MUSCLE (3.8) multiple sequence alignment

TBLA0B03270        ----MVLNFSIIKEKQKQKD-------------------ELPTTRSKLYPKKSVYDRKRR
TPHA0C04780        ------MKFSPLKLFRFSRNSYKLP--------------LSEKTKEKRKNRDFRLLPKYS
ABL124W            -----------------------------------------------------------M
Kpol_541.15        ----MDFLLNNKRQLKKKDELP-----------------ISDSRWAPKSKYRHKFNPANS
KLLA0D01529g       ----MVVFVKDKRLELPMHHDS-----------------KQKGNHFRPKSGFGLFFAKIN
Ecym_4613          MLFSISERYKAMGQSNQRSQVYYLF--------------DTIYTNVPLSPQNSRYHPKVK
KNAG0G03420        ---MSLLNWRRRAASQSR---------------------ELPTYMGTKDNKTAKFVPKRK
NCAS0B00300        ----MDLLIKVKKGVQNKAQQEELLPTS-----------RNNSNYGDEEQKKNSFVPKRR
NDAI0E00290        ---MFGLLHKFGRNSRKDAKLELPI--------------SRNNSNVADELKKQRFIPKKK
CAGL0B02321g       MMMSIPSFRDLAKLRRSADNKRGGEYSLP----------ISRTGSEATLSKHDKFIAKKK
TDEL0B00560        ----MMFRWGSKREKRKDDDNY-----------------RLPVSRSKLNPKTKSASFTWN
KAFR0A02830        ----MEFVRNLKRLSYKKGSVGGLP--------------RTNSLYETDSEKKLNFTPKNR
Skud_13.26         ----MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRST
Smik_13.19         ----MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSK
YML115C            ----MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRST
Suva_13.28         ----MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSS
ZYRO0G14234g       ----MAAFWSLKKKLKKADDDDDGY--------------KLPTSHSKLSPKG-----KRS
SAKL0D01430g       ------------------------------------------------------------
KLTH0C03828g       ------------------------------------------------------------
Kwal_27.10246      ------------------------------------------------------------
                                                                               

TBLA0B03270        SPAF----YWTCILATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKN
TPHA0C04780        KFKVTNFRDKVSNFNVALSVILLCIFIAKTISVNVS---IYKYNSFVHEEETETV--TFD
ABL124W            NYKLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEWE
Kpol_541.15        E---NFVKINAIITLILFLVFICQNSFSSSSSNVVD---SH----------------TNE
KLLA0D01529g       GLRYAKSRIVFLFALVLVSTFLLLSKLVGG-------------NVNLM---------QYI
Ecym_4613          -GKFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRN---GSTPRSYAGLLSISD---SYD
KNAG0G03420        RQTLLRLISLLGLVVFVAVSTVSLSRYLRG---------PASINKILKKLESGNH--NYK
NCAS0B00300        ----KTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTS---KYDSVTNLHAGQNTKTA-SYK
NDAI0E00290        STAKNVAIGSVVSFIICALIYCGYSYFFNTS--------PRLGKINLYANKNNKVSTSYK
CAGL0B02321g       NFKFRKLATGAIIVIVIVSIFLVFFNIEVSP--------ISLPSSFYHK--------EYL
TDEL0B00560        GSRVKRIANWALISVICFLMFKFLSTVILG---------SSESSSPLPSIWTK----SYD
KAFR0A02830        KRRLNYAKIIFGFFVSFLILFLMLNFEFNA---------SKLNKTIIDI--------AQK
Skud_13.26         LSKLQLSVSFISIIIITVLSLYLLISRLAGLNVNVS---LRDGKSLLSPSESSE---NYK
Smik_13.19         SSKFQMTVNAISLIIITILSLYLSISFLTGMSIGVP---IQNGRPLLGSSKSSD---NYK
YML115C            PSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVS---TQNGRSLLGSSKSSE---NYK
Suva_13.28         SSKFQLAVNVISLVIIIVLSLYLMILFLSEMKLGIS---IQNGNPLLGSE-------NYK
ZYRO0G14234g       SWQNRKIVSWVIITVMVLILYKAFSGVVRG---------GREVMKTVGSNTS-----SND
SAKL0D01430g       --------------MVILIIFFLLNSILGG-----------DPYV------------NYK
KLTH0C03828g       ------------------------------------------------------------
Kwal_27.10246      ------------------------------------------------------------
                                                                               

