MUSCLE (3.8) multiple sequence alignment

TPHA0C04790        ---------MDSKNNNNKAAIAASTYEIGR---SDSDSDNSTVNSSQKIDSSEQVVPTDS
TDEL0B00550        -------------------MFDRAAVNGGQ---VTALKSSHENEIERNLSREDKMLTTEK
TBLA0D03270        --------MFSMEENPSDNTINEINYTNNE---DCKNPEQQSLKNIDSRSSLNSSLTQVL
Kpol_541.16        ----------------------------MD---TDLKKKNIEVSSYIAEETIRSDCSDAN
Suva_13.467        ----------MYPVIEEKVNVQSKDSPVID----KISMKAEDKVVVSSEDEDVTTVASSN
YMR279C            ----------MFSIFKKKTSVQGTDS-EID---EKITVKAKDKVVVSTEDEEVTTIVSST
Skud_13.451        ----------MLPSFERKMSVQGTSSPVND----KISMKEEDKVIVSTDEEVTTVASSSK
Smik_13.492        ----------MLPIFKKKMSVQGTDYQIHD----KTIMKVDDKVVISTEDEEVTTVTSSN
KAFR0B03940        -------MLKLYRKKLKQQEEEKNPIEDFQ-----TTTVTAQTSLDVLSDSVKKDQISIT
KNAG0J00260        --------MELSDSESECTKTITRDHITIN---QEAEYTKNDQTNVEEKKNCSTESEAEW
CAGL0M03003g       MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDECQSNSDQLSVTSKGCI
NDAI0K00400        -------MPTHITEIKEPVSVNEANLLESQ---STIDCTSSERKTAIKEQDDEIGSDSTT
NCAS0C00400        ---------------------------------------------MENKEPIVSSSQKKT
SAKL0D01386g       -----------------------------------MWFKRSNESVSSQSKELGTQSATAF
KLTH0C03806g       -----------------------------------MNSEYTPVSKQRTGSDISRKVVDNH
Kwal_27.10245      -----------------------------------MNMKENDDEENWEKLQSSSAAGEER
KAFR0A02840        ------------------------------------MAESRTSSIKEHIQSDISIDKSSN
KNAG0G03430        --------------MSFLLNYLKKDKKKNH---KNAIDEVSSGWTVENTDSDKLGSGNET
NDAI0E00280        -------MLKHFHRHNSKNVEEEKEITQST---SSIIEEECSSITKEENNEVSEDELPSS
NCAS0B00290        -------MFRIFNRKSHRS----EEIMESA---ASSITEETSIIKHGDIEEIEKDVISQT
CAGL0B02343g       -----------------------MGIFRKSGTDSVQQETLSSSSSGSSFKQDNNDIVDEK
Suva_13.27         --MIVGKEECVIQNPEVKTAGKEEDYLEIE---NEVALEAEDSSPRNNKEGALTTIVLTN
Skud_13.25         ----------MNEKSLVKSAESRQDSFEAE---NESVSAVKKSSRHDGNEETVTISTDHG
Smik_13.18         ----------MSVHVLVESEEKNDDCMEVE---NEAVFPPKKSSRDNGSEETLRGTAFTN
YML116W            -------------MGNQSLVVLTESKGEYE---NETELPVKKSSRDNNIGESLTATAFTQ
                                                                               

TPHA0C04790        EKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAED
TDEL0B00550        EAPVFVEEPESPW----QDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERE
TBLA0D03270        STDTADNDESSSY----QNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKE
Kpol_541.16        DESPSMELKNSSL----RNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQ
Suva_13.467        KSTQ--VSNDSPW----QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKS
YMR279C            KSTQ--VTNDSPW----QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKS
Skud_13.451        SNQ---ISNDSPW----QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKS
Smik_13.492        ESNQ--VTNDSPW----QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKS
KAFR0B03940        DDDVSSISNNSKW----QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADS
KNAG0J00260        CSESEFTDNDTPW----QNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADA
CAGL0M03003g       CSVDDCHENDSPF----QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADY
NDAI0K00400        TSSSSLQENNSSW----QNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDS
NCAS0C00400        LSCDSLLENSTPW----QNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISES
SAKL0D01386g       TEHSDVQVDDKKW-PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKN
KLTH0C03806g       EDSDMLLASRSRL----QNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSED
Kwal_27.10245      DGQTEAIGPKSRL----QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKD
KAFR0A02840        EKCEVIVREKSKW----QDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDS
KNAG0G03430        STHVATTDPNCKW----QDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKS
NDAI0E00280        EQEDNTIGDHSKW----QNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS
NCAS0B00290        ETPQL---EHSKW----QNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS
CAGL0B02343g       QCDTQAIDGNQKW----QNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADS
Suva_13.27         SEDEV-MKTKQKW----QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADS
Skud_13.25         EEMTV---DKQRW----QNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANS
Smik_13.18         LEDEM-VECNQKW----QNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDS
YML116W            SEDEM-VDSNQKW----QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDS
                                    ..  **     *  *: : :  :**. :        :.::   

