MUSCLE (3.8) multiple sequence alignment

KLLA0D01485g       -----------------------MNSGTSANHYQPSLIYGRPPVG----------YEQQV
CAGL0B02365g       -------------------------MTEKVKKHGRHYVPQTYY-----------------
NCAS0B00280        ---------------------MVGPHSRRNSGYQAFQLQQQQQQS----------QQYMQ
NDAI0E00270        ---------------------MKSYQQQQQENPYPRYNKSFSRRG----------SSYYM
ABL122C            --------------MTNYQRLGPLGQAVPGPGAGGQPASSGPAQG----------PGTGP
Ecym_4615          -----------------MRQLGQQQQENHRKSSNSYMANNQRLGA----------VDQDQ
TBLA0B03280        -----------------MSKHSRRWNGSNSRNNSRNRGTPFSTNN----------MMNDQ
SAKL0D01364g       -----------------------MPNYQNKNYSSHQYATMAPPNG----------IQPHY
KLTH0C03784g       -----------------MSSYTPSAHRSMGKHPKGLYAEQRSHVA---------------
Kwal_27.10239      ------------------------------------------------------------
KNAG0G03440        ------------MDFQLKRNNAQHGYNQNHPGFTQDSVNNRDAEN----------SGPRP
Smik_13.17         ----------------------MSNQNQRKPVANYAYRQQQDYNG----------MNAMV
YML117W            ----------------------MSNSNSKKPVANYAYRQQQDYNG----------MNAMV
Suva_13.26         ----------------------MSNSNSRKPSANHAYRKQHDHNG----------MNAMV
Skud_13.24         ----------------------MPNSNPRKPGANYAYRQQHDYNG----------MNAMV
KAFR0A02850        ---------------------MMRPSYSRKNSGFHIYQSQQPAQD----------QYYSA
TPHA0I00270        ----------------MKSPHKKMGNNNDQAHNNNENNAAHPFQQ----------QGGKV
Kpol_1068.5        MAGSPRKNSSNSHVTTQYQQSSQFPASQQQAGSYAQLQQQSHHNGGHLPILQQQQHQQQQ
ZYRO0G14256g       ---------------------MQQQQRQNQQHQGHWNAPYRSRER----------IQEHQ
TDEL0B00540        ---------------------MQSKESAQQPSLSPQQRHHQQQLH----------REY--
                                                                               

KLLA0D01485g       YDVAGRNGGSNH-----------HPPQYIY--------------YTHR------------
CAGL0B02365g       -----------------------SVPDLYF------PMAHAHAHAHPQ------------
NCAS0B00280        YNGQRQRKPSYGPLGPG------TNSMLFY--------QGEQARSQYF------------
NDAI0E00270        NVQQDQRSRKPSYISLNHSV---HNPNMVY--------QHDPNGSQYF------------
ABL122C            -----------------------GQPARFF------------------------------
Ecym_4615          KHGQEQDQEQEQDQDQDEQP---RPQQIHH--------------QRFF------------
TBLA0B03280        YLYQHQFYFNNPNATTNSNS---NNQTYFHQNFTNNNAYFDNSNQEFRINNSNTNMIDHT
SAKL0D01364g       -----------------------PQTMAYH------PMGPMNGGVQPT--------MQMS
KLTH0C03784g       --------------------------------------------LPEG------------
Kwal_27.10239      ------------------------------------------------------------
KNAG0G03440        TYPQVMYQFNQNTHGYPQGTVSKQAPLSQQ--------------SHPF------------
Smik_13.17         -----------------------GNPIIYH------PVDFINGAGQYG------------
YML117W            -----------------------GNPMMYH------PVDFVNGAGQYG------------
Suva_13.26         -----------------------GNPMLYH------PVDFMNGAGQYG------------
Skud_13.24         -----------------------GNQMMYH------PVDFINGVGQYG------------
KAFR0A02850        FDT--------------------TNPLMSY-------PQFEQPYGATF------------
TPHA0I00270        PFQQTIQPVMFSHRNMNPPPYNFQNRGYKHGTSENHMYSNHQGLSQLD------------
Kpol_1068.5        HQHQHQHQHQHQHQQPYLNS---GYPVYHQGLAGRDAVAAINMINSQL------------
ZYRO0G14256g       HQHQHQYQYQQQHPT-RVMA---NSPMAFP------PVGSLQ--AQYA------------
TDEL0B00540        -----------------------NSPGIYQ-----------HMVPQFM------------
                                                                               

KLLA0D01485g       GGSMPGS-------IPGSIPGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTPQT-----
CAGL0B02365g       PPQLMNS-------------PYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNN
NCAS0B00280        PTQQP-Y-------YQTS--PLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTT-----
NDAI0E00270        ATTQQAY-------YIPS--PLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSS
ABL122C            PGAEGMS-------LAAG--SMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRP----
Ecym_4615          PSGDVAS-------SLSAAASMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRP----
TBLA0B03280        SALNPTY-------YS----PIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIH----
SAKL0D01364g       LPSQQGY-------YAGS--PMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMH
KLTH0C03784g       SREYSGY-------YHGN--RVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGM-----
Kwal_27.10239      --------------------------------------------MSSPFLATPGV-----
KNAG0G03440        PQNFAQN-------FPPNS-PMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLP----
Smik_13.17         PSQHPAY-------YSNS--PLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-----
YML117W            PSQHPAY-------YTNS--PLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNM-----
Suva_13.26         PSQHPAY-------YTNS--PLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-----
Skud_13.24         SSQHPAY-------YTNS--PLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-----
KAFR0A02850        PPPLSSSTHFQQTYYKGS--PLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTP--
TPHA0I00270        SPINSSYSQYESHPYHSQQTPLPNPPPTPFDYAYGTTLLPSHILMNSPFVSTP-------
Kpol_1068.5        SNSPGVY-------YTNQ--HIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM-----
ZYRO0G14256g       PPQ-PAY-------YAAAGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFQSQQ
TDEL0B00540        -NSQPMY-------YPTG--PVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLF----
                                                               :.** : :.       

KLLA0D01485g       GGPMSAGT-------------------------------GANGVPVGSNNIMNLRNSSYK
CAGL0B02365g       ADLLAGGY----------------------------NRNNRSFQFRRNSGFVLQSNGNTP
NCAS0B00280        GHSQSAIF----------------------------------------QQPYMMTPNRAS
NDAI0E00270        QQQSQMFL----------------------------------YSQSPAGTPNRKSFSQLN
ABL122C            QAHFHPST-----------------------------------PGHSSHSLHHAQSARSS
Ecym_4615          QGHFHPSA-------------------------------------------SSHSNHSRS
TBLA0B03280        SFPYSATS--------------ISSTPTRKSFSRKNSNSNSISNSNSSSMSNLNLNSKYD
SAKL0D01364g       AGSRGLNS--------------SQQQFYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMT
KLTH0C03784g       -GSASPHR--------------------------------------AGGSRSSHAQSSYH
Kwal_27.10239      -GHSSPHR-----------------------------------------------HVTNK
KNAG0G03440        QTNYTAQR---------------------------------------KGSHTGMANGTGS
Smik_13.17         QGGYSPAR--------------SSNFKRKAYSRPVSNHNN--YNGNNNSNQNNNNNGMVT
YML117W            QSGYNSAR--------------SSNLKRKAYSRPVSNHNG--YNGNSNSNQNNTNNGMVT
Suva_13.26         QGGYNLGR--------------SSKFNRKAYSRPISSQNSYNANHNNNNNNSNSNNGMMT
Skud_13.24         QGGYSPAR--------------SSNLKRKAYSRPVSNQNGYNGN---SSNHNHSGNGMMT
KAFR0A02850        QQQYFLQQ---------------------------------QFNTNNNNGSSTPRKSFFK
TPHA0I00270        NKSYLSFQ------------------------------------ASPSRGISYNRRNSNQ
Kpol_1068.5        GQSYSQQF------------------------------------ARPSPSKGGNSMGRLS
ZYRO0G14256g       QSQHHHHHQNHQHQIGMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLS
TDEL0B00540        QQPHHHQH---------------------------AHQRLQQYSHNQSKSSSGRSFGKLA
                                                                               

KLLA0D01485g       SF-YPPAPKLRPAPSGR----------LRRARRKDNKPQQQREHSRDNNKVEAEYDVERG
CAGL0B02365g       YMSSKRSSLSQAPMSQK---------RAEKNSTDSSVGSHGKKKLQHKKRTP--------
NCAS0B00280        FSQIPSMLNVGNPPSAR---------------RQGNQNDPNRRRSSYRSKVP--------
NDAI0E00270        SMLNQPSSRSNFFTDSY----------------------NNRYQNNPQTRIP--------
ABL122C            FLYYPQPPMLKPIPPRR-------------------------------------------
Ecym_4615          FLYYPQPPILKPIPPRR-------------------------------------------
TBLA0B03280        NYPIPPVPILKNPPLNN----QNIRNSRNNSNRIRNNHIINRKLLKDDNSYRISQQTFKE
SAKL0D01364g       RYSYPPPPQLNAPPMTH----------------------------KRKTHLR--------
KLTH0C03784g       TPNFGSTQLRMPPPTEK-------------------------RNFKHGSSYR--------
Kwal_27.10239      SSQAYKSTQLRMPPSDA------------------------IRGSRRHNKEK--------
KNAG0G03440        MNYYRTDPQI--------------------------------------------------
Smik_13.17         PSNYYRIERNSFSRNNN----STRNSTH-NNKGCDNRNSSGRRTSTRNNIFD--------
YML117W            PSNYYRMGRNSFSRNNN----STRNVTHNNNKGCDTRNNSGRRTFARNNIFD--------
Suva_13.26         PSSYYRNGRTLFSRKDN----NAVNVTHNIHKGYETRNSSGRRTSSRINIFD--------
Skud_13.24         PSNYYRNGRNSSSRNNN----STRNVSHNNNKGCDTRNSSGRRASSRSNIFD--------
KAFR0A02850        VSNRPISSRSSRFSEKR----------------KSFIINNPTTNNSNNNNNN--------
TPHA0I00270        MV-FPNPPIITSPHLV--------------------GDKSERAKSDNYEKVD--------
Kpol_1068.5        SA-YPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRN--------
ZYRO0G14256g       EASYPVPPPLKNPPVVA--------------------------RNRHRRRAQ--------
TDEL0B00540        TA-YPVPPSLNSPPASR-----------------NALHNRGPRRGSHYKSIQ--------
                                                                               

KLLA0D01485g       YSSRSASRSQSFSASTSGSMSGSSGPKSIRKTIDSELKIQFQYSILPK----GNDTYRSR
CAGL0B02365g       -------------IDVTKKLISP-------------ISINYR--VLPS----GDDTYKTR
NCAS0B00280        ------------ETDPKTLFLQP-------------FRMSYK--ILPS----GDDAYRTR
NDAI0E00270        ------------EVDPNELFQKP-------------FVISYK--LLPT----GDDAYRTR
ABL122C            ------------KKSVTLNHSEP-------------YHINFK--ILPK----GKDEYMTR
Ecym_4615          ------------RKSFSLNHSEP-------------YQVNFK--ILPK----GKDEYMTR
TBLA0B03280        NPMIIEKPKYSSVIDINKLLEIP-------------LVVSYK--ILPK----GTDEFRTR
SAKL0D01364g       ------------HETNSQPSSEP-------------YVINFK--ILPK----GDDEYMTR
KLTH0C03784g       --------------HNSSVQQRA-------------YEVVFH--ILPRSADGGGDEYMTR
Kwal_27.10239      ------------HLYDEGTRQIP-------------YKLTFN--ILPRNGNGDGDKFRTR
KNAG0G03440        ---------------INGLFQIP-------------FEISYK--ILPK----GDDLYRTR
Smik_13.17         ------------DISSELLLQRP-------------FRINYK--ILPT----GDDAYRTR
YML117W            ------------DILPEMLLQRP-------------FCINYK--VLPT----GDDAYRTR
Suva_13.26         ------------EIDPETLLQKP-------------FRINYK--ILPA----GDDAYRTR
Skud_13.24         ------------EINPEILLQRP-------------FRINYK--ILPT----GDDAYRTR
KAFR0A02850        ------------KEILEKLFTEP-------------INISYV--ILPK----GDDAYRTR
TPHA0I00270        ------------TLDDEKRNREV-----FEEESAIAYKISYQ--ILPK----GDDTYHTR
Kpol_1068.5        ------------TNNNGGRFTQKNIIKRFQENSLNRFTISYK--VLPK----GNDEYQTR
ZYRO0G14256g       ------------NEQADKMFKEP-------------FVVTYR--MLPK----GDDEYRTR
TDEL0B00540        ------------SSDASKRFKDP-------------FILTYR--VLPK----GNDEFRTR
                                                         : :   :**     . * : :*