TBLA0B03270        AKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGD---VVTSKDKERYIQEMENL
TPHA0C04780        TQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKL
ABL124W            PQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ------ISRDDPEFEEQMEEL
Kpol_541.15        AKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSE---VLTPEDKSRYEQELQEL
KLLA0D01529g       PTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGME---ALSSEDKEAFEREADML
Ecym_4613          TAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT-----LNSNQEEGFEEHLDML
KNAG0G03420        TVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGND---VLTPKDQERYEAEVKQL
NCAS0B00300        TKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTD---VLTPSDNEVYAKELQMV
NDAI0E00290        TTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTD---VLTPKDKEQYEKELAML
CAGL0B02321g       PFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTE---NPSESDLAEYNDNLQML
TDEL0B00560        TITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEE---TMTSEETTKFEQEVSML
KAFR0A02830        TINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTD---VLTPEDQEIYEREMNML
Skud_13.26         TIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSE---VLPPENEEEYQKELNML
Smik_13.19         TIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSD---VLTPKDDEKYQSELSML
YML115C            TIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSE---VLTPKDDEKYQRELNML
Suva_13.28         TIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSE---VLTPGDNEKYQEEMSML
ZYRO0G14234g       GQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGND---VLTPQDGEVFEREQKML
SAKL0D01430g       TFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAE---VLTPEDNERYEKEVEML
KLTH0C03828g       --------------------MLRKFDNGAEHYLISKGGQE---ILDSSDKERYEEEVKSL
Kwal_27.10246      ------------------------------------------------------------
                                                                               

TBLA0B03270        LSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAF
TPHA0C04780        LSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAF
ABL124W            VSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAF
Kpol_541.15        LSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAF
KLLA0D01529g       LASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAF
Ecym_4613          LSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAF
KNAG0G03420        FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF
NCAS0B00300        LDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAF
NDAI0E00290        LDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAF
CAGL0B02321g       LDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAF
TDEL0B00560        LDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAF
KAFR0A02830        YDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAF
Skud_13.26         LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF
Smik_13.19         LDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAF
YML115C            FDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF
Suva_13.28         LDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF
ZYRO0G14234g       LSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAF
SAKL0D01430g       LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF
KLTH0C03828g       LDSTVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAF
Kwal_27.10246      ----------------------------MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAF
                                                 ***:*  :**::*.::**:********:**

TBLA0B03270        LVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASI-AKSEKKNENPN-KHYLKFMDQ
TPHA0C04780        LVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKK
ABL124W            LVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGG-DLYLKYMDQ
Kpol_541.15        LVSDCTEGDHTLESLIAYSRHLQDGTLAGLF-----QE-MDKDDSKKDSE-KLYLKYMNK
KLLA0D01529g       LVSDCTDNGRTMSSLLDFSKELQNGTLSKTL---QDFE-AD-KDKGNSAE-QLYLKYMGK
Ecym_4613          LVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYK-MHKKSKSKNKEGDLHLKYMNK
KNAG0G03420        LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVT-DYLNAKDRKNN-KLYLKYMKQ
NCAS0B00300        LVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYE-MDHSKKSKGTK-NLHLKYMNP
NDAI0E00290        LVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQ-YEHSDDTRGTK-NLHLKYMNQ
CAGL0B02321g       LVSDCSEGDKTLEALETYSQLLQEGILPDIL-----AD-MDNYNKGKSNE-SIHLKYMEP
TDEL0B00560        LVSDCSEGDHTLDALIAYSRQLQNGTLSQVF---AEVE-MSEKERKKGGE-NLYLQYMDQ
KAFR0A02830        LVSDCSENDNTLDALIEFSKNLQNGTLSQVL---NEID-AFTKEETSTKS-NLHLKYMDP
Skud_13.26         LVSDCSEGDTTLDALIAYSRQLQNGTLSQIF---QDID-AIIDSQTKGTD-KLYLKYMDE
Smik_13.19         LVSDCSEDDTTLDALIAYSRQLQNGTLSQIF---QEID-AVIDSQTKGTD-KLYLQYMDQ
YML115C            LVSDCSEGDTTLDALIAYSRHLQNGTLSQIF---QEID-AVIDSQTKGTD-KLYLKYMDE
Suva_13.28         LVSDCSEGDTTLDALIAYSRQLQNGTLSEIF---QEID-AVIDSQTKGTD-KLYLKYMDE
ZYRO0G14234g       LVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAA-AEAEQASKGTE-KLYLKYMNP
SAKL0D01430g       LVSDCSEDDDTLDALIAYSKELQNGTLSELFA--EQDE-MRRKASIKGSP-DLYLKYMNQ
KLTH0C03828g       LVSDCSEDDKTLEALLEYCKELQSGTLSDVFA--AHSS-DEELIKEKGTH-DLFLKYMRP
Kwal_27.10246      LVSDCSEDDRTFEALLEYAKELQSGTLSQVFA--SHNS-GENVLREEGSS-DLFLKYMRP
                   *****:... *:.:*  :   **.* *   :                    . .*::*  

