MUSCLE (3.8) multiple sequence alignment

NDAI0E00240        -MMYSSASSSPTKRTLNNKLPFLN---KGFYPYTDTDNCNNNTARAYNHNAYSNDYNYEL
AFR449W            --------------------------------------------------------MSFR
KLLA0C06292g       --------MTEGRRLSNRSS----------------------------------------
SAKL0D01122g       -MSSQKPSGANNRRKLNNRNSFQS------------------------------------
KAFR0A02880        --MNSTPQRSLSRRVLNNKSSIVSINTNSGGFYPYSKETQNRNDL-----------NGQH
TBLA0D03310        --MEHLDTTRYRKDWNDPEWQSPT---KAGGNTYLNYASPQRSGFNTSPQRTVFGASPQR
NCAS0B00250        MQSNPYYPYNGTKDWNNPNYQCIY---RRDSVPNNTSPMLG---------------SPQR
CAGL0B02409g       -----------MSTWQKGDIMY----------------------------------SPTK
ZYRO0C14916g       --------MLGLEDGKAIDLSFPA---AELPEFDINSQSS----------------SPTK
TDEL0B00210        --MINSATNLSHPTEGEPKHRFTS---KIS--------------------------SPTK
TPHA0I00340        ---------MSTSRSLNNKIFFEK---KSATGEYPKEWMN----------------SAYG
Kpol_237.3         ---------MSNSRTLNNKTFLVD---NREPVYNRN--------------------PNGH
KLTH0C03652g       MQNPQYSGVMGQSTLRNNMVRTVP--------------------------------SPNQ
Kwal_27.10210      ---------MHNTRTYDAASQYTS---GNGKSFL----------------------PASL
KNAG0G03490        ----------MYKRTLNNKSSVQG---EGYGL-------------------------PNR
Suva_13.24         ---MSQSPSVSPRRTLNNKSSYIS---SNGGPLL----------------------PPAQ
Skud_13.22         ---MSPSPSVSPRRTLNNKSSYIG---NGSGLVL----------------------PPTQ
YML119W            ---MSPSPSVSPRRTLNNKSSYIN---NSGGLVL----------------------PPTQ
Smik_13.15         ---MSQSPSVSPRRTLNNKSSYIS---NGGGLAL----------------------PPSE
                                                                               

NDAI0E00240        QTDSVPIIQQQQQFTVNHANDYKYSPQKSMKNNPYLNQRHQSISDHNSNNTGDMSNNNN-
AFR449W            NNYNSYPVQD------------------AQYSGQYYMQPF---------HSNGRVSLSNR
KLLA0C06292g       -------------------------------------------------IRNTTHIFND-
SAKL0D01122g       YSLQQHPCLTSTQLKGHG----------GNQQN----------------SQRSLHTSKSD
KAFR0A02880        YYMPQYADLEKTSYSTSPNRI-------AILNSNVVMSSPSVIPAMQPRLINTSTRHQH-
TBLA0D03310        TNPQPHVYTSPQRNNVFMNTS-------PQRNDAFINTSPQRLNTFMNVSPQRSNVFVN-
NCAS0B00250        QQQQYHYNTSPNKNNHAPQYN-------KYNNGSYYNY-----------YKNFPPSFNSR
CAGL0B02409g       RTLNNKTSGSKIASGSNGNGNGS-----GNGSGSAYHDPGSSYSSL---QKSNKMVFQEQ
ZYRO0C14916g       RTLNNKKVLDTT----------------SYYNGGWEKGEATGLPLAAPATPATPATPATP
TDEL0B00210        RTLNNKNYLAEDAPAYHFKPNL------EEELNDKLKISSLEVPADFKKDENLEPLPQRQ
TPHA0I00340        GNLTHHQDSSQLQNQSYSKRNINST---VNNSFNYNNYDNNAANYGRENFHNNQAYSNN-
Kpol_237.3         GNARMNGVVDAKKNGGYSSHF-------INTDDNYNYSSGQVNNFKQPQYHLNRNLLRSD
KLTH0C03652g       ITMIPVPHLQA--------------------------------------HKGEKRTLRN-
Kwal_27.10210      KMAPTLSA---------------------------PQGEN---------SRSERRTLRN-
KNAG0G03490        RDAGLRQAGGGGGYVAAGVVP-------GTKN--YNVGGA---------YQNYHPTLYH-
Suva_13.24         LDLNQQPV---LNFQQKATFD-------SNQQFFYYPDSP---------TKKPRPRFNS-
Skud_13.22         VKLNQQPV---LSFQQKTTFD-------SNQQFFYYPESP---------TKSQRPRFNS-
YML119W            FNLNQQPV---LSFQQKATFD-------SNQQFFYYPESP---------TKNLRPRFNS-
Smik_13.15         LKLNQQPI---LGFQQKATFD-------SNQQFFYYPESP---------TKNLRPRFNS-
                                                                               

