEL0B00590        ----------------------EDLPQAEFENPSMTNDIPVPNLPTPAPEEHSRA---EA
                                                                               

CAGL0B02299g       LVPLVDSEKPKPLEEVQTID--VIAKDVEDDD--------------------EDLGLFGG
KNAG0G03410        VV-PEEPSAPASASEVPSEP--MPGTAEKPEEHD-----------------------AKE
Smik_13.20         GI-LGSSEDENEISSMPVEN--LAGESEPPTMIMQDTV--------------NSTLAAHN
YML114C            GI-LGSSEDENEMSSMPAEN--LVAESEPPTMTAQDTT--------------NTTPVAHN
Suva_13.29         GI-LGSSEDENELSSIQVET--VAGESEPPTAPARDTT--------------NTTPVAQN
Skud_13.27         GI-LGSSGDENEAPSIQNGN--VAGEPEPPTATVQDNA--------------NTTSMTHN
TBLA0D03250        VLEHNHNNETQEIVNHEIKE--NHKNGTQDIAINETEQDHNNSAQEIENSETGINAAITS
KAFR0A02820        GE-EDFKSTEEEHPTAASND--QPRPAAVS----------------------SEQEETKQ
KLLA0D01617g       LLHGPDEEKPMESTETFEDV--LPSITPANSTPLLSEVASGSASG-------LTPKDISE
KLTH0C03916g       DIPGRSVLDEAESQDLTREA--DMEFDSEKNKDDTSNEYSFQTAGNPRLSPGGPSSALHD
Kwal_27.10272      TN-DQAPEASVADSPKPESN--MPALQEGDTKQKDLESATPKP---------DSTDVQQE
SAKL0D01518g       EEGEDKRQSQSQSQSQSQQPYVSPIQTQEAGTLLQSSSEAHTTNLSPQLATVAETQIEAS
ABL128W            ---TATPAPPSPLANPPVLD----------------------------------------
Ecym_4609          DSTLNVSSDIESTSSARPSS-------------------------------------KPP
NDAI0E00300        GN-TSVKIGEKQTDISVEPN--NHETTEGSTQDIRTTEEQTNVEQ-------AKQKPTDG
NCAS0B00310        NILPVDGTPDNETASVASNI--IAVAPNQPEEIISSVSDSIN----------ENVTLKNP
TPHA0I00230        EI-KTSGQTNQNMEPVLSNE--IESVTSEGLEVEKLEVQEDQMQGETDVVHTTGEEVIQE
Kpol_1068.10       KIHTDANTAATEKVETIQNNNSDDAKTAQDNEKETVEKTETAPAIENSEQTVKEPETTES
ZYRO0G14146g       TA-QNEPQQPELIQEHVQEK--SQHEQEQEQEQVQ-----------------EPERIGEE
TDEL0B00590        QS-HSEVQPVIESNAQPEAQ--AQAQSESQAQAESMAEVEQQTPAQMETQVMPEAESHQE
                                                                               

CAGL0B02299g       FNSSSDDEEIDQNKETQ-ESPTK----------KTTHVKFELGESDSDKDI---------
KNAG0G03410        NATASASPAAHPATDPA-ATAPE----------GSETDRPIAQAAPSSSE----------
Smik_13.20         TTNVDATAN----RSTH-STLSE----------NTPTSPPTAMATDNDITM---------
YML114C            TTNIDATTSHSP----H-STPNE----------NAPTSPPADIATDHDITM---------
Suva_13.29         TTNIDTTAN----FSIL-STPNE----------NAPTSPPTATATDNDINI---------
Skud_13.27         TTNIDATATNPSFSSFQ-STPNE----------NAPTSPPILKATDHDITM---------
TBLA0D03250        TSTLPGSIASPPTISEQ-RAPHTSAVLTTNDDVTEGTSKDDSSQVEIKPSEGVASPEN--
KAFR0A02820        THAAEEEDEKEGPADFL-FEDVD---------------------MQEDIEI---------
KLLA0D01617g       DAPEAGSEEAKSELALH-TSPGV-----------ATDELLENQSQDHDSNVNDLF-----
KLTH0C03916g       FTSTPPALPSSDNREIHEGTPSTSAPQVPDNGEQQRQKAPEASVNVNDASAEPQEPRTN-
Kwal_27.10272      AEDTPTDADLPKSEDIG-ATELS---------DNQSHSTQISPEPGHQDI----------
SAKL0D01518g       ISDVSSDYQDGPGAATT-AQPKP---------SNQELSDDDDDENDGGGYLFEDVVTNDD
ABL128W            --AAPEPLSVPPPIEKL-GSPDT----------NAASAS---------------------