KLLA0D01485g       SLLFTNVN--SELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNTSNNDDDPNQNYN
CAGL0B02365g       SLLFENVQK-NDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKES--------------
NCAS0B00280        SLLFENVV--NSIELHTFMTEFVRFSPIESVYLINHHDSDKPDD----------------
NDAI0E00270        SLLFSNVA--SSIDLHSFIYDFVQYSSIESIYLISNTDDEKDQDNEN-------------
ABL122C            SLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM--------------------------
Ecym_4615          SLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL--------------------------
TBLA0B03280        SLLLENIN--QSIDTRTLVKNFINFGPIESVYLIKLNP----------------------
SAKL0D01364g       SLLLSNVN--ASIKLHDFITKFVKFGPIESVYVVPEEEEEEEEEEEEEEEEEEEEEEKG-
KLTH0C03784g       SLLFSNLN--PDTHLHDFLTKFEKFDRVESVYLV--------------------------
Kwal_27.10239      SLYFSNLN--PDVRLHEFLATFHKFDRIESVYVV--------------------------
KNAG0G03440        SLLLGNID--DMVDLHTFVSKFVQNNSVESVYITKEGQ----------------------
Smik_13.17         SLLIENVD--RSTDLHSIVKNFVKSNTLESTYIIGNEKSDDLKDE---------------
YML117W            SLLIENVD--HSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDV---------------
Suva_13.26         SLLIENVD--DSADLHSLVKNFVKSNALESAYIVGSKETDNLEKE---------------
Skud_13.24         SLLIENVD--RSTDLHSLVKNFVKFNTLESAYFVDNDKNDDLEDG---------------
KAFR0A02850        SLLFENVD--NAINLHSFITNFVKNNSIESIYLVPNKN----------------------
TPHA0I00270        SLLFENIN--ESIDLHTFIEKFVNYGLIESVYVVPSYETH--------------------
Kpol_1068.5        SLLFENVD--KSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDND
ZYRO0G14256g       SLLFENVN--GSVDLYSFVSKYSRYGPVESIYMFKDRN----------------------
TDEL0B00540        SLLFENVD--GSIDLHSFVTNFTNYGPVESVYLFKS------------------------
                   ** : *:          ::    .   :** *.                           

KLLA0D01485g       ADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAE
CAGL0B02365g       ----DKDT--------------------------CCLQLSFLSRQAALDFYNNFLQRLPD
NCAS0B00280        ----DTEC--------------------------RSILLSFLTREVCLTFYNNVLQRLKE
NDAI0E00270        ----DKNK--------------------------RSILLSFLSREICLSFYNNVLQRLNE
ABL122C            -----DDN--------------------------HSILLSFLTKATCLDFYNNLLQRFSE
Ecym_4615          -----DDS--------------------------HSILLSFLTKATCLDFYNNLLQRFSE
TBLA0B03280        ----GSKY--------------------------NSILLSFVSREICLDFYNNVLQRLME
SAKL0D01364g       ----EEKK--------------------------QSILLSFLTKNTCLDFYNNVLQKLSD
KLTH0C03784g       ----DSQQ--------------------------QSVLVSFLTKETCLDFYNGVLQKLSE
Kwal_27.10239      ----DREQ--------------------------QSVLVSFLTKETCLDFYNGILQKLSE
KNAG0G03440        ----QPEK--------------------------YGFLLSFLSVQICLNFYNNVLQRLKE
Smik_13.17         ----QTSN--------------------------LSILISFLTRSDCLNFYNNILQRLSE
YML117W            ----ETKN--------------------------LSILISFLTKGDCLNFYNNILQRLSE
Suva_13.26         ----ETKN--------------------------LSILISFLTRGDCLNFYNNILQRLSE
Skud_13.24         ----ETEN--------------------------LSVLISFLTRSDCLNFYNNILQRLSE
KAFR0A02850        ----DSNT--------------------------CDIILSFLSRHICLDFYNNVLQRLKE
TPHA0I00270        ----QNSV--------------------------KSILLSFTSRSICLDFYNSVLQKLSE
Kpol_1068.5        DNANNHDT--------------------------QSILLSFLSRPICLDFYNSVLQRLSE
ZYRO0G14256g       ----DKTK--------------------------HSVLLSFLSRKICLDSYNSVLQRLAE
TDEL0B00540        ----EGDH--------------------------VSILLSFFSKAICLDFYNSVLQRLSE
                                                         :** :   .*  **..**.  :

KLLA0D01485g       IKNAVKSDQLAMNFVKI-------------------------------------------
CAGL0B02365g       FKKKLSSPKLSVSFVSFSYVTDEDKDKDKDKDKDINTEKRN-------------------
NCAS0B00280        FKAKLKSENLRLSFVSIKYQDENEEEETN-------------------------------
NDAI0E00270        FKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNE----------
ABL122C            FKTKLHSPKLSVSFVC--------------------------------------------
Ecym_4615          FKSKLHSTKLSVSFVC--------------------------------------------
TBLA0B03280        FKTELSSKSLTLSFVILKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEE
SAKL0D01364g       FKIDLNSKSLTLNFVSL-------------------------------------------
KLTH0C03784g       FKKELKSKELTLNFASLR------------------------------------------
Kwal_27.10239      FKKELRSKELSLSFASPQ------------------------------------------
KNAG0G03440        FKEQLKASSLELSFVSMRQRPTKVEGKIYR------------------------------
Smik_13.17         FKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQI--------------------
YML117W            FKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEA--------------------
Suva_13.26         FKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQA--------------------
Skud_13.24         FKIFLKSKSLNLKFVCLNYESECLSTFVEGEKPKEVDEQV--------------------
KAFR0A02850        FKKHLNSESLNLNFVSLKYNKTTRDNQ---------------------------------
TPHA0I00270        YKTQLNSENLKLSFVSLCYLQNNINKGNGKISVES-------------------------
Kpol_1068.5        FKTQLNSNDLTLSFVLLKYKNQDRPDD---------------------------------
ZYRO0G14256g       FKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNV---
TDEL0B00540        YKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDS-------------------------
                    *  : :  * :.*.                                             

KLLA0D01485g       ------------------QDDEEWMANLKMNVISL-GATRSLYVEFA----DDSV---TS
CAGL0B02365g       ---------------IKRSQELLKEPALGEEIFSH-DATRSIAIEF-----YSQV---EQ
NCAS0B00280        ---------------IVDEPSFYTKESVYFELSNP-QATRSILIQF-----KNPC-S-EQ
NDAI0E00270        ---------------FDYRNSMNTVNALKFDLINP-DATRFIMIEL-----KTKC-D-KE
ABL122C            ------------------QDESSWFKYLQMNVVTR-GATRSLTVEF-----EDSVKELNE
Ecym_4615          ------------------QDETNWFRLLQMNVVTR-GVTRSLCIEF-----EDQSMELTS
TBLA0B03280        TDGEEIVIEDIRNDLNKENFPLTFASALQSDLVKR-GATRSLLLKF-----NGVV-S-KD
SAKL0D01364g       -----------------------TSEDIRDDVLRK-GATRSIALEF-----KNSF---TT
KLTH0C03784g       -----------------DVKTGPTLQEIKIEVLRA-GATRSLILEF-----QDKV---DL
Kwal_27.10239      -----------------KVESGPTLQEIKFEVLRA-GATRSLGLEF-----KDEI---DF
KNAG0G03440        ---------------RFAADDGDGMANLHFDMAAQTGATRSIAIEFVD---KDVILT-RD
Smik_13.17         ---------------DITNDSSMISASLHHDLENK-DATRSIIVEF-----KSPL-K-ST
YML117W            ---------------DITNGSTMISASLHHNIANK-DATRSIIIEF-----KSPV-E-KS
Suva_13.26         ---------------ATDDASTMISASLHHDVENK-DATRSIIIEF-----KSPL-E-KA
Skud_13.24         ---------------HAANDSMMISASLHHDVENK-DATRSIIIEF-----KSAL-E-KT
KAFR0A02850        ------------------------GPSLEFNIVTR-DATRSLAIELCSNENDSLILE-KE
TPHA0I00270        ---------------QKNETDFELTSLIQYQVANF-GATRSLCIEF-----DKRVDK-ID
Kpol_1068.5        ---------------EESDFSPALPLSLEYDIIKR-GATRSIAVEF-----NQPITS-KE
ZYRO0G14256g       ---------------QDDAYNVTVVASLQYDIVNR-GATRSVALEL-----DGEY-D-KT
TDEL0B00540        ---------------KPDAFNITAAGSLRYDVINR-GATRSIMITF-----KTPC-S-KD
                                              :  ::     .** : : :              

KLLA0D01485g       DTIWDTL-PFL---KNSGKYVVIDVDVVT--------------------TDER-------
CAGL0B02365g       DALFEKL-PFL-DDKDNKRYILEAVDIIS--------------------AEDA-------
NCAS0B00280        ELFDKKL-KFL-NQENNSRYILESIDLVN--------------------VTQT-------
NDAI0E00270        TLLNKHL-SFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDT
ABL122C            DFVRLKF-PWL---FCSQRFVLERIDLIN--------------------ATTV-------
Ecym_4615          DLIHEKI-PWL---FFSHRFVIERIDLVN--------------------AAAP-------
TBLA0B03280        QLINEKLNLFI-NNNLNNRYILESISLVNIENNTKNNKNTIGDDNEDQIEDTP-------
SAKL0D01364g       KQL-ESI-EIL-SNASNSRFVVEKIDIVN--------------------TESP-------
KLTH0C03784g       ALLSKSL-GFI--VNEGPRYVVEAIEIVN--------------------AGRS-------
Kwal_27.10239      ASLLKKF-DFF--DNSGPRYVIESIETVN--------------------TDKP-------
KNAG0G03440        ELLNKKL-KFL--SEGNNRYILEHIAVFK--------------------TQHG-------
Smik_13.17         ELFNKKL-QFL-DRSNNKRYILESIDIVN--------------------TDVP-------
YML117W            DLFKKKL-QFL-DRSKNKRYILESIDLVN--------------------TDVP-------
Suva_13.26         ELFKEKL-QFL-DRSKNKRYILESIDIVD--------------------TDVP-------
Skud_13.24         ELFRKRL-QFL-DESKNKRYILESIDLVN--------------------TDVP-------
KAFR0A02850        QLFEKILNEIL-RTDENKRYVLESIDLVS--------------------TDKS-------
TPHA0I00270        DFIETYL-PFL-SSNANKRYIIESLYIVN--------------------NNGK-------
Kpol_1068.5        GFMNSKL-SFL-LSPENKRYIIESVDIIN--------------------AAER-------
ZYRO0G14256g       KLLDQEL-DFL-SPANNQRYVLESIYLIN--------------------AKEP-------
TDEL0B00540        ELIDKKL-EFL-KKENNTRYVLESIDLVT--------------------ADEP-------
                     .   :   :     . .:::  :  .                                

KLLA0D01485g       ---------RKN-FGLHYCLLHFLSVTMALEVKELLETG-DEA---VSRVSFVT------
CAGL0B02365g       ---------ADD-FPANYVILTFINIKMAIEVLDYLKAN-LMT-YSVNECFFVS------
NCAS0B00280        ---------ENE-FPKHYAILTFINILMAMEICDYLKIH-GPR-YGIQDCMFVQ------
NDAI0E00270        MVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLN-GLK-HGITNASYVQ------
ABL122C            ---------NQH-FGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVN------
Ecym_4615          ---------KNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVN------
TBLA0B03280        ---------ISK-FGNNYCLLTFSNILMAIEAFDYFKAK-LNE-LNIFDCFFVSKTNYHK
SAKL0D01364g       ---------NKN-FNTHYAIIHFISISMAVEASSYLLNW-DEK-LGISRLFFVT------
KLTH0C03784g       ---------SKH-FGPHYAIIHFISIAMALETVEYLKSQSNKL-AGLIKFRYVN------
Kwal_27.10239      ---------SKY-FGSNYAIVHFISIAMAVETMEYLKVQTPES-FGLTKVSYVN------
KNAG0G03440        ---------TKV-FGKNYAIITFLSIPMAMEIMDYLKLN-IKQ-LHLTKFFYVQ------
Smik_13.17         ---------SNQ-FPENYAVLTFLNIFMAIEVLDYLKKY-SKK-LGISKCFYVS------
YML117W            ---------SNQ-FPENYAVLTFLNISMAIEVLDYLKKY-SKN-LGISKCFYVS------
Suva_13.26         ---------SNQ-FPENYVVLTFLNIFMAIEVLDYLKKY-SKK-LGISKCFYVS------
Skud_13.24         ---------SNQ-FPENYAVLTFLNIFMAVEVLDYLKKF-SKS-LEISKCFYVS------
KAFR0A02850        ---------NKE-FGKNYAILSFLNITMAIEIMDYIQVI-SSK-LNIGKCSFVT------
TPHA0I00270        ---------DNE-FPAHYVILSFLNISMVIEVLHYIRSK-NLS-KTIKNCLYVS------
Kpol_1068.5        ---------DAN-LPKNTVILTFLNISMTVDVMDRIRLE-RKD-SGISKCVFVT------
ZYRO0G14256g       ---------FKH-FPKNYAILTFLNISMAVEVLDYVRNNETAR-SKFQKCFFVS------
TDEL0B00540        ---------SKH-FPQNYAVLTFLNIFMAVEILDYIRLH-SQK-LDISKCFFIS------
                                :  .  :: *  : *.::    .          .    ::       