TBLA0B03270        NYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
TPHA0C04780        EYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRAR
ABL124W            EYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRAR
Kpol_541.15        DYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRAR
KLLA0D01529g       DYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRAR
Ecym_4613          DYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKAR
KNAG0G03420        EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR
NCAS0B00300        DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
NDAI0E00290        EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
CAGL0B02321g       DYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
TDEL0B00560        DYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARAR
KAFR0A02830        EYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
Skud_13.26         DYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
Smik_13.19         NYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
YML115C            GYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
Suva_13.28         DYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
ZYRO0G14234g       DYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRAR
SAKL0D01430g       DYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRAR
KLTH0C03828g       SYLKMVKDAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
Kwal_27.10246      SYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKVQGTRRKLMGRAR
                    *:: .  :     *  *.*.***:*:: *:*** :** *::** *.*** **.**..:*

TBLA0B03270        NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYD
TPHA0C04780        NWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYD
ABL124W            NWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYD
Kpol_541.15        NWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYD
KLLA0D01529g       NWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYD
Ecym_4613          NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYD
KNAG0G03420        NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD
NCAS0B00300        NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYD
NDAI0E00290        NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYD
CAGL0B02321g       NWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYD
TDEL0B00560        NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYD
KAFR0A02830        NWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYD
Skud_13.26         NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYD
Smik_13.19         NWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYD
YML115C            NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYD
Suva_13.28         NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYD
ZYRO0G14234g       NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYD
SAKL0D01430g       NWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYD
KLTH0C03828g       NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYD
Kwal_27.10246      NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRPLPEFLSGEQAYD
                   *** :*******:******.*:*****::::*:*  . ** ********* *:   * **

TBLA0B03270        LNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVS
TPHA0C04780        LNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVS
ABL124W            LNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVS
Kpol_541.15        LNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVS
KLLA0D01529g       LNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVS
Ecym_4613          LNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVS
KNAG0G03420        LNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS
NCAS0B00300        LNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVS
NDAI0E00290        LNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVS
CAGL0B02321g       LNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVS
TDEL0B00560        LNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVS
KAFR0A02830        LNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVS
Skud_13.26         LNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVS
Smik_13.19         LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS
YML115C            LNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVS
Suva_13.28         LNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVS
ZYRO0G14234g       LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS
SAKL0D01430g       LNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVS
KLTH0C03828g       LNSWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVS
Kwal_27.10246      LNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVS
                   **** **  .: **: * **:*********.*:* **   *.   :. . :::*******

TBLA0B03270        ILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKD
TPHA0C04780        ILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMA
ABL124W            ILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMD
Kpol_541.15        ILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLE
KLLA0D01529g       ILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLRE
Ecym_4613          ILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLME
KNAG0G03420        ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE
NCAS0B00300        ILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLME
NDAI0E00290        ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKE
CAGL0B02321g       ILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLA
TDEL0B00560        ILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKE
KAFR0A02830        ILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKE
Skud_13.26         ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
Smik_13.19         ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
YML115C            ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
Suva_13.28         ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
ZYRO0G14234g       ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLRE
SAKL0D01430g       ILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKE
KLTH0C03828g       ILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQ
Kwal_27.10246      ILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHYTLWHIYEPSDDDLIQ
                   **..* :** * :*.**:********.*****..: : *.** :* :*******:**:  

TBLA0B03270        MAAIERGEYNQN-----
TPHA0C04780        IATKEKERTA-------
ABL124W            IARRERENRRS------
Kpol_541.15        IASKERENNRS------
KLLA0D01529g       IAKLERESRRNQR----
Ecym_4613          IARKERSSRRS------
KNAG0G03420        IANKEREKRRE------
NCAS0B00300        IANKERQNKRG------
NDAI0E00290        IANKERQSRHKE-----
CAGL0B02321g       MAKLEKGK---------
TDEL0B00560        IGNKEREKRRE------
KAFR0A02830        MANKEREERR-------
Skud_13.26         IATREREKRREENQDES
Smik_13.19         IAAKEREKRREAEE---
YML115C            IASREREKRRQSE----
Suva_13.28         IATREREKRRQS-----
ZYRO0G14234g       IANKERESRRE------
SAKL0D01430g       IAKKEREKRRD------
KLTH0C03828g       IAEREREKKRS------
Kwal_27.10246      VRERERESKRQ------
                   :   *.           