Ecym_4609          QQQPLQDVTTPPASENT-TSPHH----------SAIHLTPTGPLIGSTPFVPH-------
NDAI0E00300        QGKEELEDEEEDDFDDH-NFLFE----------DVVTSEFDKPGEDNKSTIVPNTNADIE
NCAS0B00310        NEPKHTESDDSGTFDDQ-NFLFQ----------DVATSEIDKLNNGNDTIV---------
TPHA0I00230        IKQSETPINFPTMATTT-ITTTE----------TNISTTETTTITETTPNINSGLEESND
Kpol_1068.10       NGIGSSTDTTKDKEPVI-SNPEEPQVNSDINEPTASSTTDTTLQQAQEPEKEEVEADNGQ
ZYRO0G14146g       IQPATQEIADLPPQEPQ-GEPLQ----------GRPQEEDISIELSSNPSEDEDLNNSTY
TDEL0B00590        RSSVESQHELASPPEVD-AQPQE----------QESDEDDTNFLFDESITTEQQDEIQL-
                                                                               

CAGL0B02299g       ----------------------
KNAG0G03410        ----------------------
Smik_13.20         ----------------------
YML114C            ----------------------
Suva_13.29         ----------------------
Skud_13.27         ----------------------
TBLA0D03250        ----------------------
KAFR0A02820        ----------------------
KLLA0D01617g       ----------------------
KLTH0C03916g       ----------------------
Kwal_27.10272      ----------------------
SAKL0D01518g       SIVF------------------
ABL128W            ----------------------
Ecym_4609          ----------------------
NDAI0E00300        LI--------------------
NCAS0B00310        ----------------------
TPHA0I00230        TN--------------------
Kpol_1068.10       SIENVEPLTTAEPGSEPKPILD
ZYRO0G14146g       PV--------------------
TDEL0B00590        ----------------------
                                         

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0B02299g
-------MPAIES--------------------------SVVRGGVQENRDVDIKEINSS
NRMDYQMGELLKRAVGVQLQT------IDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRI
SLLQRRQS-IAVSDLEIWMRGYNLLPSDLYMTAEESKFIREN-YRNDTSVVFKDINIDNP
MESALGRINI-----QNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNL
RY-KPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL--MSNLDSI
STTKDNQKGTHLKQENNLILSEESNNLEVQSISTDKPDDVGSLEDINKQDDDKTQGNKIE
VDAENKDQVVKIEENKESSTEKATETATETATEKQLSEEELADLEIKALLYRIE----NN
KEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKY
NPLLRLAKMK-------------------------YYDAEE---------------SDFE
TEYQKCIKRTMDRFKR-NIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKKEQEIV
R----KSREMEAI-------------ENANKFGILPGEKPL-------------------
----------------------EVLQDASNASTGESSTTTAQIPQGAPLLVNPVN---ST
LVPLVDSEKPKPLEEVQTID--VIAKDVEDDD--------------------EDLGLFGG
FNSSSDDEEIDQNKETQ-ESPTK----------KTTHVKFELGESDSDKDI---------
----------------------
>KNAG0G03410
-------MSDWESDE------------------------KSGVKGALVGDVSAPVELPHE
P-WDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVEEQLSGMVTELHRI
ATVQRRQH-ATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVP----REQTVQLQD
ATGSYDRFKL-----VENQQLIAS----GLSGSDMSQELPIAE--------------K--
---IPAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNL--VR-----
--------------------NCDR------------------------------------
------------DADTKVDER---------ARETPPEELKRIDDEIVALYGPL-----EE
IAER---HEGPRTKRRTPLYLKKS------FDVQAYSLGRVKLARNAVQRFEWETKYRPR
NPFLCSHRAV----------------------------------------------PENS
KKVYSMLENSLNELVQVDLPRLESRKAAAIAHAVEQR----DAKLAELRAKLKETTPSAT
KPF--QGMDINIG-------------GGGDDDAVDDDEVALFEELS--------------
----------------------GSSDDDDDGGIETVTKTTNLPNTQGNPMAGPRL---AV
VV-PEEPSAPASASEVPSEP--MPGTAEKPEEHD-----------------------AKE
NATASASPAAHPATDPA-ATAPE----------GSETDRPIAQAAPSSSE----------
----------------------
>Smik_13.20
-------MTFRMSGSES----------------------GTQHTIVQLRRLPDLTEISHL
E-IDAPVVEILKKTVLFQLNS------LNIC--ISNFALDELVNLVAVQMDGMFRNLHNL
TLLQRRSE-ASQADLKLLFREFNVDAASLYQQFQVSEFIKSN-HAVE----YGKLVRLSS
-FPALAHNEE-----DEEDELSNI----EEQQSEINVLLPPSN--------------PLE
KL-IPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNL---------
--------------------NKRL------------------------------------
------------SHLSSASHT----------SPPPVLDDADATEQQLEIWGNAL----QE
RK---------------PTITATS---LNESNIEQYAKYRVELARERVAKFELNQLKRTK
NPFLKLSETL-------------------------YFSEGP-HQS----------HKTIQ
SAIDLQFRKSMTLFMH-NLPKVQKLKKERIRMAKEERAKSLRRRQEELISERKKREQD--
-----EGHDLELL--------------LNNEH----------------------------
----------------------AREATDNNTTPNVANNSTIIINANANDEDDDMN---LF
GI-LGSSEDENEISSMPVEN--LAGESEPPTMIMQDTV--------------NSTLAAHN
TTNVDATAN----RSTH-STLSE----------NTPTSPPTAMATDNDITM---------
----------------------
>YML114C
-------MTSKTSESGT----------------------GTQSTIVQLRNLPDLTEISHL
E-IDAPVVEILKKTVLFQLNS------LNIC--ISNFALDELVNLVTVQMDGMFRNLHNL
TLLQRRSQ-ASQADLKLLLREFNLDAPSLYQQFQASEFIKSK-HSTE----YEKLMSWSS
-LAALPHNEE-----DEEDELNNI----EEQQNEINVLLPPSN--------------PLE
KQ-IPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNL---------
--------------------NKSL------------------------------------
------------SHISSASNT----------PQPPGLDDEDAIEQQLEIWGNAL----EE
RK---------------PTITEKS---FNENNIEQYAKYRVELARERVTKFEVNQLKRTK
NPFLKISETL-------------------------YLPESP-HQS----------HKTIQ
KTIELQFRKSMTLFMH-NLPKVQKLKKEKIRMAKEERAKSLKRRQEELISQRTKREQD--
-----EGHDLELL--------------LNNEH----------------------------
----------------------ARDAADDTTTPNALNNSTIVINTNAEDEDDDIN---LF
GI-LGSSEDENEMSSMPAEN--LVAESEPPTMTAQDTT--------------NTTPVAHN
TTNIDATTSHSP----H-STPNE----------NAPTSPPADIATDHDITM---------
----------------------
>Suva_13.29
-------MTSATPESGS----------------------GASQTMVQLTNLPDLTEVSHL
E-IDAPVLEILKKSVLFQLNS------LNIC--ISNFALDEMVNLVAVQMDGMFRNLHNL
ALLQRRSQ-VSQADLKLLFREFNLNSASLFQQLQISEHIKSK-HSVE----YEKLVKSSS
-FTAVSHIED-----DEEDEINNI----EEQQNEINVLLPPSN--------------PLE
KL-IPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNL---------
--------------------NKRL------------------------------------
------------FRISSASHT----------PSPRLPDASDAS-ERLEIWGNTL----HE