KLLA0D01485g       ---------------------------------------PANSADKEMRRRRSSAISLKQ
CAGL0B02365g       --------LPGC------------------------------------------KSQRES
NCAS0B00280        -------------------------------------VIPKAVSCVSSKRASIISKDNDN
NDAI0E00270        --------IKHV------------------KKSLNSSSKRSSVTSTTDNKDKSEVDTNES
ABL122C            --------VNGH----------------------------------------------HS
Ecym_4615          --------VNGH----------------------------------------------SS
TBLA0B03280        NSENSKSTISHSTPSSKISSIVNLPNEINNNNKSNVPITSLNSDNDKSNVSISNDNISND
SAKL0D01364g       ----------------------------------------------------------DS
KLTH0C03784g       ------------------------------------------------------------
Kwal_27.10239      ------------------------------------------------------------
KNAG0G03440        --------VTHP-----------------------PQQSPAASQKK----PHANDTESNR
Smik_13.17         --------LAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNND-NNNSNNHKSNISD
YML117W            --------LAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNNGNNNKSNMSG
Suva_13.26         --------LTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNND-----------INN
Skud_13.24         --------LTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKND--NNNNSNKGNISS
KAFR0A02850        --------IQPL------------------------IENNVMNNSSALSSATNIQSSVSS
TPHA0I00270        ----------------------------------------FDRTKHAVSNSNRQSLSKKG
Kpol_1068.5        ------------------------------------------------------------
ZYRO0G14256g       -----------------------------------VSSCPQTSSDGGIVTTSNSITPVAS
TDEL0B00540        --------IQPQ--------------------------IPDGKRLS---------VSSAS
                                                                               

KLLA0D01485g       EASPQMFSTDSRSRSRSSN-VSLPLS------EQVSTASTDISTPIYE-EFDG-NL---T
CAGL0B02365g       STTPVLGHISTEGSKSVSE-VNLANG------GNTVMIDRELES-LSD-ELASLKL---E
NCAS0B00280        NDETLSSQQKKNDILKNSSIISLPSA-----ENDQVSDEEKLDK-LSE-KLKSTNI---E
NDAI0E00270        VEGKDKKSEEAKSFNNKLSSITMSSP------DTTYEGEDDIDIDIIISKLQKLKL---K
ABL122C            KLSDEEAAAAANGLQQDSRTSSVSSI--------SLSISNTADL-AALFHSLDLSL---D
Ecym_4615          DLSDEDAVAAANGLQRESRTSSVSSI--------SLPISNSSDL-VELFHSLDLAL---G
TBLA0B03280        NTSNDNNNSNDNPINNNDITIRNKSRKNSNVTVHELSMDQEIEI-LNE-KLKNIDL---K
SAKL0D01364g       IINKSDYFRSAPASQDASR--------------SSVSIDQTLEF-ATK-KLQGLVL---K
KLTH0C03784g       ----TTSASGKSEFQTLSS-SQLNERALSNTSDSDISGGESVAS-LGS-KLQQTSL---G
Kwal_27.10239      ----STFTSGKSEFQTFSN-SELSDQ-------NDVEVQDSISS-FEDITLSEGSMSVEN
KNAG0G03440        DTSPPNSKKDQEFFPNNSM-LSLVSS------ESSTSLADDVDG-LVN-KLKSIEL---Q
Smik_13.17         ANTHNSNNSTRASLYGNSN-VSLASL------PSSVSLNEEIDI-LTT-KLQGIQL---D
YML117W            ITTLNNNSSIGVSVYGHSN-MSLTSL------SSSVSLNEEIDM-LAT-KLQGVEL---D
Suva_13.26         INNNNNNGSIGSSIYGNSN-ISLTSL------SSSVSLNEEIEV-LTT-KLQGIDL---D
Skud_13.24         INAQNNNSSIGSSIYGNSN-ISLTSL------SSSVSLNEEIDL-LTT-KLQGIEL---D
KAFR0A02850        EGNNNQNNNGSTFFHKNSI-NSLLSS------ESSVSIDEEVIS-IAD-KLKGIKL---K
TPHA0I00270        TSDTLNTYTLESPINHNTE-VDMNDI-------PSIYDENEIE--IAN-KLSELEI---Q
Kpol_1068.5        ------FNKENPTVPNMKR-LSLVDI--------TSDISNQLNS-----EFENTRL----
ZYRO0G14256g       GGSAGIATNGDLGGYTSKN-ASLSSL---NSVGSYISLDQEIDF-LSS-SLK-------G
TDEL0B00540        NGRSMESISGNYRSKNASV-TSLESS------GSIISLDQEIDE-MTY-KLQSVNS---K
                                                                               

KLLA0D01485g       WSTLIVDVSEYKEPIVNEFDHHLNSWSIS------------KPTTLYMHESGTTNFSSS-
CAGL0B02365g       EKCLKIIRSDYPKPEIRSHDDHIPGST--------------NFSMYIFDDGMNPEGNSGM
NCAS0B00280        ELILIVDTATYPRPSFLSHDEHLPNATLS-------------------LSSSSNPFEQQL
NDAI0E00270        ETIQVLDIATYNTPLFQSHDSHMANITLS--------------IVNPFEAQLMRPPPSNI
ABL122C            TLSLQVVPSEYPTPLIEQHSEHLTSITIS------------RPSKTLGPSASLIEMDSNA
Ecym_4615          IISLQVIPSEYPVPLIESHDDHLHSVTIS------------RPSKTLTSSTSLVEMDGGP
TBLA0B03280        DNELIISAKIYNQPIVEEFDQDLENISITNLSNSNYLLLNQQPFEFNMNMNMTMNMNMNM
SAKL0D01364g       ERTLSIKPKTYPQAEIEEHQHHLTSISIS------------KPLLSSNNNSSSVSLQGNQ
KLTH0C03784g       EQTLVVDPTQYGRPLVEERSEHLPHVTIS------------KALN---SKSSLNDLTSNT
Kwal_27.10239      EKAFTVLPSQYGPPVVEEHNQHCSHITIS------------KALSSKVSRNGSSSSIAS-
KNAG0G03440        ESTLKLRVEDYPEPLFEQFSEHSNGIVQS------------LPVPQ--TRPIGGPQSSIS
Smik_13.17         GTDLEINYHDYQTPTVHEHSTHLSNVKIS------------KTVEN--SRQFPHDIPSPL
YML117W            GTYLEINYRDYQTPTIEEHSTHLSNVKIS------------KTTEN--SRQFSQDIPSPL
Suva_13.26         GTILEVTCHDYPTPVINEHSAHLSNIKIS------------KTVDN--SRQFTQDIPSPL
Skud_13.24         GTSLEITSHDYSTPTINEHSTHLSNIKIS------------KTVEN--SRHFPQDIPSPL
KAFR0A02850        DISLDILPRDYPEPEFNFSTDHLPNVTIS-------------------VPTQLDQIPGT-
TPHA0I00270        THTFNLDISNYSNPHIEIRAEHLPNVSIS------------RDPMIYANPIYQSPPSGYM
Kpol_1068.5        -----------------IHLIWMETINCN-------------------------------
ZYRO0G14256g       SHTITVAVDEYPKPFFAEFSDHLSNASVL------------EASAL--DTQISSPHPQEV
TDEL0B00540        KNILEVTTNNYKDPSFEGHTDHLTNVTVS------------EAASL--DSQLTMPSPQEV
                                                                               

KLLA0D01485g       ------------NLSDD--IDPLSISSHDPVPQQ------MLLNEYPYIMEPL-------
CAGL0B02365g       --------YLHDNLTDHSSIIGSPFSNYIDPSIS--------HVMLPNNGLPVGGFDAPG
NCAS0B00280        PYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKG--------YISPNPNMNYNTPLMYPN
NDAI0E00270        VSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQ-ETSGRRSLSSSSTSLSNYQGRSNSN
ABL122C            -TNAGNHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPM
Ecym_4615          ---NGGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVL-GTSQSL
TBLA0B03280        NMNVNMNMNMNMNMLPPQSMPMPMFAGNFDMIDP--------MDPQRSRQPSV--LFTAT
SAKL0D01364g       -------NLTSSPVTQEMYLHDTSNSTREDVMIQ---------SSMASGTSNF--VPPPP
KLTH0C03784g       ----------TSPQPQEVLVNDHEDSSSRGSMVS--------LKQANSHGPAY--PPIPG
Kwal_27.10239      ------------PQPQEVLVSNSEAPSSRNSIVS--------LLSARSQGPTY---PVPG
KNAG0G03440        TPRAFGAFPNDIGSPPASFL--PLDLNHSNSVPN--------LPPGFIPATPS--GPMSP
Smik_13.17         ------------PLNERMFMNDSNHSNGSIVPQQ--------LMATPSPVSST--IQM--
YML117W            ------------PLNEHMFMNDSNQSNGAIIPQQ--------LIATPSPVSPN--LQM--
Suva_13.26         ------------PLNEHMFMTDSNQSNGTIVSQQ--------LITAPSPQSPN--PQMNQ
Skud_13.24         ------------PLNEQMFMNDSNQSNGAVIPQQ--------LIAAPSPLSSN--LQINQ
KAFR0A02850        ------------PRTQEIYINDMSPSFEGIDMMN----SSSTMLSGNGTFISNTPMLIPS
TPHA0I00270        ENMWTTTPFLSSHIVHEEYANDRVD-----------------YNMKHYNNQLY-------
Kpol_1068.5        ------------------------------------------LRXXX-------------
ZYRO0G14256g       -----IVPSQDSPLVGGAPPLDAVHPAATPA-----------LSSQVLPLQPH--MAMNS
TDEL0B00540        TVNEYVLPNQDMPLPNDMNYAPSVQDVDAVPPSM--------VPMSTMPNTPY-------
                                                                               

KLLA0D01485g       --------------------M-------------PPQITQTIQNQYSKSIQAVNA---GM
CAGL0B02365g       KFPIEPISGPPFNH------T-------------NKVITQSIEDRLNTSARIAAAMGGDA
NCAS0B00280        GYFVNDPAFSMNNNYNNNTNY-------------RNPISKTLEQHATTTSQVVNSLGADA
NDAI0E00270        NYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEM
ABL122C            SLHNPSDGNGGSPSYFMDPMV-------------GAPIGQTLQRQYLAGASQAN----GI
Ecym_4615          SLHNPNDNGGAGPSYFMDPMS-------------GAPINQALQRQYLTGTGQV----GGS
TBLA0B03280        QQPQQPQQQQPQQQG-----T-------------HNNLTQTLENHFNTSTELSAVLGGGP
SAKL0D01364g       HYYMD---------------V-------------TKPIRQTLQQQLTTTAQVASNMGGGL
KLTH0C03784g       YPFYMN--------------M-------------SKPLGQTLQQQYTTTAQVATAMGGGL
Kwal_27.10239      YHYYMD--------------M-------------SKPLGQTLQQQYTATAQVATAMGGGA
KNAG0G03440        QQQQLFLNSQRQQRDHAGGKF-------------AHPITDSLESQMKTSTQVATAMGSDF
Smik_13.17         -----------NQRV-----L-------------PNPITQSLEQNFNVSAKVASSMGSDV
YML117W            -----------NQRV-----L-------------PNPITQSLEQNFNVSAKVASSMGSDI
Suva_13.26         RV------------------L-------------PNPITQSLEQNFNVSAKVASSMGSDI
Skud_13.24         RV------------------L-------------PNAITQSLEQNFNVSAKVASSMGSDV
KAFR0A02850        QSFYMDQNTQIQEAPFRSNSF-------------IHPITDSLENQLSTSAKVASAMGSDA
TPHA0I00270        ----------------------------------NVPLPQTLQSQFATSAEMASKMGGGV
Kpol_1068.5        --------------------M-------------LHQLLRASKHQFATSAEIANTMGGGA
ZYRO0G14256g       GIYMEPFGRRNKT-------M-------------IKPITQSLQKQFATSAEVANSMGGGI
TDEL0B00540        GCYMPPPNVRQNGN------M-------------TKPITQSLQRQYATSAEVASSMGGGI
                                                        :  : : .               