TPHA0C04790        FGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTH
TDEL0B00550        LDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSH
TBLA0D03270        LDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAH
Kpol_541.16        LHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH
Suva_13.467        FNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSN
YMR279C            FNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSN
Skud_13.451        FGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSN
Smik_13.492        FNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSN
KAFR0B03940        LNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTE
KNAG0J00260        FNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH
CAGL0M03003g       FKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN
NDAI0K00400        FHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAH
NCAS0C00400        FHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTH
SAKL0D01386g       FDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTS
KLTH0C03806g       LKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAH
Kwal_27.10245      LNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAH
KAFR0A02840        FNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSK
KNAG0G03430        FHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTH
NDAI0E00280        FKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH
NCAS0B00290        FNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSH
CAGL0B02343g       LDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAH
Suva_13.27         FGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSG
Skud_13.25         FGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSG
Smik_13.18         FGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSG
YML116W            FGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSG
                   : :      **.::*.*  *****:.*..***:***  :  *     :*::: *.: :: 

TPHA0C04790        SDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFS
TDEL0B00550        NDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFA
TBLA0D03270        NDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFA
Kpol_541.16        SGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFS
Suva_13.467        NDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFG
YMR279C            SDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFG
Skud_13.451        NDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFG
Smik_13.492        SDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFG
KAFR0B03940        NVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWG
KNAG0J00260        NDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWS
CAGL0M03003g       SDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFG
NDAI0K00400        SDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWG
NCAS0C00400        SDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWG
SAKL0D01386g       SVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFS
KLTH0C03806g       NVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFS
Kwal_27.10245      NVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFS
KAFR0A02840        SDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFA
KNAG0G03430        SDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFA
NDAI0E00280        NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA
NCAS0B00290        SDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFA
CAGL0B02343g       SDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFS
Suva_13.27         SDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFA
Skud_13.25         SDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFA
Smik_13.18         SDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFA
YML116W            SDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFA
                   .  *:: ..:***:.::: ***: * :* :*  .   **. :* :.  .* *  :*  :.

TPHA0C04790        GIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLL
TDEL0B00550        GVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVL
TBLA0D03270        GLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLII
Kpol_541.16        GLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLIL
Suva_13.467        GLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLIL
YMR279C            GLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLIL
Skud_13.451        GLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLIL
Smik_13.492        GLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLIL
KAFR0B03940        GLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLIL
KNAG0J00260        GLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMIL
CAGL0M03003g       GLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLL
NDAI0K00400        GLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLIL
NCAS0C00400        GLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLIL
SAKL0D01386g       GLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMIL
KLTH0C03806g       GLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIM
Kwal_27.10245      GLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLIL
KAFR0A02840        GLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLIL
KNAG0G03430        GLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLIL
NDAI0E00280        GLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLIL
NCAS0B00290        GLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLIL
CAGL0B02343g       GLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIM
Suva_13.27         GLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVL
Skud_13.25         GLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVL
Smik_13.18         GLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLIL
YML116W            GLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLIL
                   *:        * * *::  :   .      : :*. :*.*     *** *:   : *:::