NDAI0E00240        NNNNNRRYQQD--FQQLQLQFQFQSQSQTTSQSPQRINYYVNNNNNNLDNRHSPIRQTSP
AFR449W            TNNSNGQQKTT--EYRAK----------------GKYARSPVIVANSYVMVNP-------
KLLA0C06292g       TSSKTKG----------------------TKFKFKNGSGTRQSPNKQHISSSP-------
SAKL0D01122g       LANVQIGVTTTDKKFKFK-----------NQYPRAQPTLIRQSNVVKDINIKQ-------
KAFR0A02880        HHHQQQQQQQQ--QQQHHYQYPLQTGSYYNTSQMNNNYYYSNMRNNNSINSNR-------
TBLA0D03310        TSPQRTSFNPN--SNRPNLNWSTVESILPPNPMVNSPSKYNNNNNNNNNNNNNNNNNNNN
NCAS0B00250        RNSINKNVSPT--KMKFN----------SSSSSPSSPTKSMANSVANFIHIVE-------
CAGL0B02409g       PMLVRNMYDQNYYYYDGQGYGSPPMSNRNAMANPVSPFLYSPVMLPNHVHASP-------
ZYRO0C14916g       AAIPILSMNEN--------------------RLRRSPQRMGAKNTKSSLTGSP-------
TDEL0B00210        QGFPNRNYKNILETNGMPLRHGYPYQPRHDTISSAPDYRTRLSPTKNSKATNS-------
TPHA0I00340        -AYSLKGLNNT--YILNNMRNDNKIKRGQKPIMNGRSMPYKNMNKQNSRALKQ-------
Kpol_237.3         KSKKGRSILNN--NNGGW-----------NSNRPDNQSNISNVNNRKINDTNL-------
KLTH0C03652g       TSPLRKS----------------------QDFEGSKPTNTGKSGAGANGHSNS-------
Kwal_27.10210      TSPLRRS----------------------QVVDGGKTSPSTKSVTISSGQLNS-------
KNAG0G03490        TAN-----NQT--LYPV------------VNQSMNHPSVY---------HAAN-------
Suva_13.24         ASQTNKDSNEN--YYTSG---------NNGNNGNNRSSRYPNTTSTANVNSN--------
Skud_13.22         VSQINKDTNEN--YYAGA-----------ANSNGNRPSRYPNA-GAANVNANP-------
YML119W            ISQVNKGVNED--HYTGG-----------GSSNNNRPSRYTNTMGAANTNVNS-------
Smik_13.15         TSQINKGFNEN--RYAGC------------NNNGNRSSRYANTTGAANVGASS-------
                                                                               