RK---------------PAIIAKS---FNEKNIEQYAKYRIELARERVSKFEVNQLKRTK
NPFLKISESL-------------------------YSFKNP-HQS----------HKVIQ
RSIDLQLRKSVTLFMH-NLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQD--
-----EGHDLELL--------------LNNEQ----------------------------
----------------------ARESTDNNTNLNALNVSTIDINANADGDDDDMN---LF
GI-LGSSEDENELSSIQVET--VAGESEPPTAPARDTT--------------NTTPVAQN
TTNIDTTAN----FSIL-STPNE----------NAPTSPPTATATDNDINI---------
----------------------
>Skud_13.27
-------MTSTTSESGF----------------------GTRRTLVQLKNLPDLTEISHL
K-IDAPVVEILRKTVLFQLNS------LDIC--ISNFALDELVNLVAVQMDGMFRNLHNL
ALLQRRSR-ATQADLKLLFKEFNLDPASLYQQLQISEFIKSN-HSVE----YEKLVSSSS
-FSASSHNEE-----DEEDELNNI----EEQQNEISVLLPPSN--------------PLE
KL-MPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNL---------
--------------------NKRL------------------------------------
------------LHISLASHA----------PPPRLPDDADAGEQQLEIWGNAL----QE
EK---------------RTAISKS---FNENNIEQYAKYRVELARERVSKFEVNQLKRTK
NPFLRISETL-------------------------YSSKSP-HQP----------HRAIQ
RAIDLQFRKSMMLFAH-NLPKVQKLKKEKIRMAIEERSRSLKRRQEELILERKKREQD--
-----EGHDLELL--------------LHNEH----------------------------
----------------------ARESTENNTNPNAPSSFTIDINANADDEDDDMN---LF
GI-LGSSGDENEAPSIQNGN--VAGEPEPPTATVQDNA--------------NTTSMTHN
TTNIDATATNPSFSSFQ-STPNE----------NAPTSPPILKATDHDITM---------
----------------------
>TBLA0D03250
------MHSSSASIKKESNTSKLPIPDHKINQNVLKNSHPTSSNTQLLKNLPDLIQSPNR
L-ESSCIGQLLAKSIALQLKP------MNDNTSISTVAFNRLLTLVDLQLNDMIYQLARL
SITQRRLT-IASNDLSLWLRSFNLNPSDLTLYLEESNFIKSK-FNKD----YNLLYELLR
DYNTETNHNF-----KNPNYSTSDLLNNKSSESSSSRIVPPSN--------------TIL
RS-MPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKL--LEASTTS
EINSLPTPETDRENDLEQNINIDT------------------------------------
------------NTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSAL----QV
RKIKKRFELMIDPKAETQLSEEFVYP--STFNVEEYARKQVQKIREQVLFYEEKQLQAQK
NPFWKYSKMIVGPSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQIN
HDIQQMFNRSLNNLIN-SLPNLAKEKASAREIAENER----EKKVQEMLKKKQKELNE--
-----KQSSAGAL-------------DLHDLQKEND---GLFADLGSSDDDESSTR----
----------------------HQNTSDKTQETHSPKLSQNEDQHANNNETQEIV---KH
VLEHNHNNETQEIVNHEIKE--NHKNGTQDIAINETEQDHNNSAQEIENSETGINAAITS
TSTLPGSIASPPTISEQ-RAPHTSAVLTTNDDVTEGTSKDDSSQVEIKPSEGVASPEN--
----------------------
>KAFR0A02820
-------MTISIEDD---------------------------------MNVEPLEIRRQI
T-GNPQLDNLLVKSVAMRLKP------VNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRL
SLLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIKRL-YSED----EKKLSEDSI
HYNQHTDFV-------------------GPVETSSFQLLNPTN--------------PLK
DA-IPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNL--IN-----
--------------------KIES------------------------------------
------------NEERNDLHY----------------DETLAKLESQALFGTV-----EE
K--------MNTNKKVYKSLNSIIVP-ITKFDIEEYSHKRVNIARNKVSKFENKMLALKY
NPFINLINDQ--------------------------------------------------