TPHA0C04790        FSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYEINYAE-VPLLPKAITGNRHIIMIL
TDEL0B00550        FNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAK-VPLLPKEVTESRSIIMIL
TBLA0D03270        LNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK-TPLIPKAISSNRGMLMIL
Kpol_541.16        FNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAE-NPLLPSEIIRNRQLIMIL
Suva_13.467        FNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK-VPLLPHAVTKNRHMIMIL
YMR279C            FNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAE-VPLLPRAMTKNRHMIMIL
Skud_13.451        FNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAE-VPLLPHAVTKNRHMIMIL
Smik_13.492        FNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAE-VPLLPHAVTKNRHMIMIL
KAFR0B03940        MNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAE-SPLLPPEVTKNRHIVTII
KNAG0J00260        FNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK-SPLLPPEVIKNRHIGMIL
CAGL0M03003g       LNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYAT-SPLLPPSVLENKKILMIL
NDAI0K00400        FNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAK-VPLLPKAVTQNGHILTIL
NCAS0C00400        FNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPI-SPLLPREVTKNGQILTIL
SAKL0D01386g       FNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYAN-DPLIPRPAMHNHRLLMTL
KLTH0C03806g       FNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAK-EPLLPRAVLFNRKLMMIL
Kwal_27.10245      FNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAK-QPLLPHSVLFNRKLMMIL
KAFR0A02840        FNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAP-SPLIAREITHSRNMIITI
KNAG0G03430        LNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAA-SPLLPRVITQNRHMVMIL
NDAI0E00280        LNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAK-SPILPVEVTKNRHIIMIL
NCAS0B00290        LNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAE-SPLLPVEVTKNRHIIMIL
CAGL0B02343g       LNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVL
Suva_13.27         LNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAK-SPLLPQAVMKDRHMIQIM
Skud_13.25         MNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAK-SPLLPRAVLKDRHMIQIM
Smik_13.18         LNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAK-SPLLPHAVIKDYHMIQIM
YML116W            LNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAK-TPLLPRAVIKDRHMIQIM
                   :.:.:*:..  **   *:*.:*:::.  :  *  :* .     *::.     .      :

TPHA0C04790        LAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPS
TDEL0B00550        ASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPA
TBLA0D03270        FSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPS
Kpol_541.16        TAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA
Suva_13.467        LAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPA
YMR279C            LAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPA
Skud_13.451        LAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPA
Smik_13.492        LAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPA
KAFR0B03940        ISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPS
KNAG0J00260        LAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPS
CAGL0M03003g       AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA
NDAI0K00400        TVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPA
NCAS0C00400        GILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPA
SAKL0D01386g       LAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPS
KLTH0C03806g       ASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPA
Kwal_27.10245      SSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPA
KAFR0A02840        FTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAP
KNAG0G03430        MALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISAS
NDAI0E00280        AALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISAS
NCAS0B00290        AALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAA
CAGL0B02343g       FALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPS
Suva_13.27         LSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPS
Skud_13.25         LALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPS
Smik_13.18         LALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS
YML116W            LALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS
                     :  ***::**: :**  * *.:* ::.:*:* :.* . : *   :   .  :.   ..

TPHA0C04790        IILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEY
TDEL0B00550        VLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQY
TBLA0D03270        VLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQY
Kpol_541.16        VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQH
Suva_13.467        FLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEY
YMR279C            LLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQY
Skud_13.451        LLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQY
Smik_13.492        ILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQY
KAFR0B03940        VLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQY
KNAG0J00260        VLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQY
CAGL0M03003g       VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY
NDAI0K00400        ILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQY
NCAS0C00400        VLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQY
SAKL0D01386g       LILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMEN
KLTH0C03806g       IILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQY
Kwal_27.10245      VILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQY
KAFR0A02840        VILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEY
KNAG0G03430        IILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQY
NDAI0E00280        VILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY
NCAS0B00290        FILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY
CAGL0B02343g       IILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQY
Suva_13.27         VFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEY
Skud_13.25         VFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEY
Smik_13.18         VYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY
YML116W            VFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY
                   . :  :   *  *  : :. .  ::::.  ..   :* .*:* .**.::*::** *. : 