KLLA0D01485g       EHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLE
CAGL0B02365g       DNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFID
NCAS0B00280        GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID
NDAI0E00270        GNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFID
ABL122C            NNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLE
Ecym_4615          NNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLE
TBLA0B03280        GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID
SAKL0D01364g       GNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIE
KLTH0C03784g       GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIE
Kwal_27.10239      GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE
KNAG0G03440        NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID
Smik_13.17         GNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFID
YML117W            GNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFID
Suva_13.26         GNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFID
Skud_13.24         GNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFID
KAFR0A02850        GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFID
TPHA0I00270        GNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFID
Kpol_1068.5        GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID
ZYRO0G14256g       GNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFID
TDEL0B00540        GNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFID
                    :**:::**: .**. **:***.*** :* :  .  * :.*: *::.  * :* :*: ::

KLLA0D01485g       PIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQN
CAGL0B02365g       PIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHE
NCAS0B00280        PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ
NDAI0E00270        PLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHE
ABL122C            PIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG
Ecym_4615          PIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHG
TBLA0B03280        PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE
SAKL0D01364g       PIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFRE
KLTH0C03784g       PIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKE
Kwal_27.10239      PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE
KNAG0G03440        PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE
Smik_13.17         PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHE
YML117W            PIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHE
Suva_13.26         PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHE
Skud_13.24         PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHE
KAFR0A02850        PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE
TPHA0I00270        PIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHN
Kpol_1068.5        PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN
ZYRO0G14256g       PIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSD
TDEL0B00540        PIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNK
                   *::**.  *.:***     *.: : **** **.****:***: :**:*:: :*.::    

KLLA0D01485g       RYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYS------DTKD
CAGL0B02365g       RYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN------HNNG
NCAS0B00280        KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAH------NPVE
NDAI0E00270        KYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVN-----NNPKD
ABL122C            KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSN---SPIEKNL
Ecym_4615          KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCN---SLSQRNL
TBLA0B03280        IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVN------EDDG
SAKL0D01364g       KYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDAN------GADN
KLTH0C03784g       KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDAN------NPNN
Kwal_27.10239      KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDAN------NSNN
KNAG0G03440        SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAS-------TKQ
Smik_13.17         TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDG
YML117W            TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESG
Suva_13.26         TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSG
Skud_13.24         TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGG
KAFR0A02850        KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEAT-------NDF
TPHA0I00270        KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVK------NEDN
Kpol_1068.5        KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVN-----SSNGG
ZYRO0G14256g       EYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIK------YNDG
TDEL0B00540        KFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVK------YEGG
                      :*    *  **  :*  * :*  .* ****:** **  ** ***             

KLLA0D01485g       NLFH-----KKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGSNHNRNSQNNNTSRGHR
CAGL0B02365g       EEFH-----KKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKME
NCAS0B00280        SKFS-----EKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELE
NDAI0E00270        NTFS-----KKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQ
ABL122C            EKFH-----AQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGK--
Ecym_4615          EKFH-----AQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQ
TBLA0B03280        IRFH-----NKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVKKPAYQIKLKKIE
SAKL0D01364g       KKFH-----GSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKIRMHKQN
KLTH0C03784g       DSFH-----EKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQ
Kwal_27.10239      ESFH-----EKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLRRQQ
KNAG0G03440        DHFN-----QLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLE
Smik_13.17         EMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE
YML117W            EVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLE
Suva_13.26         ELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE
Skud_13.24         EVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE
KAFR0A02850        DRFN-----EKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLE
TPHA0I00270        NNFH-----ERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLE
Kpol_1068.5        KTFH-----ERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLE
ZYRO0G14256g       EAFH-----KSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRME
TDEL0B00540        GNFY-----KMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKME
                                 ** .*.*.********:*..:   * ..  .               

KLLA0D01485g       QRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNKNFLSLGVDADFSEGLGIS----
CAGL0B02365g       EKRKMQ--------EDNLLS------QKKNS------IQLDSLGISVDRT----------
NCAS0B00280        EKRKAD--------TERLNSLRKTSSSDGQL------SKLDAFGIGIDTV----------
NDAI0E00270        EKRRVE--------QEKGKEL-NGGVNDNKL------PSLDALGIGLQRT----------
ABL122C            QPRKED--------GIVNSD---DLTKNNEV------LP----GVQMNSS----------
Ecym_4615          QSKRGT--------SSASSD---DARKDDAS------TE----KVPVSSK----------
TBLA0B03280        EERRLQ--------EENNLRNNNKLSNNSQIRKPA--VNLESLGITFESSETDTTI----
SAKL0D01364g       KAGGSNG-------QEPISS-----------------FQDNAFGICISPRGIESEE----
KLTH0C03784g       KGASDA--------PTEVKD---EAKELDKP------IKADAFGISVGDT----------
Kwal_27.10239      KSDIEA--------QAKSGK---GDENSEKK------LQVDAFGISVGSQ----------
KNAG0G03440        EKRRNQ--------DAERRE--MVNGTIPEE------NPFDAFAINTGSA----------
Smik_13.17         ERRRQN--------ENDKKE-----RAFDKA------LNLESLGISLDSH----------
YML117W            EKRRQN--------EIDEKE-----KAFDKP------LNLESLGISLDAH----------
Suva_13.26         ERRRQN--------ENDKKE------SFDKV------LNLESLGISLDPH----------
Skud_13.24         ERRRQN--------ENDKKE------SFDKV------LNLESLGISLDPH----------
KAFR0A02850        EKRRDH--------DRRENG--FKHVYNDEE------TIYNE-SMETDNQ----------
TPHA0I00270        EERKRN--------DEIKQI-------DNKR------INLDSLGITTSPN----------
Kpol_1068.5        EERKQE--------EKNKIS--------NKS------INLNSFGIQVETP----------
ZYRO0G14256g       EERKKH--------EETLRS--QNQNNDEKM------LQFGSLGIHLEGNDNNKTSYERS
TDEL0B00540        EERRQH--------EETLRR--QQENNSEKF------LQFGSLGITIDSNGKEDPE----
                   :                                           :               

KLLA0D01485g       -------------------------ISPQAE-----------RRHVLSDNEDEREEHREE
CAGL0B02365g       ------------------------------------------------------------
NCAS0B00280        -----------------------------------------------SNNEEDGNIEKGN
NDAI0E00270        ------------------------------------------APPEEQKVPESNEDDANY
ABL122C            ------------------------------------------------------KNGGVG
Ecym_4615          -------------------------------------------------------EPVCD
TBLA0B03280        -------------------------NTTNND-------------IDTPEDTQKLTSPATS
SAKL0D01364g       -------------------------VEALPD---------------VPQNIEEEKNPQNN
KLTH0C03784g       -----------------------------QN---------------LVRDSDEEQKLEED
Kwal_27.10239      -----------------------------PD----------------ARYSDEEQKIEEN
KNAG0G03440        ------------------------------------------------------------
Smik_13.17         -----------------------------KD--------IGIGEIENKNCIGREIENEAE
YML117W            -----------------------------KD--------NGGGETGTANNTGHENESELE
Suva_13.26         ---------------------------------------KGTDIDEAEAEGTTGAEVENE
Skud_13.24         -----------------------------KD--------AGIGVIETENITGDEIESEIE
KAFR0A02850        ---------------------------------------------------------HNE
TPHA0I00270        ------------------------------------------------------------
Kpol_1068.5        ----------------------------------------------------------SQ
ZYRO0G14256g       LNGEEEEEQEEVEPNEAEKANGEGGREKDEDNNQEPMNPISKDGNSENHGSGEKYQEEEK
TDEL0B00540        -------------------------KVDDVDFEDEVKFDSNSPKKTVEQASGKESDQEEQ
                                                                               

KLLA0D01485g       EQEECGNRHSGVNGSNVANNE----AINETLINGTYTADIPEDTLQVGS-----------
CAGL0B02365g       ----FSNESKLSGGHTTTEEN----GGV--------KQDLESNDYKSDH-----------
NCAS0B00280        TLSKIDTDVNGFNALGFKIEP----KHD--------MMNETMDNNTEGN-----------
NDAI0E00270        DSAVTESDTNTFNALGFRIQS----NTD--------SHDDEQNDEKGEE-----------
ABL122C            ESQSLVGDQELAEGLGISLTS----AQISPDTGHTHHYSDGVEEGDECD-----------
Ecym_4615          EILGLNDDNALAEGLGISLSS----AYVNEYGDDISKRTNKKNRSKTET-----------
TBLA0B03280        FDDDHKVDPASLEALGIITTS----ATVAVTKNIDPSQINTDTSNHEDDETSSTDNAIEQ
SAKL0D01364g       GLLKLANGNGIGEGLGIEFSP----GLNKEGHEGDDKFDCIQQENGFDG-----------
KLTH0C03784g       ELLRLSDLNNTGGGLGISLAS----STG-----------EETNTPVSDE-----------
Kwal_27.10239      ELLLLSKPNSAEGGLGISVSQ----DVT-----------VTENNTACGG-----------
KNAG0G03440        ----EKKDELSLDSLGISIME----VES---ASPISPVMGDLEDHTNGS-----------
Smik_13.17         AVNR-SNETVGIGGLGLGVAS----SEV--------NRAASDETDYEDL-----------
YML117W            AENENGNETGSFGGLGLAVAS----SDV--------KRATSDETDYEDI-----------
Suva_13.26         VEAENGNETVGLGGLGLGVVN----SDV--------KRALSDETDYDEF-----------
Skud_13.24         AENVNDNETTGLGGLGLGVAN----CDV--------KRATSDETDYEEL-----------
KAFR0A02850        ESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEKSITKNNG-----------
TPHA0I00270        -QNIQEDETLSLAKLKLTSDT----GFK----------------NSENE-----------
Kpol_1068.5        NESEQEEPKISLDGLGMSLSK--------------------PNSENHDL-----------
ZYRO0G14256g       ELLKLSNKSQIIDGLGIAAVA----GNG---KDMVASQDQDILDRAHES-----------
TDEL0B00540        ELLKLSNKSQGAQGLNIVESQ----GQS------TREKEATKLTRNHSE-----------
                                                                               

KLLA0D01485g       DSCS-------TYSGSSSSDVDIIVNAPSPKA----------GDAKSFTHTRRNAHHRQR
CAGL0B02365g       PQISSNGPIGIGLSSKKSPIFDDISGSDESVISD--------FENSASKETSSSDRKYQT
NCAS0B00280        NTLE-------NISSDESSNIELMISSPKESVQK--------GDVITNQKPHSNNHHNFK
NDAI0E00270        QEEVDVIAHADDISSVNSSDVEIIIDCPHNE-----------SDTSMIQEKKKTIRKNQQ
ABL122C            DDDA-------GYSTSGSSDIDIIVAPPDEFKRRES------GTSS-GKHKKKSKSTRRN
Ecym_4615          VEEDT------GYTTSGSSDIDIIVAPPLEHNKGKE------GNSNHGKSKRKSQGGKRL
TBLA0B03280        FSNENEDEELDSQSSDDLSDVELIIGSGDNSDALT-------LENIDNQKLKKNKNKHNK
SAKL0D01364g       KDED-------ESYSSDSSDIDIIVSAPEQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSR
KLTH0C03784g       SSKE-------ESVSSESSDVDILVSAPGS------------ADTSQLESKTAPRSPKQP
Kwal_27.10239      KNKT-------GSVSSGSSEVDILVSAPGS------------ANTSQLEGGGPTQRTTAA
KNAG0G03440        YTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRS--------VGVLEGDPSTLSPPSDKR
Smik_13.17         FNKS-------SGSSDSSSDIEVIMHSPSDPEYA--------LKSQTLRSSSQTVINSKR
YML117W            FNKS-------SGSSDSSSDVEVIMHSPSDPEYA--------LKSQTLRSSSQTVINSKR
Suva_13.26         FNKS-------SRSSDSSSDIEVIMHSPSDPEYA--------LKSQTLRSSSQTVLNSKR
Skud_13.24         FNKS-------SGSSDSSSDIEVIMHSPSDPEYA--------LKSQTLRSSSQTVINSKR
KAFR0A02850        FENT-------SFHSDSSSDIELIINSP---------------NSLRTKDNDVLDSEK--
TPHA0I00270        SDID-------DSASNSSTDVELIINSPGNG-----------FKSHRNRKPKPNNLDL--
Kpol_1068.5        KETD-------DSDSDISTDIELIIDPPVRENTK--------GNKNKKQNHRKNDMNNNL
ZYRO0G14256g       GDEE-------SLDSGVSSNVELILHSPLEGDSN--------NQKKHEKNNKPFKSKKLE
TDEL0B00540        NDET-------SAKSDASSDVELIINSPEEEESN--------FKSKSNRGFRKNDRRKLA
                                     . .: :                                    