TDVKSYLNRSFQLMIN-SIPELTLEKKKAIRQAEIER----DERINRLREDHQTKLKQI-
-----DTISHDIL-----------------------------------------------
-----------------------------GTAADEMDEKTMDDIDLFSALELDAV---TK
GE-EDFKSTEEEHPTAASND--QPRPAAVS----------------------SEQEETKQ
THAAEEEDEKEGPADFL-FEDVD---------------------MQEDIEI---------
----------------------
>KLLA0D01617g
-------MTTSEDKDKNDAK------------I------ETDQRRVRLDKLPNLNEVPHA
N----PMERLFAQAVLLQLKT------LNKNVVISQLAFDDLCYVSLLQLDDLLQSLKKI
TQVQRRTK-ISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGK-FKDE----ANALNETVL
KVKQQFMKEL-----EEKELLSSKHSEFFVQDVDILNLLPSSN--------------KSN
KY-VPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNM--LSQVV--
--------------------NQDP------------------------------------
--------LVALNKDSDQSAN----------NAALSEHIKESQLETDLIFDPH-----KT
I--PTDKEWGTTTVLHGIESFNLS-P-VKNFNVLEYCKKRDAIVKRRAERAENQVSNKRR
NPFIRGAMIC-------------------------SPYGQGSTKS----------RKSVE
NQLKTMLRRSYLGLID-SIPRVKEVRERARKEAEERE----RLLQEQRRIEKEK------
-----KMAEQEIL-------------DLNNLQTD-----PLLHGWDKDSE----------
----------------------DDDENDDEKFLTQGPPEVQAITDTNISTLGELA---SE
LLHGPDEEKPMESTETFEDV--LPSITPANSTPLLSEVASGSASG-------LTPKDISE
DAPEAGSEEAKSELALH-TSPGV-----------ATDELLENQSQDHDSNVNDLF-----
----------------------
>KLTH0C03916g
-------MTKSAPDSPSSS--------------------SSELKGVQLRHLPNLEEIPRT
A-LDDPLRKLLEKAVAIQLKA------VNSNVSISQFAFENLIILVEQMLSNMLVDLHKM
VNIQRRHC-ISKKDLLLIIDGYNLTCADLMVELERSQYVRSH-NLER----VRKVREESE
VVEAKEKTPL-----SEKELLESKHLEFFIQDKEILTLVPPTP--------------KNT
KY-VPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLS-----
--------------------HEES------------------------------------
------------PSEGADSDE----------------IFKESQQDTQLIFGPA-----KK
TK--------IAAINGASDLLRTL-P-QQNYNVEEYARNRVEIARRKVEEYERHQLLLQK
GAFIKAAHLL-------------------------SPFAKK-R-N----------CKQVE
KEVRTLLHRSYIGLLK-SAPLLREQRKREVELAEENR----RLREEQIRQEREERLK---
-----NSKDYDVL-------------DLDNLNED-----PFFGGLGS-------------
----------------------SDTEDEKEPPQQEGTNKSGNTAPSATPEISDRANTMSA
DIPGRSVLDEAESQDLTREA--DMEFDSEKNKDDTSNEYSFQTAGNPRLSPGGPSSALHD
FTSTPPALPSSDNREIHEGTPSTSAPQVPDNGEQQRQKAPEASVNVNDASAEPQEPRTN-
----------------------
>Kwal_27.10272
-------MTKPAPDAQTVS--------------------PDLQRVVQLKNLPTLHEIPKA
D-MDDPLKKLLEKAIAIQLKS------INADASISQLAFENLIILVEEMLSNMLMDLHKM
ANIQRRHC-ISKKDLLLIIEGYNLSSSDLMLELERSRYVRSR-HLEQ----IKKVEEDSK
YVEKQEHTPL-----TQNELLSSTHPEFFVLDKDVLTLVPPSV--------------KDT
KH-VPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLS-----
--------------------HEEA------------------------------------
------------SSGPIDSDT----------------IYEEAQQETQLLFGPV-----KK
KK--------TAAINEVNDLLRTL-P-QQNFSVEEYARNRVEIARRRVNEYERHQLQLQK
GAFIKAAHLL-------------------------SPFSKK-RTS----------CKQVE
KEIRTLLHRSRIGLLK-SAPSLKERRKREIALAEENR----RLRDEKLRKEREARSK---
-----SSNEFDVL-------------DLNNLNED-----PFFGGLGSSDSEDEQQQEE--