TPHA0C04790        QGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIAS
TDEL0B00550        QGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISG
TBLA0D03270        QGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSG
Kpol_541.16        QGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAG
Suva_13.467        QGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISF
YMR279C            QGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISV
Skud_13.451        QGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISV
Smik_13.492        QGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISV
KAFR0B03940        QGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSF
KNAG0J00260        QGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAF
CAGL0M03003g       QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSL
NDAI0K00400        QGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAF
NCAS0C00400        QGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAF
SAKL0D01386g       QGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISA
KLTH0C03806g       QGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSG
Kwal_27.10245      QGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISG
KAFR0A02840        QGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLLAC
KNAG0G03430        QGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSL
NDAI0E00280        QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISG
NCAS0B00290        QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITA
CAGL0B02343g       QGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISG
Suva_13.27         QGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISG
Skud_13.25         QGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISG
Smik_13.18         QGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISG
YML116W            QGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISG
                   ***: **. *: .*: *: **:. . * : :  *   * *:..* * .:. .  .  .: 

TPHA0C04790        LYMFETFW-TDYKEKTKLANDIESSIERTG
TDEL0B00550        VFVLQKEL-MRSKSRKENELEYNGS-----
TBLA0D03270        GYMIECLW-KDRVLSLEENKQTDIESS---
Kpol_541.16        LYMVETIF-DSYKDRKEKDCENCEQ-----
Suva_13.467        TYMLETFW-NNRRDRQKDSVITEMS-----
YMR279C            TYMLENLW-NRHRKSEDRSLEA--------
Skud_13.451        TYMLETVW-NERKKCQRKSLEA--------
Smik_13.492        TYMLENFW-NKHKESEKKRLEAETS-----
KAFR0B03940        SYMAEDLW-IRYRKRRQNEKKEDKC-----
KNAG0J00260        CYLFEVLW-IGRKKRLEKRKEKTTATC---
CAGL0M03003g       VFLVTDIIAKRHRKRIESECESC-------
NDAI0K00400        LNVCHDIW-SKRNAKDPKDLQRCGTGSNI-
NCAS0C00400        LNLCYDLW-RKRKSRLDDIRSLNTNDSA--
SAKL0D01386g       LFMLENYL-RMRRRNVKEEV----------
KLTH0C03806g       AYAIEDWW-TRRRERSVRIKLDEKHQE---
Kwal_27.10245      AFMIEDWW-TSRRKRTT-------------
KAFR0A02840        ILVIDKLV-AKYRNKNSIKNSA--------
KNAG0G03430        IYMCERLW-IDRKERMESTSETNLS-----
NDAI0E00280        IYMAEVLW-AKRKERLSSNRDHDMS-----
NCAS0B00290        IYLGEILW-GKRKQHLAANVVPDLS-----
CAGL0B02343g       ALMLSEII-QGRKNEKDSAVVEIAK-----
Suva_13.27         LYMVECYI-KDHRAKAVAEDKRSMS-----
Skud_13.25         LYMVERII-KDHKAKARGR-----------
Smik_13.18         LYMVESFI-NDHKAKAATENDCATT-----
YML116W            LYMVESFI-KGRRARAAAEYDCTVA-----
                                                 