KLLA0D01485g       NTNQTRQYNNHHHAQQHQFQPLSHINAPYQTPQPQYHPYPQTPHRFSNSFV---------
CAGL0B02365g       TNSR--------------------GDTFVPKTNLSHAP-PRAPSTINMTYK---------
NCAS0B00280        RNSS------------------SNRQRYKETDTQNTHR-NNNNSNATFAPN---------
NDAI0E00270        KIDR---------------------LAKARNAMFPEHR-ETIPDINNKLFH---------
ABL122C            QHSN----AASSASYNQQY-SLGSLDHTSSAGSLDAPP-PLAPSSMQQHLA---------
Ecym_4615          QNGAQDGVGGGYGGHSQHY-LAGSFELVNSNTYLDSIP-PLVPSPINQHFH---------
TBLA0B03280        RKVH----RSHNQ----------KILQSNQVPVLNQYP-PMASSTLTRTYR---------
SAKL0D01364g       TKLK----RRPTSGLTDLY-SLNGFPSMVSSTSLDAVP-PLAPSTVSRHYS---------
KLTH0C03784g       RVLA---------NVPEKPSAFSAIIPRVSSASLDAVP-PLAPSTLSRQYT---------
Kwal_27.10239      SNGK----KERSSGVSKLH-CFSEIAPRVSKASLDAVP-PLAPAALNCHYN---------
KNAG0G03440        KL-------------------------VALHEVSSPPP-PLAPDTISRQYA---------
Smik_13.17         PVKA----EDEEDAV--------EISQFNHKSSLRHAP-PRAPSTLSYNRS---------
YML117W            PVKI----EDEEEAV--------GMSQLNYRSSLRQAP-PRAPSTLSYNHS---------
Suva_13.26         PAKV----ENEDGLV--------GLSQFNHRSSLKQAP-PRAPSTLSHNHS---------
Skud_13.24         PVKV----EDEDDV---------GISQLNHRSSLRQAP-PRAPSTLSYDHL---------
KAFR0A02850        ----------------------------IINSANTTNR-TGNANGYKNDYT---------
TPHA0I00270        -----------------------GERPKVDAIVFKADG-PMAPNKLSHDYH---------
Kpol_1068.5        NF---------------------GNPPPVSKTLLESSP-PLAPATLSRDFQ---------
ZYRO0G14256g       NVSA----TGTGDVSNYNS-SLGEGASAVSNPSISMNP-PIAPSTISRNYSLMMKTQNGH
TDEL0B00540        NCA-----EGASSKERFKS-TTNDVSSALSSSSLEANP-PMAPATISRNYS---------
                                                                               

KLLA0D01485g       -------------------------PVAQHEG----------------------------
CAGL0B02365g       -------------------------KISYVPP----------------LNGQAPKMDYPK
NCAS0B00280        -------------------------KEFGFGI--------------------SPNVDEHQ
NDAI0E00270        -------------------------DRKNKDK------------------NRRKQVQGGI
ABL122C            -------------------------DRRPRHT----------PGRSTDSSASQYNSQTPT
Ecym_4615          -------------------------DKSLCRG---SAHVNDNNNALGGFNNYSYNCGGSN
TBLA0B03280        -------------------------KTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKN
SAKL0D01364g       -------------------------VASSHSN---------NSYHNNGRHDASKKRHGGG
KLTH0C03784g       -------------------------ATSKHNS--------RRGSRFGTTEKSSPRYNDIR
Kwal_27.10239      -------------------------SAPRRSA------RKNGHDHDSNPVSGSKSDIGSK
KNAG0G03440        -------------------------EASYHNE--------------LVTGNDHPDTGYGK
Smik_13.17         -------------------------KKNETPI-------------------RDIVPNGET
YML117W            -------------------------KNNETPM-------------------QDIFTNGET
Suva_13.26         -------------------------KKNQMPI-------------------QDAGINAEV
Skud_13.24         -------------------------KKSETSF--------------------QDSRNAET
KAFR0A02850        -------------------------KNRNDGM----------------------------
TPHA0I00270        -------------------------RTHNTRV----------------------------
Kpol_1068.5        -------------------------KSSKQLS------SDLTNLSTMDQNDMSENDSNTS
ZYRO0G14256g       PHPRRDSSDRQNQQQQQQQQQQQQQQQQQQQQHQQQQQQQPNPSSSHNSGDRMSSHVGNS
TDEL0B00540        -------------------------LMFKQQY-NHEKLRDFEGESFDDESQQESNFDFES
                                                                               

KLLA0D01485g       ANNGNPRKSS----MKPIAGSDVMTRYLEQLHHNTFVYAANILGAT----QDPVFYDEDN
CAGL0B02365g       KYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEEDPSAP----
NCAS0B00280        KNNKKHNTN--DKEARVIPGSDVMAQYLAQLQHSTFMYAANILGAS--AE-DGSYYDESN
NDAI0E00270        QDQDPHLSST-GKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVS--AE-DNTYYDEED
ABL122C            NANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNG
Ecym_4615          NGNRTRRRRQ-AKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHD-PLGFYDVNA
TBLA0B03280        PFRGPRNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVS--AEDNNITYGDDG
SAKL0D01364g       KGNTHHGR---HRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENG
KLTH0C03784g       SQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVD---DGETVFYDENG
Kwal_27.10239      STQGKSSKSR-QRNAQAIPGSNVMAQYLAQLQHSTFMYAADILGVD-----DPNLHSTL-
KNAG0G03440        AENGRHRQQL-PRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGAS--NEGTEQYDDQ--
Smik_13.17         TSNRKKNRGS-FPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNTHTEE--
YML117W            ANNRKKKRGS-FARHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNTHPDE--
Suva_13.26         TDNKTKKRGS-FPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNAYSDE--
Skud_13.24         ANNRERKRGS-LPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNAYSEE--
KAFR0A02850        RNNRSRNR---SRYSRTIPGSDVMAQYLAQLQHSTFMYAANILGAS----GEEEYYDEAE
TPHA0I00270        -DNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNAS--IE-EPEFYDEND
Kpol_1068.5        SKNASHKRSS-KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGAS--SD-EPEFYDENV
ZYRO0G14256g       RGQQGKGRNK-RRNAKAIPGSDVMAQYLAQLQHSTFMYAANILGAT--AEGDVDYYEDNT
TDEL0B00540        TQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGAS--NDGDNNYLDENA
                                  . :.* :**:.** *::*.**:*::::*..               

KLLA0D01485g       A------
CAGL0B02365g       -------
NCAS0B00280        A------
NDAI0E00270        TT-----
ABL122C            NEQH---
Ecym_4615          NEP----
TBLA0B03280        EPLN---
SAKL0D01364g       GFRGPM-
KLTH0C03784g       PTTDPLI
Kwal_27.10239      -------
KNAG0G03440        -------
Smik_13.17         -------
YML117W            -------
Suva_13.26         -------
Skud_13.24         -------
KAFR0A02850        LPTVNED
TPHA0I00270        IDFAKQ-
Kpol_1068.5        INAGNS-
ZYRO0G14256g       EN-----
TDEL0B00540        DS-----
                          