--------------------K-ATDGVSESEKQQITQDEAALDTVKASPPTEPHV---SN
TN-DQAPEASVADSPKPESN--MPALQEGDTKQKDLESATPKP---------DSTDVQQE
AEDTPTDADLPKSEDIG-ATELS---------DNQSHSTQISPEPGHQDI----------
----------------------
>SAKL0D01518g
-------MTTEEASHKDAP--------------------APSRKQIRLKKLPTLHAAPHD
S-LEQPMHKILSQAVAIRLKP------MNKDVAMSQFAFENLVQLVSENLSFMLTTLHRF
VDIQRRRE-ISKKDLLLLLKGYDLSNSELMRELESSQYIVSN-HPEK----VNKIAQKSK
ELKSKLLKPM-----TEKELLNSAHSEFFFKDMDILDLVPPTN--------------KNN
QY-IPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNL--LK-----
--------------------HHDS------------------------------------
------------TNQDLGNNE----------RVEKRSLYEETQEETFLIFGPE-----RK
KS---------HTTENSHELLRTL-P-LKNFSVEEYARNRVEIARRKVLEYEQYQLRLQK
NPFIKAANLC-------------------------SPLKKS-TMS----------RKAID
KELKSMLQRSYIGLLR-SVPKLNEVKARERELANERR----REMLEKLNEERQRQAE---
-----AGGGDEVL-------------DLNNLNED-----PLLAGFDSSDSEGE-------
----------------------DGEAKALAGNAQHTELEQVEPSQTKSSQEQEQI---LF
EEGEDKRQSQSQSQSQSQQPYVSPIQTQEAGTLLQSSSEAHTTNLSPQLATVAETQIEAS
ISDVSSDYQDGPGAATT-AQPKP---------SNQELSDDDDDENDGGGYLFEDVVTNDD
SIVF------------------
>ABL128W
-------MTNGECNGIHNR--------------------AGAKEGIQLKKLPDLTEVTKS
N----PMQKLLAQAVGLHLKT------MRSDVGITQLGFENLVQFVELQLDDMLQILHRF
ANVQRRNE-VSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQ-HAGA----VRSIEEQSA
SLMGHWHQPM-----SEEELLSSSHAEFFFKDVDILNLVPPTN--------------NNN
HY-VPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHM--L------
--------------------GTAT------------------------------------
------------KKPRADDAQ-------------LPQIISDGQQENLLIYGPE-----RR
R-----------------LAPEPA-P-TRGFNIEDYARCRVELARRRVEEFEQQKLQVQK
NPFIRAAAAC-------------------------SPYATT-RLS----------RKAIE
REFGVLLHRSYIGVLH-AIPRLRRTKARELAAAYERE----RARQESMRNNTDL------
-----TQQQHGVL-------------DLSALHDD-----PLLADLD--------------
----------------------SSDSDDDRQPPSPRKPPDPTESDAPSPPTAD-------
---TATPAPPSPLANPPVLD----------------------------------------
--AAPEPLSVPPPIEKL-GSPDT----------NAASAS---------------------
----------------------
>Ecym_4609
-------MTTDIKSSDGST--------------------EGAKEFIQLKKLPGLQEVAKH
N----PMQILLSQSVALQLKT------MKSDFSITELGFNNMMQFIEMQMNDMFQILHRF
ANIQRRNE-ISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKT-YEAE----FKNIERQSL
DLVEKWQKPL-----RDEELLSSNHAEFFFKDVDILNLVPPTN--------------INN
SY-VPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNM--LG-----
--------------------SAQA------------------------------------
------------KMLKVEDEE------------TIAQTYKESQEETQLIYGVE-----KQ
RPRRENAYVGGNSTNNDDLPLNSS-H-SKGFNIQEYARSRIGLARRKVEEFENHKLQAQK
NPFIRASSIC-------------------------SPYGNAQKTT----------RKAAE
REFNILLRRSYVGVLK-SIPKLRQLKANEMAAAIERE----RIKQKEREMELEK------
-----KHLQQGVV-------------DLNALHED-----ALLADLD--------------
----------------------STDSEDDEPMMGSKKQELGFSEIANPLQAKKIL---AQ
DSTLNVSSDIESTSSARPSS-------------------------------------KPP