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0C04790
---------MDSKNNNNKAAIAASTYEIGR---SDSDSDNSTVNSSQKIDSSEQVVPTDS
EKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAED
FGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTH
SDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFS
GIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLL
FSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYEINYAE-VPLLPKAITGNRHIIMIL
LAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPS
IILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEY
QGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIAS
LYMFETFW-TDYKEKTKLANDIESSIERTG
>TDEL0B00550
-------------------MFDRAAVNGGQ---VTALKSSHENEIERNLSREDKMLTTEK
EAPVFVEEPESPW----QDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERE
LDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSH
NDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFA
GVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVL
FNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAK-VPLLPKEVTESRSIIMIL
ASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPA
VLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQY
QGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISG
VFVLQKEL-MRSKSRKENELEYNGS-----
>TBLA0D03270
--------MFSMEENPSDNTINEINYTNNE---DCKNPEQQSLKNIDSRSSLNSSLTQVL
STDTADNDESSSY----QNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKE
LDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAH
NDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFA
GLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLII
LNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK-TPLIPKAISSNRGMLMIL
FSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPS
VLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQY
QGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSG
GYMIECLW-KDRVLSLEENKQTDIESS---
>Kpol_541.16
----------------------------MD---TDLKKKNIEVSSYIAEETIRSDCSDAN
DESPSMELKNSSL----RNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQ
LHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSH
SGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFS
GLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLIL
FNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAE-NPLLPSEIIRNRQLIMIL
TAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPA
VLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQH
QGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAG
LYMVETIF-DSYKDRKEKDCENCEQ-----
>Suva_13.467
----------MYPVIEEKVNVQSKDSPVID----KISMKAEDKVVVSSEDEDVTTVASSN
KSTQ--VSNDSPW----QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKS
FNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSN
NDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFG
GLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLIL
FNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK-VPLLPHAVTKNRHMIMIL
LAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPA
FLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEY
QGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISF
TYMLETFW-NNRRDRQKDSVITEMS-----
>YMR279C
----------MFSIFKKKTSVQGTDS-EID---EKITVKAKDKVVVSTEDEEVTTIVSST
KSTQ--VTNDSPW----QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKS
FNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSN
SDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFG
GLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLIL
FNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAE-VPLLPRAMTKNRHMIMIL
LAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPA
LLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQY
QGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISV
TYMLENLW-NRHRKSEDRSLEA--------
>Skud_13.451
----------MLPSFERKMSVQGTSSPVND----KISMKEEDKVIVSTDEEVTTVASSSK
SNQ---ISNDSPW----QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKS
FGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSN
NDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFG
GLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLIL
FNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAE-VPLLPHAVTKNRHMIMIL
LAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPA
LLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQY
QGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISV
TYMLETVW-NERKKCQRKSLEA--------
>Smik_13.492
----------MLPIFKKKMSVQGTDYQIHD----KTIMKVDDKVVISTEDEEVTTVTSSN
ESNQ--VTNDSPW----QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKS
FNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSN
SDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFG
GLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLIL
FNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAE-VPLLPHAVTKNRHMIMIL
LAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPA
ILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQY
QGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISV
TYMLENFW-NKHKESEKKRLEAETS-----
>KAFR0B03940
-------MLKLYRKKLKQQEEEKNPIEDFQ-----TTTVTAQTSLDVLSDSVKKDQISIT
DDDVSSISNNSKW----QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADS
LNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTE
NVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWG
GLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLIL
MNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAE-SPLLPPEVTKNRHIVTII
ISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPS
VLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQY
QGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSF
SYMAEDLW-IRYRKRRQNEKKEDKC-----
>KNAG0J00260
--------MELSDSESECTKTITRDHITIN---QEAEYTKNDQTNVEEKKNCSTESEAEW
CSESEFTDNDTPW----QNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADA
FNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH
NDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWS
GLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMIL
FNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK-SPLLPPEVIKNRHIGMIL
LAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPS
VLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQY
QGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAF
CYLFEVLW-IGRKKRLEKRKEKTTATC---
>CAGL0M03003g
MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDECQSNSDQLSVTSKGCI
CSVDDCHENDSPF----QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADY
FKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN
SDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFG
GLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLL
LNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYAT-SPLLPPSVLENKKILMIL
AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA
VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY
QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSL
VFLVTDIIAKRHRKRIESECESC-------
>NDAI0K00400
-------MPTHITEIKEPVSVNEANLLESQ---STIDCTSSERKTAIKEQDDEIGSDSTT
TSSSSLQENNSSW----QNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDS
FHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAH
SDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWG
GLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLIL
FNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAK-VPLLPKAVTQNGHILTIL
TVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPA
ILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQY
QGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAF
LNVCHDIW-SKRNAKDPKDLQRCGTGSNI-
>NCAS0C00400
---------------------------------------------MENKEPIVSSSQKKT
LSCDSLLENSTPW----QNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISES
FHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTH
SDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWG
GLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLIL
FNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPI-SPLLPREVTKNGQILTIL
GILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPA
VLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQY
QGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAF
LNLCYDLW-RKRKSRLDDIRSLNTNDSA--
>SAKL0D01386g
-----------------------------------MWFKRSNESVSSQSKELGTQSATAF
TEHSDVQVDDKKW-PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKN
FDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTS
SVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFS
GLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMIL
FNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYAN-DPLIPRPAMHNHRLLMTL
LAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPS
LILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMEN
QGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISA
LFMLENYL-RMRRRNVKEEV----------
>KLTH0C03806g
-----------------------------------MNSEYTPVSKQRTGSDISRKVVDNH
EDSDMLLASRSRL----QNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSED
LKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAH
NVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFS
GLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIM
FNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAK-EPLLPRAVLFNRKLMMIL
ASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPA
IILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQY
QGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSG
AYAIEDWW-TRRRERSVRIKLDEKHQE---
>Kwal_27.10245
-----------------------------------MNMKENDDEENWEKLQSSSAAGEER
DGQTEAIGPKSRL----QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKD
LNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAH
NVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFS
GLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLIL
FNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAK-QPLLPHSVLFNRKLMMIL
SSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPA
VILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQY
QGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISG
AFMIEDWW-TSRRKRTT-------------
>KAFR0A02840
------------------------------------MAESRTSSIKEHIQSDISIDKSSN
EKCEVIVREKSKW----QDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDS
FNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSK
SDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFA
GLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLIL
FNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAP-SPLIAREITHSRNMIITI
FTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAP
VILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEY
QGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLLAC
ILVIDKLV-AKYRNKNSIKNSA--------
>KNAG0G03430
--------------MSFLLNYLKKDKKKNH---KNAIDEVSSGWTVENTDSDKLGSGNET
STHVATTDPNCKW----QDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKS
FHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTH
SDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFA
GLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLIL
LNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAA-SPLLPRVITQNRHMVMIL
MALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISAS
IILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQY
QGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSL
IYMCERLW-IDRKERMESTSETNLS-----
>NDAI0E00280
-------MLKHFHRHNSKNVEEEKEITQST---SSIIEEECSSITKEENNEVSEDELPSS
EQEDNTIGDHSKW----QNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS
FKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH
NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA
GLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLIL
LNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAK-SPILPVEVTKNRHIIMIL
AALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISAS
VILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY
QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISG
IYMAEVLW-AKRKERLSSNRDHDMS-----
>NCAS0B00290
-------MFRIFNRKSHRS----EEIMESA---ASSITEETSIIKHGDIEEIEKDVISQT
ETPQL---EHSKW----QNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS
FNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSH
SDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFA
GLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLIL
LNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAE-SPLLPVEVTKNRHIIMIL
AALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAA
FILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY
QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITA
IYLGEILW-GKRKQHLAANVVPDLS-----
>CAGL0B02343g
-----------------------MGIFRKSGTDSVQQETLSSSSSGSSFKQDNNDIVDEK
QCDTQAIDGNQKW----QNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADS
LDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAH
SDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFS
GLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIM
LNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVL
FALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPS
IILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQY
QGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISG
ALMLSEII-QGRKNEKDSAVVEIAK-----
>Suva_13.27
--MIVGKEECVIQNPEVKTAGKEEDYLEIE---NEVALEAEDSSPRNNKEGALTTIVLTN
SEDEV-MKTKQKW----QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADS
FGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSG
SDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFA
GLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVL
LNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAK-SPLLPQAVMKDRHMIQIM
LSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPS
VFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEY
QGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISG
LYMVECYI-KDHRAKAVAEDKRSMS-----
>Skud_13.25
----------MNEKSLVKSAESRQDSFEAE---NESVSAVKKSSRHDGNEETVTISTDHG
EEMTV---DKQRW----QNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANS
FGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSG
SDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFA
GLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVL
MNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAK-SPLLPRAVLKDRHMIQIM
LALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPS
VFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEY
QGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISG
LYMVERII-KDHKAKARGR-----------
>Smik_13.18
----------MSVHVLVESEEKNDDCMEVE---NEAVFPPKKSSRDNGSEETLRGTAFTN
LEDEM-VECNQKW----QNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDS
FGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSG
SDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFA
GLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLIL
LNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAK-SPLLPHAVIKDYHMIQIM
LALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS
VYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY
QGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISG
LYMVESFI-NDHKAKAATENDCATT-----
>YML116W
-------------MGNQSLVVLTESKGEYE---NETELPVKKSSRDNNIGESLTATAFTQ
SEDEM-VDSNQKW----QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDS
FGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSG
SDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFA
GLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLIL
LNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAK-TPLLPRAVIKDRHMIQIM
LALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS
VFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY
QGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISG
LYMVESFI-KGRRARAAAEYDCTVA-----