NDAI0E00240        QRNINNSNNINHVYQYTKQNHYQNNNNNNNNN-NNNTTQYHQISSPQRQTTANYSPAKFQ
AFR449W            ----------------------KSGGQTVQHKQNSHH-----------------------
KLLA0C06292g       ------------------------------------------------------------
SAKL0D01122g       ----------------------QPYSSSSH------------------------------
KAFR0A02880        -----------MKQRNKMMNVTSPRYNQENTANNNKN-----------------------
TBLA0D03310        NNNRTSPYKNNSNTTNSNNKYYNKLNQSNSYLINNNNNNNSSNNRHSSPTKNSNNNNNNN
NCAS0B00250        ------------------------------------------------------------
CAGL0B02409g       ---------------------TTGRKKKVSLNRNPRNSNLVMPSSPIKNNNIDTGSKTAN
ZYRO0C14916g       ----------------------HRKGPRSSNLQARGP-----------------------
TDEL0B00210        ----------------------KSRNPRCK------------------------------
TPHA0I00340        ----------------------TKNPPNNAKNFTNKN-----------------------
Kpol_237.3         ----------------------RNPKQNLTFG-QNRN-----------------------
KLTH0C03652g       ----------------------RQRWV---------------------------------
Kwal_27.10210      ----------------------RPRWI---------------------------------
KNAG0G03490        ----------------------QPNYTTYPTV-RQPR-----------------------
Suva_13.24         -----------------------PHHQSVSHI-NSKS-----------------------
Skud_13.22         ----------------------HPHHQSVSHI-NSKA-----------------------
YML119W            ----------------------HPHHQSVSHL-NSKS-----------------------
Smik_13.15         ----------------------HPHHQSVSHL-NTKS-----------------------
                                                                               

NDAI0E00240        RTSPTKQYHYQEVKSESDI---LLTNSSYSK-LNIKNRYF---TENKEQLIKD-------
AFR449W            -----GNHGRTQVIEIPTA---ESISAPLHENRALKLRYM---AGPV-RPEGI-------
KLLA0C06292g       -----------PILEVQNI---ADVDTSNT--FGQFNRIS---QPPSKNLNYD-------
SAKL0D01122g       -----------SSTFVREI---PNISYIQRQ-ITRTPRYM---AAPV-KIDYE-------
KAFR0A02880        --QKPKKVQYKEIKDVSEL---FKDATNQDVNSYLLSQYFNKNTKPV-DFGEF-------
TBLA0D03310        NNNKQKQLKLKEIYDENSL---PVMNRMYIE-QSIRSKYF---NNSI-DLNQFFNDSTTN
NCAS0B00250        ------------INNFNQV---PKDTISNYQNHNIKERYF---TKQN-NITNN-------
CAGL0B02409g       LSGPGKKYK--ELRDIDDL---PRSPCNYET-PNLKNRYF----GPVQKVEDN-------
ZYRO0C14916g       -----PKYK--EISSIYEL---EKVDPVKQE-NNFTNRYF---SDPV-DLDSA-------
TDEL0B00210        -----------EKNDASQV---PTLNKLEKD-KIIASRYF---SPPI-DLRKM-------
TPHA0I00340        -----IKFT--IVHDESEI---DNDKKHSN--DDICNKYF---SEPV-DLNYY-------
Kpol_237.3         -----LKYT--IINSERDLLKVDNNELMRKT-GAIKNRYF---SSIT-NLNDF-------
KLTH0C03652g       --------------DVKII---DDIKCPTS--NSEKPRYL---TVPG-KFDVK-------
Kwal_27.10210      --------------EAKTI---SDVEKPVA--KAGNQRYL---ASPC-KIDYK-------
KNAG0G03490        -----RQVK--EATAAVSA---PTVPSSSGDLACILNRYF---TEDIVQLDRL-------
Suva_13.24         -----LRFH--QTKEADSI---QDIPFPSR--TCTAKRYF---TKPI-DLYGT-------
Skud_13.22         -----PKFN--QTKEVKSI---KDISFPSR--TCTAKRYF---TSPI-DLHGI-------
YML119W            -----LKFN--QTKEVSSI---NEIIFPSR--TCTKKRYF---TKPI-DLYGT-------
Smik_13.15         -----LKFN--QTKEVNSI---KDITFPPR--TCTIKRYF---TSPI-DLSGA-------
                                                        .                      