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0D01485g
-----------------------MNSGTSANHYQPSLIYGRPPVG----------YEQQV
YDVAGRNGGSNH-----------HPPQYIY--------------YTHR------------
GGSMPGS-------IPGSIPGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTPQT-----
GGPMSAGT-------------------------------GANGVPVGSNNIMNLRNSSYK
SF-YPPAPKLRPAPSGR----------LRRARRKDNKPQQQREHSRDNNKVEAEYDVERG
YSSRSASRSQSFSASTSGSMSGSSGPKSIRKTIDSELKIQFQYSILPK----GNDTYRSR
SLLFTNVN--SELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNTSNNDDDPNQNYN
ADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAE
IKNAVKSDQLAMNFVKI-------------------------------------------
------------------QDDEEWMANLKMNVISL-GATRSLYVEFA----DDSV---TS
DTIWDTL-PFL---KNSGKYVVIDVDVVT--------------------TDER-------
---------RKN-FGLHYCLLHFLSVTMALEVKELLETG-DEA---VSRVSFVT------
---------------------------------------PANSADKEMRRRRSSAISLKQ
EASPQMFSTDSRSRSRSSN-VSLPLS------EQVSTASTDISTPIYE-EFDG-NL---T
WSTLIVDVSEYKEPIVNEFDHHLNSWSIS------------KPTTLYMHESGTTNFSSS-
------------NLSDD--IDPLSISSHDPVPQQ------MLLNEYPYIMEPL-------
--------------------M-------------PPQITQTIQNQYSKSIQAVNA---GM
EHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLE
PIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQN
RYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYS------DTKD
NLFH-----KKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGSNHNRNSQNNNTSRGHR
QRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNKNFLSLGVDADFSEGLGIS----
-------------------------ISPQAE-----------RRHVLSDNEDEREEHREE
EQEECGNRHSGVNGSNVANNE----AINETLINGTYTADIPEDTLQVGS-----------
DSCS-------TYSGSSSSDVDIIVNAPSPKA----------GDAKSFTHTRRNAHHRQR
NTNQTRQYNNHHHAQQHQFQPLSHINAPYQTPQPQYHPYPQTPHRFSNSFV---------
-------------------------PVAQHEG----------------------------
ANNGNPRKSS----MKPIAGSDVMTRYLEQLHHNTFVYAANILGAT----QDPVFYDEDN
A------
>CAGL0B02365g
-------------------------MTEKVKKHGRHYVPQTYY-----------------
-----------------------SVPDLYF------PMAHAHAHAHPQ------------
PPQLMNS-------------PYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNN
ADLLAGGY----------------------------NRNNRSFQFRRNSGFVLQSNGNTP
YMSSKRSSLSQAPMSQK---------RAEKNSTDSSVGSHGKKKLQHKKRTP--------
-------------IDVTKKLISP-------------ISINYR--VLPS----GDDTYKTR
SLLFENVQK-NDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKES--------------
----DKDT--------------------------CCLQLSFLSRQAALDFYNNFLQRLPD
FKKKLSSPKLSVSFVSFSYVTDEDKDKDKDKDKDINTEKRN-------------------
---------------IKRSQELLKEPALGEEIFSH-DATRSIAIEF-----YSQV---EQ
DALFEKL-PFL-DDKDNKRYILEAVDIIS--------------------AEDA-------
---------ADD-FPANYVILTFINIKMAIEVLDYLKAN-LMT-YSVNECFFVS------
--------LPGC------------------------------------------KSQRES
STTPVLGHISTEGSKSVSE-VNLANG------GNTVMIDRELES-LSD-ELASLKL---E
EKCLKIIRSDYPKPEIRSHDDHIPGST--------------NFSMYIFDDGMNPEGNSGM
--------YLHDNLTDHSSIIGSPFSNYIDPSIS--------HVMLPNNGLPVGGFDAPG
KFPIEPISGPPFNH------T-------------NKVITQSIEDRLNTSARIAAAMGGDA
DNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFID
PIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHE
RYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN------HNNG
EEFH-----KKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKME
EKRKMQ--------EDNLLS------QKKNS------IQLDSLGISVDRT----------
------------------------------------------------------------
----FSNESKLSGGHTTTEEN----GGV--------KQDLESNDYKSDH-----------
PQISSNGPIGIGLSSKKSPIFDDISGSDESVISD--------FENSASKETSSSDRKYQT
TNSR--------------------GDTFVPKTNLSHAP-PRAPSTINMTYK---------
-------------------------KISYVPP----------------LNGQAPKMDYPK
KYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEEDPSAP----
-------
>NCAS0B00280
---------------------MVGPHSRRNSGYQAFQLQQQQQQS----------QQYMQ
YNGQRQRKPSYGPLGPG------TNSMLFY--------QGEQARSQYF------------
PTQQP-Y-------YQTS--PLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTT-----
GHSQSAIF----------------------------------------QQPYMMTPNRAS
FSQIPSMLNVGNPPSAR---------------RQGNQNDPNRRRSSYRSKVP--------
------------ETDPKTLFLQP-------------FRMSYK--ILPS----GDDAYRTR
SLLFENVV--NSIELHTFMTEFVRFSPIESVYLINHHDSDKPDD----------------
----DTEC--------------------------RSILLSFLTREVCLTFYNNVLQRLKE
FKAKLKSENLRLSFVSIKYQDENEEEETN-------------------------------
---------------IVDEPSFYTKESVYFELSNP-QATRSILIQF-----KNPC-S-EQ
ELFDKKL-KFL-NQENNSRYILESIDLVN--------------------VTQT-------
---------ENE-FPKHYAILTFINILMAMEICDYLKIH-GPR-YGIQDCMFVQ------
-------------------------------------VIPKAVSCVSSKRASIISKDNDN
NDETLSSQQKKNDILKNSSIISLPSA-----ENDQVSDEEKLDK-LSE-KLKSTNI---E
ELILIVDTATYPRPSFLSHDEHLPNATLS-------------------LSSSSNPFEQQL
PYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKG--------YISPNPNMNYNTPLMYPN
GYFVNDPAFSMNNNYNNNTNY-------------RNPISKTLEQHATTTSQVVNSLGADA
GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID
PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ
KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAH------NPVE
SKFS-----EKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELE
EKRKAD--------TERLNSLRKTSSSDGQL------SKLDAFGIGIDTV----------
-----------------------------------------------SNNEEDGNIEKGN
TLSKIDTDVNGFNALGFKIEP----KHD--------MMNETMDNNTEGN-----------
NTLE-------NISSDESSNIELMISSPKESVQK--------GDVITNQKPHSNNHHNFK
RNSS------------------SNRQRYKETDTQNTHR-NNNNSNATFAPN---------
-------------------------KEFGFGI--------------------SPNVDEHQ
KNNKKHNTN--DKEARVIPGSDVMAQYLAQLQHSTFMYAANILGAS--AE-DGSYYDESN
A------
>NDAI0E00270
---------------------MKSYQQQQQENPYPRYNKSFSRRG----------SSYYM
NVQQDQRSRKPSYISLNHSV---HNPNMVY--------QHDPNGSQYF------------
ATTQQAY-------YIPS--PLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSS
QQQSQMFL----------------------------------YSQSPAGTPNRKSFSQLN
SMLNQPSSRSNFFTDSY----------------------NNRYQNNPQTRIP--------
------------EVDPNELFQKP-------------FVISYK--LLPT----GDDAYRTR
SLLFSNVA--SSIDLHSFIYDFVQYSSIESIYLISNTDDEKDQDNEN-------------
----DKNK--------------------------RSILLSFLSREICLSFYNNVLQRLNE
FKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNE----------
---------------FDYRNSMNTVNALKFDLINP-DATRFIMIEL-----KTKC-D-KE
TLLNKHL-SFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDT
MVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLN-GLK-HGITNASYVQ------
--------IKHV------------------KKSLNSSSKRSSVTSTTDNKDKSEVDTNES
VEGKDKKSEEAKSFNNKLSSITMSSP------DTTYEGEDDIDIDIIISKLQKLKL---K
ETIQVLDIATYNTPLFQSHDSHMANITLS--------------IVNPFEAQLMRPPPSNI
VSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQ-ETSGRRSLSSSSTSLSNYQGRSNSN
NYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEM
GNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFID
PLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHE
KYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVN-----NNPKD
NTFS-----KKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQ
EKRRVE--------QEKGKEL-NGGVNDNKL------PSLDALGIGLQRT----------
------------------------------------------APPEEQKVPESNEDDANY
DSAVTESDTNTFNALGFRIQS----NTD--------SHDDEQNDEKGEE-----------
QEEVDVIAHADDISSVNSSDVEIIIDCPHNE-----------SDTSMIQEKKKTIRKNQQ
KIDR---------------------LAKARNAMFPEHR-ETIPDINNKLFH---------
-------------------------DRKNKDK------------------NRRKQVQGGI
QDQDPHLSST-GKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVS--AE-DNTYYDEED
TT-----
>ABL122C
--------------MTNYQRLGPLGQAVPGPGAGGQPASSGPAQG----------PGTGP
-----------------------GQPARFF------------------------------
PGAEGMS-------LAAG--SMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRP----
QAHFHPST-----------------------------------PGHSSHSLHHAQSARSS
FLYYPQPPMLKPIPPRR-------------------------------------------
------------KKSVTLNHSEP-------------YHINFK--ILPK----GKDEYMTR
SLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM--------------------------
-----DDN--------------------------HSILLSFLTKATCLDFYNNLLQRFSE
FKTKLHSPKLSVSFVC--------------------------------------------
------------------QDESSWFKYLQMNVVTR-GATRSLTVEF-----EDSVKELNE
DFVRLKF-PWL---FCSQRFVLERIDLIN--------------------ATTV-------
---------NQH-FGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVN------
--------VNGH----------------------------------------------HS
KLSDEEAAAAANGLQQDSRTSSVSSI--------SLSISNTADL-AALFHSLDLSL---D
TLSLQVVPSEYPTPLIEQHSEHLTSITIS------------RPSKTLGPSASLIEMDSNA
-TNAGNHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPM
SLHNPSDGNGGSPSYFMDPMV-------------GAPIGQTLQRQYLAGASQAN----GI
NNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLE
PIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG
KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSN---SPIEKNL
EKFH-----AQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGK--
QPRKED--------GIVNSD---DLTKNNEV------LP----GVQMNSS----------
------------------------------------------------------KNGGVG
ESQSLVGDQELAEGLGISLTS----AQISPDTGHTHHYSDGVEEGDECD-----------
DDDA-------GYSTSGSSDIDIIVAPPDEFKRRES------GTSS-GKHKKKSKSTRRN
QHSN----AASSASYNQQY-SLGSLDHTSSAGSLDAPP-PLAPSSMQQHLA---------
-------------------------DRRPRHT----------PGRSTDSSASQYNSQTPT
NANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNG
NEQH---
>Ecym_4615
-----------------MRQLGQQQQENHRKSSNSYMANNQRLGA----------VDQDQ
KHGQEQDQEQEQDQDQDEQP---RPQQIHH--------------QRFF------------
PSGDVAS-------SLSAAASMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRP----
QGHFHPSA-------------------------------------------SSHSNHSRS
FLYYPQPPILKPIPPRR-------------------------------------------
------------RKSFSLNHSEP-------------YQVNFK--ILPK----GKDEYMTR
SLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL--------------------------
-----DDS--------------------------HSILLSFLTKATCLDFYNNLLQRFSE
FKSKLHSTKLSVSFVC--------------------------------------------
------------------QDETNWFRLLQMNVVTR-GVTRSLCIEF-----EDQSMELTS
DLIHEKI-PWL---FFSHRFVIERIDLVN--------------------AAAP-------
---------KNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVN------
--------VNGH----------------------------------------------SS
DLSDEDAVAAANGLQRESRTSSVSSI--------SLPISNSSDL-VELFHSLDLAL---G
IISLQVIPSEYPVPLIESHDDHLHSVTIS------------RPSKTLTSSTSLVEMDGGP
---NGGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVL-GTSQSL
SLHNPNDNGGAGPSYFMDPMS-------------GAPINQALQRQYLTGTGQV----GGS
NNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLE
PIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHG
KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCN---SLSQRNL
EKFH-----AQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQ
QSKRGT--------SSASSD---DARKDDAS------TE----KVPVSSK----------
-------------------------------------------------------EPVCD
EILGLNDDNALAEGLGISLSS----AYVNEYGDDISKRTNKKNRSKTET-----------
VEEDT------GYTTSGSSDIDIIVAPPLEHNKGKE------GNSNHGKSKRKSQGGKRL
QNGAQDGVGGGYGGHSQHY-LAGSFELVNSNTYLDSIP-PLVPSPINQHFH---------
-------------------------DKSLCRG---SAHVNDNNNALGGFNNYSYNCGGSN
NGNRTRRRRQ-AKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHD-PLGFYDVNA
NEP----
>TBLA0B03280
-----------------MSKHSRRWNGSNSRNNSRNRGTPFSTNN----------MMNDQ
YLYQHQFYFNNPNATTNSNS---NNQTYFHQNFTNNNAYFDNSNQEFRINNSNTNMIDHT
SALNPTY-------YS----PIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIH----
SFPYSATS--------------ISSTPTRKSFSRKNSNSNSISNSNSSSMSNLNLNSKYD
NYPIPPVPILKNPPLNN----QNIRNSRNNSNRIRNNHIINRKLLKDDNSYRISQQTFKE
NPMIIEKPKYSSVIDINKLLEIP-------------LVVSYK--ILPK----GTDEFRTR
SLLLENIN--QSIDTRTLVKNFINFGPIESVYLIKLNP----------------------
----GSKY--------------------------NSILLSFVSREICLDFYNNVLQRLME
FKTELSSKSLTLSFVILKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEE
TDGEEIVIEDIRNDLNKENFPLTFASALQSDLVKR-GATRSLLLKF-----NGVV-S-KD
QLINEKLNLFI-NNNLNNRYILESISLVNIENNTKNNKNTIGDDNEDQIEDTP-------
---------ISK-FGNNYCLLTFSNILMAIEAFDYFKAK-LNE-LNIFDCFFVSKTNYHK
NSENSKSTISHSTPSSKISSIVNLPNEINNNNKSNVPITSLNSDNDKSNVSISNDNISND
NTSNDNNNSNDNPINNNDITIRNKSRKNSNVTVHELSMDQEIEI-LNE-KLKNIDL---K
DNELIISAKIYNQPIVEEFDQDLENISITNLSNSNYLLLNQQPFEFNMNMNMTMNMNMNM
NMNVNMNMNMNMNMLPPQSMPMPMFAGNFDMIDP--------MDPQRSRQPSV--LFTAT