QQQPLQDVTTPPASENT-TSPHH----------SAIHLTPTGPLIGSTPFVPH-------
----------------------
>NDAI0E00300
-------MAS-----------------------------ANETENYDMNEVQPPREIAHN
H-MDMQIEKLLQKSIAIQLKA------FKVD--FSKLAFNQLTLLVDDQLNSLITELHRL
SLLQRRNS-MAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKE----YRILRDLNE
EVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTN--------------PFK
GINISSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNF--LKNISNA
KKGTSIAPMTIPPSPSLS--NEGP------------------------------------
--------ITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIE
RDSSSKPNIISIHDEKIVNFFGHS-SSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEK
NPFLKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDN-RLSPIR------KRAQIN
NEIISNLKRSFYSILN-NYPKLKKAKKQRVKLAIEKR----DQRLQELRKIQE-EERKVK
EQKLLTKSENPLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSSEEEEEE------
----------------------EEEEEEGEQQTATTHNVLQQLGSQRKEKEGTMT---TT
GN-TSVKIGEKQTDISVEPN--NHETTEGSTQDIRTTEEQTNVEQ-------AKQKPTDG
QGKEELEDEEEDDFDDH-NFLFE----------DVVTSEFDKPGEDNKSTIVPNTNADIE
LI--------------------
>NCAS0B00310
MAETVTSSSSPTLKKEQDLI------------L------NDTQEEPLMNELTNPTEIPSN
S-SDEQVRKLLNKSIALQLKP------LNLE--LSQLAFNELSLLVNDQLDFLISELHRM
SVIQRRNA-AAKTDIELLLRGLNLNMSELHYQLQVSNFMKSK-NGKD----YDTLIKDSS
TIFDSSDTMA-----NPGHD--------SMVNNPSNILIKPNN--------------PFE
IS-IPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNL--LN-----
--------------------DITE------------------------------------
------------QSSIENEET-------------SNFDSELAREENIAIYGYDA----MS
RKKRKPPHLISIHDTE-QNFFNHP-QGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEK
NPFLRLSRMI----------------------------NDK-KVS----------RSDLK
LEIKNSLQRSYKSIFR-NYPKLKQERDRRLELARQKR----EEKIEKLKIQNEQLK----
-----KDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIATNI-----------
----------------------EDVEDDGIGLFGDLESSDEDNDDKVNNTNTSID---NN
NILPVDGTPDNETASVASNI--IAVAPNQPEEIISSVSDSIN----------ENVTLKNP
NEPKHTESDDSGTFDDQ-NFLFQ----------DVATSEIDKLNNGNDTIV---------
----------------------
>TPHA0I00230
MTAMVTNETIRTSDLLQGSDGDKAVEKFEHQDIGMDKEVTEQKKYVQLTKLPTLTEFKYE
D-TKGPMEVILAKAIALQLKL------MNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKL
AALQRRKE-VAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEK-YGGE----VTLLNRLAT
DTNEVLTVFK-----KTDKTLK------DDSTLETLKLVPITN--------------TLE
NI-IPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESE-----
--------------------KITT------------------------------------
------------SKLLNLDKF-------------DSDDMDTAKLEMDALYSGGS----CD
RKKRT----AFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQN
DPFLKMTALL-------------------------SEQTDK-KVS----------REVIN
TNIENVLKRSFLQLIN-SIPTLNQNKKDTRERAMVEK----KRRHDEWLKRREEKLKKLE
QEKNLRAQAFGAI-------------DLSSFTNIDDG--GFLDGFDSSENEQELEIRA--
--------------------KSSQNNSKDISSTGPGSWDKEEANPVAIGTSVNTK---SL
EI-KTSGQTNQNMEPVLSNE--IESVTSEGLEVEKLEVQEDQMQGETDVVHTTGEEVIQE