NDAI0E00240        ----G----DKLKPIINIIPKHSST--------TSKT----YKLLNPL--LSEKSITSMD
AFR449W            ----K----VPKNPVINLSKKKAPETY--------------YKIAEPLLNVAHDSSKSNT
KLLA0C06292g       ----T----PKINVKLEYHTMQSSK--------II------YKIDVPI----SSKSDMEI
SAKL0D01122g       ----A----CRTNVVVNETQKRKSI--------AY------YKLCEPM--LSEASRRKPM
KAFR0A02880        ----NHSNEMKSKAIIINTASRSWY--------KNSNKIQTYKLSTPI--LSSIKYGSTL
TBLA0D03310        TNSSNNSSMNKLKPIINTLPKHLKN--------VSRKK---YKLIIPL-RKLQQDSKGDN
NCAS0B00250        ----T----EKLKPIINVVPKSNSK-------------IVIYKLTSNNHNNNNNKSNALG
CAGL0B02409g       ---------TDRKANVNISYKNSKS--------KQKKPPVVYKLATPL---ASKDVNALD
ZYRO0C14916g       ----RSDD-GRLKPIINTASKNGKS--------YPGNKI--YKLSIPL--LVCQDTHRAL
TDEL0B00210        ----KRAD-GKLRPIIYVTSSGSKN--------LTNSKI--YRLTVPL--MTCDESHQVV
TPHA0I00340        ----KDSD-GKIKPVINLVSKKTQQ--------SIKKV---YKLSVPI--NYKDTTYSGV
Kpol_237.3         ----RGED-GKLKPLINTLPKNVQL--------NRKKN---YKLNKPV--MQEKTSYKVV
KLTH0C03652g       ----R----GRSGLIIGSSSRVAY-----------------YRLAEVP--FQGKNTKNEL
Kwal_27.10210      ----R----GKSSSVAEFVPQKVVH----------------YKLEELP--FKSKSGRTQL
KNAG0G03490        ----RGAD-GKLRPLVASVKRQSKP--------GNSGNC--VKLLRPLERHTKQRTTALN
Suva_13.24         ----RNNC-STVMPGLMSSPTKSKANFTIKKSILPRCVITTYKLPSPVYKTIDDISKKII
Skud_13.22         ----RNNS-SNITPTLTNSPMKSKANFNIKKFILPRSVIITYKLASPVHETIDDISKKII
YML119W            ----RSS--TSVAPKLTNSPTKSKTNFNIKKCILPRSVVTTYKLPSPVHETIDDISKKII
Smik_13.15         ----RKN--TSTAPALTNSPIKSKANFNIRKYILPRSVITTYKLSSPVYETIDDISKKVI
                                                             .:                