QQPQQPQQQQPQQQG-----T-------------HNNLTQTLENHFNTSTELSAVLGGGP
GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID
PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE
IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVN------EDDG
IRFH-----NKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVKKPAYQIKLKKIE
EERRLQ--------EENNLRNNNKLSNNSQIRKPA--VNLESLGITFESSETDTTI----
-------------------------NTTNND-------------IDTPEDTQKLTSPATS
FDDDHKVDPASLEALGIITTS----ATVAVTKNIDPSQINTDTSNHEDDETSSTDNAIEQ
FSNENEDEELDSQSSDDLSDVELIIGSGDNSDALT-------LENIDNQKLKKNKNKHNK
RKVH----RSHNQ----------KILQSNQVPVLNQYP-PMASSTLTRTYR---------
-------------------------KTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKN
PFRGPRNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVS--AEDNNITYGDDG
EPLN---
>SAKL0D01364g
-----------------------MPNYQNKNYSSHQYATMAPPNG----------IQPHY
-----------------------PQTMAYH------PMGPMNGGVQPT--------MQMS
LPSQQGY-------YAGS--PMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMH
AGSRGLNS--------------SQQQFYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMT
RYSYPPPPQLNAPPMTH----------------------------KRKTHLR--------
------------HETNSQPSSEP-------------YVINFK--ILPK----GDDEYMTR
SLLLSNVN--ASIKLHDFITKFVKFGPIESVYVVPEEEEEEEEEEEEEEEEEEEEEEKG-
----EEKK--------------------------QSILLSFLTKNTCLDFYNNVLQKLSD
FKIDLNSKSLTLNFVSL-------------------------------------------
-----------------------TSEDIRDDVLRK-GATRSIALEF-----KNSF---TT
KQL-ESI-EIL-SNASNSRFVVEKIDIVN--------------------TESP-------
---------NKN-FNTHYAIIHFISISMAVEASSYLLNW-DEK-LGISRLFFVT------
----------------------------------------------------------DS
IINKSDYFRSAPASQDASR--------------SSVSIDQTLEF-ATK-KLQGLVL---K
ERTLSIKPKTYPQAEIEEHQHHLTSISIS------------KPLLSSNNNSSSVSLQGNQ
-------NLTSSPVTQEMYLHDTSNSTREDVMIQ---------SSMASGTSNF--VPPPP
HYYMD---------------V-------------TKPIRQTLQQQLTTTAQVASNMGGGL
GNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIE
PIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFRE
KYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDAN------GADN
KKFH-----GSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKIRMHKQN
KAGGSNG-------QEPISS-----------------FQDNAFGICISPRGIESEE----
-------------------------VEALPD---------------VPQNIEEEKNPQNN
GLLKLANGNGIGEGLGIEFSP----GLNKEGHEGDDKFDCIQQENGFDG-----------
KDED-------ESYSSDSSDIDIIVSAPEQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSR
TKLK----RRPTSGLTDLY-SLNGFPSMVSSTSLDAVP-PLAPSTVSRHYS---------
-------------------------VASSHSN---------NSYHNNGRHDASKKRHGGG
KGNTHHGR---HRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENG
GFRGPM-
>KLTH0C03784g
-----------------MSSYTPSAHRSMGKHPKGLYAEQRSHVA---------------
--------------------------------------------LPEG------------
SREYSGY-------YHGN--RVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGM-----
-GSASPHR--------------------------------------AGGSRSSHAQSSYH
TPNFGSTQLRMPPPTEK-------------------------RNFKHGSSYR--------
--------------HNSSVQQRA-------------YEVVFH--ILPRSADGGGDEYMTR
SLLFSNLN--PDTHLHDFLTKFEKFDRVESVYLV--------------------------
----DSQQ--------------------------QSVLVSFLTKETCLDFYNGVLQKLSE
FKKELKSKELTLNFASLR------------------------------------------
-----------------DVKTGPTLQEIKIEVLRA-GATRSLILEF-----QDKV---DL
ALLSKSL-GFI--VNEGPRYVVEAIEIVN--------------------AGRS-------
---------SKH-FGPHYAIIHFISIAMALETVEYLKSQSNKL-AGLIKFRYVN------
------------------------------------------------------------
----TTSASGKSEFQTLSS-SQLNERALSNTSDSDISGGESVAS-LGS-KLQQTSL---G
EQTLVVDPTQYGRPLVEERSEHLPHVTIS------------KALN---SKSSLNDLTSNT
----------TSPQPQEVLVNDHEDSSSRGSMVS--------LKQANSHGPAY--PPIPG
YPFYMN--------------M-------------SKPLGQTLQQQYTTTAQVATAMGGGL
GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIE
PIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKE
KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDAN------NPNN
DSFH-----EKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQ
KGASDA--------PTEVKD---EAKELDKP------IKADAFGISVGDT----------
-----------------------------QN---------------LVRDSDEEQKLEED
ELLRLSDLNNTGGGLGISLAS----STG-----------EETNTPVSDE-----------
SSKE-------ESVSSESSDVDILVSAPGS------------ADTSQLESKTAPRSPKQP
RVLA---------NVPEKPSAFSAIIPRVSSASLDAVP-PLAPSTLSRQYT---------
-------------------------ATSKHNS--------RRGSRFGTTEKSSPRYNDIR
SQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVD---DGETVFYDENG
PTTDPLI
>Kwal_27.10239
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MSSPFLATPGV-----
-GHSSPHR-----------------------------------------------HVTNK
SSQAYKSTQLRMPPSDA------------------------IRGSRRHNKEK--------
------------HLYDEGTRQIP-------------YKLTFN--ILPRNGNGDGDKFRTR
SLYFSNLN--PDVRLHEFLATFHKFDRIESVYVV--------------------------
----DREQ--------------------------QSVLVSFLTKETCLDFYNGILQKLSE
FKKELRSKELSLSFASPQ------------------------------------------
-----------------KVESGPTLQEIKFEVLRA-GATRSLGLEF-----KDEI---DF
ASLLKKF-DFF--DNSGPRYVIESIETVN--------------------TDKP-------
---------SKY-FGSNYAIVHFISIAMAVETMEYLKVQTPES-FGLTKVSYVN------
------------------------------------------------------------
----STFTSGKSEFQTFSN-SELSDQ-------NDVEVQDSISS-FEDITLSEGSMSVEN
EKAFTVLPSQYGPPVVEEHNQHCSHITIS------------KALSSKVSRNGSSSSIAS-
------------PQPQEVLVSNSEAPSSRNSIVS--------LLSARSQGPTY---PVPG
YHYYMD--------------M-------------SKPLGQTLQQQYTATAQVATAMGGGA
GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE
PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE
KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDAN------NSNN
ESFH-----EKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLRRQQ
KSDIEA--------QAKSGK---GDENSEKK------LQVDAFGISVGSQ----------
-----------------------------PD----------------ARYSDEEQKIEEN
ELLLLSKPNSAEGGLGISVSQ----DVT-----------VTENNTACGG-----------
KNKT-------GSVSSGSSEVDILVSAPGS------------ANTSQLEGGGPTQRTTAA
SNGK----KERSSGVSKLH-CFSEIAPRVSKASLDAVP-PLAPAALNCHYN---------
-------------------------SAPRRSA------RKNGHDHDSNPVSGSKSDIGSK
STQGKSSKSR-QRNAQAIPGSNVMAQYLAQLQHSTFMYAADILGVD-----DPNLHSTL-
-------
>KNAG0G03440
------------MDFQLKRNNAQHGYNQNHPGFTQDSVNNRDAEN----------SGPRP
TYPQVMYQFNQNTHGYPQGTVSKQAPLSQQ--------------SHPF------------
PQNFAQN-------FPPNS-PMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLP----
QTNYTAQR---------------------------------------KGSHTGMANGTGS
MNYYRTDPQI--------------------------------------------------
---------------INGLFQIP-------------FEISYK--ILPK----GDDLYRTR
SLLLGNID--DMVDLHTFVSKFVQNNSVESVYITKEGQ----------------------
----QPEK--------------------------YGFLLSFLSVQICLNFYNNVLQRLKE
FKEQLKASSLELSFVSMRQRPTKVEGKIYR------------------------------
---------------RFAADDGDGMANLHFDMAAQTGATRSIAIEFVD---KDVILT-RD
ELLNKKL-KFL--SEGNNRYILEHIAVFK--------------------TQHG-------
---------TKV-FGKNYAIITFLSIPMAMEIMDYLKLN-IKQ-LHLTKFFYVQ------
--------VTHP-----------------------PQQSPAASQKK----PHANDTESNR
DTSPPNSKKDQEFFPNNSM-LSLVSS------ESSTSLADDVDG-LVN-KLKSIEL---Q
ESTLKLRVEDYPEPLFEQFSEHSNGIVQS------------LPVPQ--TRPIGGPQSSIS
TPRAFGAFPNDIGSPPASFL--PLDLNHSNSVPN--------LPPGFIPATPS--GPMSP
QQQQLFLNSQRQQRDHAGGKF-------------AHPITDSLESQMKTSTQVATAMGSDF
NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID
PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE
SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAS-------TKQ
DHFN-----QLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLE
EKRRNQ--------DAERRE--MVNGTIPEE------NPFDAFAINTGSA----------
------------------------------------------------------------
----EKKDELSLDSLGISIME----VES---ASPISPVMGDLEDHTNGS-----------
YTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRS--------VGVLEGDPSTLSPPSDKR
KL-------------------------VALHEVSSPPP-PLAPDTISRQYA---------
-------------------------EASYHNE--------------LVTGNDHPDTGYGK
AENGRHRQQL-PRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGAS--NEGTEQYDDQ--
-------
>Smik_13.17
----------------------MSNQNQRKPVANYAYRQQQDYNG----------MNAMV
-----------------------GNPIIYH------PVDFINGAGQYG------------
PSQHPAY-------YSNS--PLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-----
QGGYSPAR--------------SSNFKRKAYSRPVSNHNN--YNGNNNSNQNNNNNGMVT
PSNYYRIERNSFSRNNN----STRNSTH-NNKGCDNRNSSGRRTSTRNNIFD--------
------------DISSELLLQRP-------------FRINYK--ILPT----GDDAYRTR
SLLIENVD--RSTDLHSIVKNFVKSNTLESTYIIGNEKSDDLKDE---------------
----QTSN--------------------------LSILISFLTRSDCLNFYNNILQRLSE
FKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQI--------------------
---------------DITNDSSMISASLHHDLENK-DATRSIIVEF-----KSPL-K-ST
ELFNKKL-QFL-DRSNNKRYILESIDIVN--------------------TDVP-------
---------SNQ-FPENYAVLTFLNIFMAIEVLDYLKKY-SKK-LGISKCFYVS------
--------LAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNND-NNNSNNHKSNISD
ANTHNSNNSTRASLYGNSN-VSLASL------PSSVSLNEEIDI-LTT-KLQGIQL---D
GTDLEINYHDYQTPTVHEHSTHLSNVKIS------------KTVEN--SRQFPHDIPSPL
------------PLNERMFMNDSNHSNGSIVPQQ--------LMATPSPVSST--IQM--
-----------NQRV-----L-------------PNPITQSLEQNFNVSAKVASSMGSDV
GNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFID
PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHE
TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDG
EMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE
ERRRQN--------ENDKKE-----RAFDKA------LNLESLGISLDSH----------
-----------------------------KD--------IGIGEIENKNCIGREIENEAE
AVNR-SNETVGIGGLGLGVAS----SEV--------NRAASDETDYEDL-----------
FNKS-------SGSSDSSSDIEVIMHSPSDPEYA--------LKSQTLRSSSQTVINSKR
PVKA----EDEEDAV--------EISQFNHKSSLRHAP-PRAPSTLSYNRS---------
-------------------------KKNETPI-------------------RDIVPNGET
TSNRKKNRGS-FPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNTHTEE--
-------
>YML117W
----------------------MSNSNSKKPVANYAYRQQQDYNG----------MNAMV
-----------------------GNPMMYH------PVDFVNGAGQYG------------
PSQHPAY-------YTNS--PLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNM-----
QSGYNSAR--------------SSNLKRKAYSRPVSNHNG--YNGNSNSNQNNTNNGMVT
PSNYYRMGRNSFSRNNN----STRNVTHNNNKGCDTRNNSGRRTFARNNIFD--------
------------DILPEMLLQRP-------------FCINYK--VLPT----GDDAYRTR
SLLIENVD--HSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDV---------------
----ETKN--------------------------LSILISFLTKGDCLNFYNNILQRLSE
FKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEA--------------------
---------------DITNGSTMISASLHHNIANK-DATRSIIIEF-----KSPV-E-KS
DLFKKKL-QFL-DRSKNKRYILESIDLVN--------------------TDVP-------
---------SNQ-FPENYAVLTFLNISMAIEVLDYLKKY-SKN-LGISKCFYVS------
--------LAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNNGNNNKSNMSG
ITTLNNNSSIGVSVYGHSN-MSLTSL------SSSVSLNEEIDM-LAT-KLQGVEL---D
GTYLEINYRDYQTPTIEEHSTHLSNVKIS------------KTTEN--SRQFSQDIPSPL
------------PLNEHMFMNDSNQSNGAIIPQQ--------LIATPSPVSPN--LQM--
-----------NQRV-----L-------------PNPITQSLEQNFNVSAKVASSMGSDI
GNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFID
PIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHE
TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESG
EVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLE
EKRRQN--------EIDEKE-----KAFDKP------LNLESLGISLDAH----------
-----------------------------KD--------NGGGETGTANNTGHENESELE
AENENGNETGSFGGLGLAVAS----SDV--------KRATSDETDYEDI-----------
FNKS-------SGSSDSSSDVEVIMHSPSDPEYA--------LKSQTLRSSSQTVINSKR
PVKI----EDEEEAV--------GMSQLNYRSSLRQAP-PRAPSTLSYNHS---------
-------------------------KNNETPM-------------------QDIFTNGET
ANNRKKKRGS-FARHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNTHPDE--
-------
>Suva_13.26
----------------------MSNSNSRKPSANHAYRKQHDHNG----------MNAMV
-----------------------GNPMLYH------PVDFMNGAGQYG------------
PSQHPAY-------YTNS--PLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-----
QGGYNLGR--------------SSKFNRKAYSRPISSQNSYNANHNNNNNNSNSNNGMMT
PSSYYRNGRTLFSRKDN----NAVNVTHNIHKGYETRNSSGRRTSSRINIFD--------
------------EIDPETLLQKP-------------FRINYK--ILPA----GDDAYRTR
SLLIENVD--DSADLHSLVKNFVKSNALESAYIVGSKETDNLEKE---------------
----ETKN--------------------------LSILISFLTRGDCLNFYNNILQRLSE
FKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQA--------------------
---------------ATDDASTMISASLHHDVENK-DATRSIIIEF-----KSPL-E-KA
ELFKEKL-QFL-DRSKNKRYILESIDIVD--------------------TDVP-------
---------SNQ-FPENYVVLTFLNIFMAIEVLDYLKKY-SKK-LGISKCFYVS------
--------LTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNND-----------INN
INNNNNNGSIGSSIYGNSN-ISLTSL------SSSVSLNEEIEV-LTT-KLQGIDL---D
GTILEVTCHDYPTPVINEHSAHLSNIKIS------------KTVDN--SRQFTQDIPSPL
------------PLNEHMFMTDSNQSNGTIVSQQ--------LITAPSPQSPN--PQMNQ
RV------------------L-------------PNPITQSLEQNFNVSAKVASSMGSDI
GNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFID
PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHE
TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSG
ELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE
ERRRQN--------ENDKKE------SFDKV------LNLESLGISLDPH----------
---------------------------------------KGTDIDEAEAEGTTGAEVENE
VEAENGNETVGLGGLGLGVVN----SDV--------KRALSDETDYDEF-----------
FNKS-------SRSSDSSSDIEVIMHSPSDPEYA--------LKSQTLRSSSQTVLNSKR
PAKV----ENEDGLV--------GLSQFNHRSSLKQAP-PRAPSTLSHNHS---------
-------------------------KKNQMPI-------------------QDAGINAEV
TDNKTKKRGS-FPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNAYSDE--
-------
>Skud_13.24
----------------------MPNSNPRKPGANYAYRQQHDYNG----------MNAMV
-----------------------GNQMMYH------PVDFINGVGQYG------------
SSQHPAY-------YTNS--PLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-----
QGGYSPAR--------------SSNLKRKAYSRPVSNQNGYNGN---SSNHNHSGNGMMT
PSNYYRNGRNSSSRNNN----STRNVSHNNNKGCDTRNSSGRRASSRSNIFD--------
------------EINPEILLQRP-------------FRINYK--ILPT----GDDAYRTR
SLLIENVD--RSTDLHSLVKNFVKFNTLESAYFVDNDKNDDLEDG---------------
----ETEN--------------------------LSVLISFLTRSDCLNFYNNILQRLSE
FKIFLKSKSLNLKFVCLNYESECLSTFVEGEKPKEVDEQV--------------------
---------------HAANDSMMISASLHHDVENK-DATRSIIIEF-----KSAL-E-KT
ELFRKRL-QFL-DESKNKRYILESIDLVN--------------------TDVP-------
---------SNQ-FPENYAVLTFLNIFMAVEVLDYLKKF-SKS-LEISKCFYVS------
--------LTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKND--NNNNSNKGNISS
INAQNNNSSIGSSIYGNSN-ISLTSL------SSSVSLNEEIDL-LTT-KLQGIEL---D
GTSLEITSHDYSTPTINEHSTHLSNIKIS------------KTVEN--SRHFPQDIPSPL
------------PLNEQMFMNDSNQSNGAVIPQQ--------LIAAPSPLSSN--LQINQ
RV------------------L-------------PNAITQSLEQNFNVSAKVASSMGSDV
GNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFID
PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHE
TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGG
EVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE
ERRRQN--------ENDKKE------SFDKV------LNLESLGISLDPH----------
-----------------------------KD--------AGIGVIETENITGDEIESEIE
AENVNDNETTGLGGLGLGVAN----CDV--------KRATSDETDYEEL-----------
FNKS-------SGSSDSSSDIEVIMHSPSDPEYA--------LKSQTLRSSSQTVINSKR
PVKV----EDEDDV---------GISQLNHRSSLRQAP-PRAPSTLSYDHL---------
-------------------------KKSETSF--------------------QDSRNAET
ANNRERKRGS-LPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS--AE-DNAYSEE--
-------
>KAFR0A02850
---------------------MMRPSYSRKNSGFHIYQSQQPAQD----------QYYSA
FDT--------------------TNPLMSY-------PQFEQPYGATF------------
PPPLSSSTHFQQTYYKGS--PLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTP--
QQQYFLQQ---------------------------------QFNTNNNNGSSTPRKSFFK
VSNRPISSRSSRFSEKR----------------KSFIINNPTTNNSNNNNNN--------
------------KEILEKLFTEP-------------INISYV--ILPK----GDDAYRTR
SLLFENVD--NAINLHSFITNFVKNNSIESIYLVPNKN----------------------
----DSNT--------------------------CDIILSFLSRHICLDFYNNVLQRLKE
FKKHLNSESLNLNFVSLKYNKTTRDNQ---------------------------------
------------------------GPSLEFNIVTR-DATRSLAIELCSNENDSLILE-KE
QLFEKILNEIL-RTDENKRYVLESIDLVS--------------------TDKS-------
---------NKE-FGKNYAILSFLNITMAIEIMDYIQVI-SSK-LNIGKCSFVT------
--------IQPL------------------------IENNVMNNSSALSSATNIQSSVSS
EGNNNQNNNGSTFFHKNSI-NSLLSS------ESSVSIDEEVIS-IAD-KLKGIKL---K
DISLDILPRDYPEPEFNFSTDHLPNVTIS-------------------VPTQLDQIPGT-
------------PRTQEIYINDMSPSFEGIDMMN----SSSTMLSGNGTFISNTPMLIPS
QSFYMDQNTQIQEAPFRSNSF-------------IHPITDSLENQLSTSAKVASAMGSDA
GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFID
PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE
KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEAT-------NDF
DRFN-----EKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLE
EKRRDH--------DRRENG--FKHVYNDEE------TIYNE-SMETDNQ----------
---------------------------------------------------------HNE
ESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEKSITKNNG-----------
FENT-------SFHSDSSSDIELIINSP---------------NSLRTKDNDVLDSEK--
----------------------------IINSANTTNR-TGNANGYKNDYT---------
-------------------------KNRNDGM----------------------------
RNNRSRNR---SRYSRTIPGSDVMAQYLAQLQHSTFMYAANILGAS----GEEEYYDEAE
LPTVNED
>TPHA0I00270
----------------MKSPHKKMGNNNDQAHNNNENNAAHPFQQ----------QGGKV
PFQQTIQPVMFSHRNMNPPPYNFQNRGYKHGTSENHMYSNHQGLSQLD------------
SPINSSYSQYESHPYHSQQTPLPNPPPTPFDYAYGTTLLPSHILMNSPFVSTP-------
NKSYLSFQ------------------------------------ASPSRGISYNRRNSNQ
MV-FPNPPIITSPHLV--------------------GDKSERAKSDNYEKVD--------
------------TLDDEKRNREV-----FEEESAIAYKISYQ--ILPK----GDDTYHTR
SLLFENIN--ESIDLHTFIEKFVNYGLIESVYVVPSYETH--------------------
----QNSV--------------------------KSILLSFTSRSICLDFYNSVLQKLSE
YKTQLNSENLKLSFVSLCYLQNNINKGNGKISVES-------------------------
---------------QKNETDFELTSLIQYQVANF-GATRSLCIEF-----DKRVDK-ID
DFIETYL-PFL-SSNANKRYIIESLYIVN--------------------NNGK-------
---------DNE-FPAHYVILSFLNISMVIEVLHYIRSK-NLS-KTIKNCLYVS------
----------------------------------------FDRTKHAVSNSNRQSLSKKG
TSDTLNTYTLESPINHNTE-VDMNDI-------PSIYDENEIE--IAN-KLSELEI---Q
THTFNLDISNYSNPHIEIRAEHLPNVSIS------------RDPMIYANPIYQSPPSGYM
ENMWTTTPFLSSHIVHEEYANDRVD-----------------YNMKHYNNQLY-------
----------------------------------NVPLPQTLQSQFATSAEMASKMGGGV
GNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFID
PIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHN
KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVK------NEDN
NNFH-----ERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLE
EERKRN--------DEIKQI-------DNKR------INLDSLGITTSPN----------
------------------------------------------------------------
-QNIQEDETLSLAKLKLTSDT----GFK----------------NSENE-----------
SDID-------DSASNSSTDVELIINSPGNG-----------FKSHRNRKPKPNNLDL--
-----------------------GERPKVDAIVFKADG-PMAPNKLSHDYH---------
-------------------------RTHNTRV----------------------------
-DNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNAS--IE-EPEFYDEND
IDFAKQ-
>Kpol_1068.5
MAGSPRKNSSNSHVTTQYQQSSQFPASQQQAGSYAQLQQQSHHNGGHLPILQQQQHQQQQ
HQHQHQHQHQHQHQQPYLNS---GYPVYHQGLAGRDAVAAINMINSQL------------
SNSPGVY-------YTNQ--HIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM-----
GQSYSQQF------------------------------------ARPSPSKGGNSMGRLS
SA-YPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRN--------
------------TNNNGGRFTQKNIIKRFQENSLNRFTISYK--VLPK----GNDEYQTR
SLLFENVD--KSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDND
DNANNHDT--------------------------QSILLSFLSRPICLDFYNSVLQRLSE
FKTQLNSNDLTLSFVLLKYKNQDRPDD---------------------------------
---------------EESDFSPALPLSLEYDIIKR-GATRSIAVEF-----NQPITS-KE
GFMNSKL-SFL-LSPENKRYIIESVDIIN--------------------AAER-------
---------DAN-LPKNTVILTFLNISMTVDVMDRIRLE-RKD-SGISKCVFVT------
------------------------------------------------------------
------FNKENPTVPNMKR-LSLVDI--------TSDISNQLNS-----EFENTRL----
-----------------IHLIWMETINCN-------------------------------
------------------------------------------LRXXX-------------
--------------------M-------------LHQLLRASKHQFATSAEIANTMGGGA
GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID
PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN
KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVN-----SSNGG
KTFH-----ERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLE
EERKQE--------EKNKIS--------NKS------INLNSFGIQVETP----------
----------------------------------------------------------SQ
NESEQEEPKISLDGLGMSLSK--------------------PNSENHDL-----------
KETD-------DSDSDISTDIELIIDPPVRENTK--------GNKNKKQNHRKNDMNNNL
NF---------------------GNPPPVSKTLLESSP-PLAPATLSRDFQ---------
-------------------------KSSKQLS------SDLTNLSTMDQNDMSENDSNTS
SKNASHKRSS-KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGAS--SD-EPEFYDENV
INAGNS-
>ZYRO0G14256g
---------------------MQQQQRQNQQHQGHWNAPYRSRER----------IQEHQ
HQHQHQYQYQQQHPT-RVMA---NSPMAFP------PVGSLQ--AQYA------------
PPQ-PAY-------YAAAGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFQSQQ
QSQHHHHHQNHQHQIGMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLS
EASYPVPPPLKNPPVVA--------------------------RNRHRRRAQ--------
------------NEQADKMFKEP-------------FVVTYR--MLPK----GDDEYRTR
SLLFENVN--GSVDLYSFVSKYSRYGPVESIYMFKDRN----------------------
----DKTK--------------------------HSVLLSFLSRKICLDSYNSVLQRLAE
FKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNV---
---------------QDDAYNVTVVASLQYDIVNR-GATRSVALEL-----DGEY-D-KT
KLLDQEL-DFL-SPANNQRYVLESIYLIN--------------------AKEP-------
---------FKH-FPKNYAILTFLNISMAVEVLDYVRNNETAR-SKFQKCFFVS------
-----------------------------------VSSCPQTSSDGGIVTTSNSITPVAS
GGSAGIATNGDLGGYTSKN-ASLSSL---NSVGSYISLDQEIDF-LSS-SLK-------G
SHTITVAVDEYPKPFFAEFSDHLSNASVL------------EASAL--DTQISSPHPQEV
-----IVPSQDSPLVGGAPPLDAVHPAATPA-----------LSSQVLPLQPH--MAMNS
GIYMEPFGRRNKT-------M-------------IKPITQSLQKQFATSAEVANSMGGGI
GNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFID
PIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSD
EYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIK------YNDG
EAFH-----KSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRME
EERKKH--------EETLRS--QNQNNDEKM------LQFGSLGIHLEGNDNNKTSYERS
LNGEEEEEQEEVEPNEAEKANGEGGREKDEDNNQEPMNPISKDGNSENHGSGEKYQEEEK
ELLKLSNKSQIIDGLGIAAVA----GNG---KDMVASQDQDILDRAHES-----------
GDEE-------SLDSGVSSNVELILHSPLEGDSN--------NQKKHEKNNKPFKSKKLE
NVSA----TGTGDVSNYNS-SLGEGASAVSNPSISMNP-PIAPSTISRNYSLMMKTQNGH
PHPRRDSSDRQNQQQQQQQQQQQQQQQQQQQQHQQQQQQQPNPSSSHNSGDRMSSHVGNS
RGQQGKGRNK-RRNAKAIPGSDVMAQYLAQLQHSTFMYAANILGAT--AEGDVDYYEDNT
EN-----
>TDEL0B00540
---------------------MQSKESAQQPSLSPQQRHHQQQLH----------REY--
-----------------------NSPGIYQ-----------HMVPQFM------------
-NSQPMY-------YPTG--PVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLF----
QQPHHHQH---------------------------AHQRLQQYSHNQSKSSSGRSFGKLA
TA-YPVPPSLNSPPASR-----------------NALHNRGPRRGSHYKSIQ--------
------------SSDASKRFKDP-------------FILTYR--VLPK----GNDEFRTR
SLLFENVD--GSIDLHSFVTNFTNYGPVESVYLFKS------------------------
----EGDH--------------------------VSILLSFFSKAICLDFYNSVLQRLSE
YKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDS-------------------------
---------------KPDAFNITAAGSLRYDVINR-GATRSIMITF-----KTPC-S-KD
ELIDKKL-EFL-KKENNTRYVLESIDLVT--------------------ADEP-------
---------SKH-FPQNYAVLTFLNIFMAVEILDYIRLH-SQK-LDISKCFFIS------
--------IQPQ--------------------------IPDGKRLS---------VSSAS
NGRSMESISGNYRSKNASV-TSLESS------GSIISLDQEIDE-MTY-KLQSVNS---K
KNILEVTTNNYKDPSFEGHTDHLTNVTVS------------EAASL--DSQLTMPSPQEV
TVNEYVLPNQDMPLPNDMNYAPSVQDVDAVPPSM--------VPMSTMPNTPY-------
GCYMPPPNVRQNGN------M-------------TKPITQSLQRQYATSAEVASSMGGGI
GNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFID
PIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNK
KFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVK------YEGG
GNFY-----KMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKME
EERRQH--------EETLRR--QQENNSEKF------LQFGSLGITIDSNGKEDPE----
-------------------------KVDDVDFEDEVKFDSNSPKKTVEQASGKESDQEEQ
ELLKLSNKSQGAQGLNIVESQ----GQS------TREKEATKLTRNHSE-----------
NDET-------SAKSDASSDVELIINSPEEEESN--------FKSKSNRGFRKNDRRKLA
NCA-----EGASSKERFKS-TTNDVSSALSSSSLEANP-PMAPATISRNYS---------
-------------------------LMFKQQY-NHEKLRDFEGESFDDESQQESNFDFES
TQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGAS--NDGDNNYLDENA
DS-----