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B03270
----MVLNFSIIKEKQKQKD-------------------ELPTTRSKLYPKKSVYDRKRR
SPAF----YWTCILATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKN
AKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGD---VVTSKDKERYIQEMENL
LSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAF
LVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASI-AKSEKKNENPN-KHYLKFMDQ
NYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYD
LNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVS
ILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKD
MAAIERGEYNQN-----
>TPHA0C04780
------MKFSPLKLFRFSRNSYKLP--------------LSEKTKEKRKNRDFRLLPKYS
KFKVTNFRDKVSNFNVALSVILLCIFIAKTISVNVS---IYKYNSFVHEEETETV--TFD
TQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKL
LSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAF
LVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKK
EYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRAR
NWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYD
LNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVS
ILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMA
IATKEKERTA-------
>ABL124W
-----------------------------------------------------------M
NYKLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEWE
PQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ------ISRDDPEFEEQMEEL
VSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAF
LVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGG-DLYLKYMDQ
EYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRAR
NWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYD
LNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVS
ILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMD
IARRERENRRS------
>Kpol_541.15
----MDFLLNNKRQLKKKDELP-----------------ISDSRWAPKSKYRHKFNPANS
E---NFVKINAIITLILFLVFICQNSFSSSSSNVVD---SH----------------TNE
AKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSE---VLTPEDKSRYEQELQEL
LSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAF
LVSDCTEGDHTLESLIAYSRHLQDGTLAGLF-----QE-MDKDDSKKDSE-KLYLKYMNK
DYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRAR
NWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYD
LNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVS
ILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLE
IASKERENNRS------
>KLLA0D01529g
----MVVFVKDKRLELPMHHDS-----------------KQKGNHFRPKSGFGLFFAKIN
GLRYAKSRIVFLFALVLVSTFLLLSKLVGG-------------NVNLM---------QYI
PTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGME---ALSSEDKEAFEREADML
LASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAF
LVSDCTDNGRTMSSLLDFSKELQNGTLSKTL---QDFE-AD-KDKGNSAE-QLYLKYMGK
DYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRAR
NWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYD
LNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVS
ILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLRE
IAKLERESRRNQR----
>Ecym_4613
MLFSISERYKAMGQSNQRSQVYYLF--------------DTIYTNVPLSPQNSRYHPKVK
-GKFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRN---GSTPRSYAGLLSISD---SYD
TAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT-----LNSNQEEGFEEHLDML
LSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAF
LVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYK-MHKKSKSKNKEGDLHLKYMNK
DYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKAR
NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYD
LNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVS
ILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLME
IARKERSSRRS------
>KNAG0G03420
---MSLLNWRRRAASQSR---------------------ELPTYMGTKDNKTAKFVPKRK
RQTLLRLISLLGLVVFVAVSTVSLSRYLRG---------PASINKILKKLESGNH--NYK
TVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGND---VLTPKDQERYEAEVKQL
FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF
LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVT-DYLNAKDRKNN-KLYLKYMKQ
EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR
NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD
LNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS
ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE
IANKEREKRRE------
>NCAS0B00300
----MDLLIKVKKGVQNKAQQEELLPTS-----------RNNSNYGDEEQKKNSFVPKRR
----KTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTS---KYDSVTNLHAGQNTKTA-SYK
TKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTD---VLTPSDNEVYAKELQMV
LDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAF
LVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYE-MDHSKKSKGTK-NLHLKYMNP
DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYD
LNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVS
ILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLME
IANKERQNKRG------
>NDAI0E00290
---MFGLLHKFGRNSRKDAKLELPI--------------SRNNSNVADELKKQRFIPKKK
STAKNVAIGSVVSFIICALIYCGYSYFFNTS--------PRLGKINLYANKNNKVSTSYK
TTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTD---VLTPKDKEQYEKELAML
LDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAF
LVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQ-YEHSDDTRGTK-NLHLKYMNQ
EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYD
LNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVS
ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKE
IANKERQSRHKE-----
>CAGL0B02321g
MMMSIPSFRDLAKLRRSADNKRGGEYSLP----------ISRTGSEATLSKHDKFIAKKK
NFKFRKLATGAIIVIVIVSIFLVFFNIEVSP--------ISLPSSFYHK--------EYL
PFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTE---NPSESDLAEYNDNLQML
LDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAF
LVSDCSEGDKTLEALETYSQLLQEGILPDIL-----AD-MDNYNKGKSNE-SIHLKYMEP
DYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
NWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYD
LNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVS
ILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLA
MAKLEKGK---------
>TDEL0B00560
----MMFRWGSKREKRKDDDNY-----------------RLPVSRSKLNPKTKSASFTWN
GSRVKRIANWALISVICFLMFKFLSTVILG---------SSESSSPLPSIWTK----SYD
TITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEE---TMTSEETTKFEQEVSML
LDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAF
LVSDCSEGDHTLDALIAYSRQLQNGTLSQVF---AEVE-MSEKERKKGGE-NLYLQYMDQ
DYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARAR
NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYD
LNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVS
ILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKE
IGNKEREKRRE------
>KAFR0A02830
----MEFVRNLKRLSYKKGSVGGLP--------------RTNSLYETDSEKKLNFTPKNR
KRRLNYAKIIFGFFVSFLILFLMLNFEFNA---------SKLNKTIIDI--------AQK
TINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTD---VLTPEDQEIYEREMNML
YDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAF
LVSDCSENDNTLDALIEFSKNLQNGTLSQVL---NEID-AFTKEETSTKS-NLHLKYMDP
EYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYD
LNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVS
ILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKE
MANKEREERR-------
>Skud_13.26
----MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRST
LSKLQLSVSFISIIIITVLSLYLLISRLAGLNVNVS---LRDGKSLLSPSESSE---NYK
TIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSE---VLPPENEEEYQKELNML
LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF
LVSDCSEGDTTLDALIAYSRQLQNGTLSQIF---QDID-AIIDSQTKGTD-KLYLKYMDE
DYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYD
LNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVS
ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
IATREREKRREENQDES
>Smik_13.19
----MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSK
SSKFQMTVNAISLIIITILSLYLSISFLTGMSIGVP---IQNGRPLLGSSKSSD---NYK
TIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSD---VLTPKDDEKYQSELSML
LDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAF
LVSDCSEDDTTLDALIAYSRQLQNGTLSQIF---QEID-AVIDSQTKGTD-KLYLQYMDQ
NYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYD
LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS
ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
IAAKEREKRREAEE---
>YML115C
----MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRST
PSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVS---TQNGRSLLGSSKSSE---NYK
TIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSE---VLTPKDDEKYQRELNML
FDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF
LVSDCSEGDTTLDALIAYSRHLQNGTLSQIF---QEID-AVIDSQTKGTD-KLYLKYMDE
GYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYD
LNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVS
ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
IASREREKRRQSE----
>Suva_13.28
----MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSS
SSKFQLAVNVISLVIIIVLSLYLMILFLSEMKLGIS---IQNGNPLLGSE-------NYK
TIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSE---VLTPGDNEKYQEEMSML
LDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF
LVSDCSEGDTTLDALIAYSRQLQNGTLSEIF---QEID-AVIDSQTKGTD-KLYLKYMDE
DYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYD
LNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVS
ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE
IATREREKRRQS-----
>ZYRO0G14234g
----MAAFWSLKKKLKKADDDDDGY--------------KLPTSHSKLSPKG-----KRS
SWQNRKIVSWVIITVMVLILYKAFSGVVRG---------GREVMKTVGSNTS-----SND
GQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGND---VLTPQDGEVFEREQKML
LSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAF
LVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAA-AEAEQASKGTE-KLYLKYMNP
DYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYD
LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS
ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLRE
IANKERESRRE------
>SAKL0D01430g
------------------------------------------------------------
--------------MVILIIFFLLNSILGG-----------DPYV------------NYK
TFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAE---VLTPEDNERYEKEVEML
LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF
LVSDCSEDDDTLDALIAYSKELQNGTLSELFA--EQDE-MRRKASIKGSP-DLYLKYMNQ
DYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYD
LNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVS
ILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKE
IAKKEREKRRD------
>KLTH0C03828g
------------------------------------------------------------
------------------------------------------------------------
--------------------MLRKFDNGAEHYLISKGGQE---ILDSSDKERYEEEVKSL
LDSTVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAF
LVSDCSEDDKTLEALLEYCKELQSGTLSDVFA--AHSS-DEELIKEKGTH-DLFLKYMRP
SYLKMVKDAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYD
LNSWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVS
ILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQ
IAEREREKKRS------
>Kwal_27.10246
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAF
LVSDCSEDDRTFEALLEYAKELQSGTLSQVFA--SHNS-GENVLREEGSS-DLFLKYMRP
SYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKVQGTRRKLMGRAR
NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRPLPEFLSGEQAYD
LNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVS
ILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHYTLWHIYEPSDDDLIQ
VRERERESKRQ------