IKQSETPINFPTMATTT-ITTTE----------TNISTTETTTITETTPNINSGLEESND
TN--------------------
>Kpol_1068.10
-------MT------------------------------GEATKYIQLTELPTLTEYKYE
E-TEPAIEKILAKAVALQLKS------MNCDTSITKFAFEHLMSLVVGQIDDMVLELHRL
SSLQRRNT-VAKADISVWLRGFNLTPEDLEEQNQKSQYLSKL-YDKD----YESLTKIAT
TTTRTLSTYQ-------KLDLTHK----DTSTAQTSKLVPISN--------------PLQ
KL-IPSWLPDFPPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNL--LR-----
--------------------GGQE------------------------------------
------------DRISRDLKF-------------SSSEMELATEETLATYSAIT----LR
NK-------------HLTSFFEKE-PIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQR
NPFLKISRLI-------------------------SANNDN-KVS----------KSVAN
TEIRKYLKRSLLNFIH-SIPKTQQERKEARERAEEEK----ERRLAEIKALKEEKLKEME
AK---KSSDFNLL-------------DLSNYPNDSHG--GFFAALESSDEERELIIQPRL
SSYTRNNSGVSSNETQADSVKNANENENENENEAIKAGKELENDTTDSVKDIPTE---EN
KIHTDANTAATEKVETIQNNNSDDAKTAQDNEKETVEKTETAPAIENSEQTVKEPETTES
NGIGSSTDTTKDKEPVI-SNPEEPQVNSDINEPTASSTTDTTLQQAQEPEKEEVEADNGQ
SIENVEPLTTAEPGSEPKPILD
>ZYRO0G14146g
-----------------------------------------MDNYIQITKLPTLQELQHE
D-REPNVVKVLAKSVALQLKP------MNAQ--ITQFAFDRLLQLVDGQLNDMISQLHRM
SNLQRRET-IAKGDISMLMEGFNISPSSIELQSRISEFYSQK-YFKE----FNHLHSLRD
LQSSLAHEMV-----PFEDQE-------AVRQNVSTVLVPPTN--------------PLQ
DF-LPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHL---------
--------------------SQK-------------------------------------
------------KNPTDDIVN------------RSQYDSELAEQETLAIYGSQL----KK
RK-------TQHPQANSADLLSKL-P-QTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQ
DPFLKLSRIA-------------------------FTQCND-KFT----------KKQVH
REFQLALQRSFIHLVK-SIPELERNKLETEEKAKEER----SKRLQELRAQREEQE----
-----KKGERDVL-------------DLDE------------------------------
----------------------LDQNQEDFFAMESSDEEVMEPTVDKPPLEQPQQ---TE
TA-QNEPQQPELIQEHVQEK--SQHEQEQEQEQVQ-----------------EPERIGEE
IQPATQEIADLPPQEPQ-GEPLQ----------GRPQEEDISIELSSNPSEDEDLNNSTY
PV--------------------
>TDEL0B00590
-------MED-----------------------------HSHERHIQLTHLPTLDEIDHG
K-TEAAVVKILSKAVALQLKP------MKAD--ISKFAFEHLMILIDDQLNDMIGQLHRF
SNVQRRES-IAKGDVHLFLQGYNLTPADLDKQHQASQYYSKT-YGKE----FDSLHSLKE
TFTDAVVDED------------------NGSEDVINELVRPNN--------------PLI
RY-IPKWMPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHL--LK-----
--------------------NMNP------------------------------------
------------PTPSSDADG-------------ASYDEALVREETAAIYGNEQ----KK
RK---------KNASSSSDLLSKL-P-QTNFSIEEYARSRVEIARKKVVEYEERQMKLQR
NPFIKYSKIA-------------------------LSNSSD-KSG----------RRQAT
REIHSMLQRSLQHLIK-SIPELQMTKQDARRKAEQKR----DERLQELRDKKAQKLKNFT
DQQL-ENGDINLL-------------DLDENNDD-------FFNYSGSED----------
----------------------EDLPQAEFENPSMTNDIPVPNLPTPAPEEHSRA---EA
QS-HSEVQPVIESNAQPEAQ--AQAQSESQAQAESMAEVEQQTPAQMETQVMPEAESHQE
RSSVESQHELASPPEVD-AQPQE----------QESDEDDTNFLFDESITTEQQDEIQL-
----------------------