NDAI0E00240        ISSILKLNNATISHGNSKHLLLANDPNFKIN----NLDEITMDLIMKKIKLINETKKKGK
AFR449W            QRLAKLIAQRRSAYHRMQPIRLGSMDGYDVT----SLDQLGEIIE---------------
KLLA0C06292g       SPVITKLINET--HESAEAFKLCNDNRFGYT----TLDALPAVLS---------------
SAKL0D01122g       IAKIIDAKRNS--YNERQPIKLGANTEYQVV----SLEQFPDTVS---------------
KAFR0A02880        SKKIDSHYNDQ--NISAQPLFIAGNKNFKID----ELNEASVELI--------------D
TBLA0D03310        KTINELMATRN--DSNDQIIQSFGKPNLKIS----DLTKDEDKLI---------------
NCAS0B00250        NPKTKKMNSII--KQHLNSFNIDDTNTKDLKLINKKLESLKLQSP---------------
CAGL0B02409g       NSFLLQPDTPR--YYKIQPIKFLHSEPIENF---AGLQDISTHLL---------------
ZYRO0C14916g       KNQIERVYRSK--YHSYQPLSLFGDMSIRYY----RLEDLQSRFI---------------
TDEL0B00210        RDEIEN-NRHR--YRQTQPLHRNQAPADDFG---ETVPNL--------------------
TPHA0I00340        SSLIETEYRPL--YSKDQSFKFYNKDSVLLF---KTLDAIVEKIK---------------
Kpol_237.3         VELIDQVYNKY--YNKLQPYRSISDDNIDLGSIENAIEKLCERLE---------------
KLTH0C03652g       LRSIIDAAQPG--FFRKQPIGVSDDPKYLVS----TLKELPNAVH---------------
Kwal_27.10210      IKDIILAQQEV--YFKKQPIGPAEDAKYQVQ----ALGELSGAVK---------------
KNAG0G03490        SLFVSKTSSIR-----GEPLLLFAGKRPVYT-----LSDLQNMEL---------------
Suva_13.24         ILQISLNFEKS--YHFLQPIQLSTNKKTRVS---KSIEELCRDLL---------------
Skud_13.22         ILQISLNFEKS--YHSLQPIQLSTDRKTRIL---KSLDELCGEHL---------------
YML119W            ILLISLKFEKN--YHFLQPIQLSTNSKTRIS---KSLDELCGVQL---------------
Smik_13.15         ILLISLKFEKN--YHFWQPIQLSVNKKTRIS---KTLDELCEEQL---------------
                                    :                  :                       

NDAI0E00240        TTTKSITDEKLSENNIKEKDKSKKVVVLDPTKSKLKNTTSLRKSNRHLINVITANSNPND
AFR449W            RY-----QVEKPVVKRRSLASSNYSTV----FQDRVDYL-------------IVPTNAND
KLLA0C06292g       KY---ISQNMSVQRLPQRPKTKHLYNR----VDQLLAQE-------------NQFFSAND
SAKL0D01122g       KY---INDLKKPNRRTLASSTRVANNK----IDQLIAQE-------------SYSTCQND
KAFR0A02880        KYLSQLDKSSTGRTLIKNSSLNSSKMQ----RQRRPL---------------INVSNYND
TBLA0D03310        LKNYLLNTIKIVNPIHRKLINSNPHLQ---INPATTTAQTPASTTATATTANTASNLIQN
NCAS0B00250        -------SQKKSHRSLMNLTHQPATME--------------------------------N
CAGL0B02409g       -------DNNTPKKKSHISRVQPPPAA------------------------------TND
ZYRO0C14916g       EF---LQKPRKPQPPLQVARSLNGTGA------------------------------LND
TDEL0B00210        ------------RNTKKTATLRRPLLA---------------------------GSSLND
TPHA0I00340        ASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTG-----------LKLTSNND
Kpol_237.3         NST--ATNKRTPNNVHDIAKISNSRTL-------------------------LTSTIGND
KLTH0C03652g       EY-----ADRVSGFTLKNSKANPLARL---ALQESAE--------------------VNE
Kwal_27.10210      KF-----TERSTRRIIRASKANPLTRL-----------------------TMQDPGDAND
KNAG0G03490        -----VKGADRPTETVEPRQVEEKNVT---GSKRPVDQV-------------ASGGGHND
Suva_13.24         SPPPPSKSQHQLQSNIKPMKNAQNTNT----KQRTSI---------------NAGTNANE
Skud_13.22         VLL--PKQQSQPQNNIKPVKNLPNINT----KQRTST---------------SIGTTANE
YML119W            TST--LRQQKQLQGNSKPVKNLPNSNA----KQRAGA---------------SVSTNANE
Smik_13.15         AST--FQQQSQLQNNVKSLKNPSNTNA----KQRTGA---------------SVALAANE
                                                                              :

NDAI0E00240        SFDLSFDGKAMDRSDIFRMVDSFTMALSDDERELSGIILDTNNKAKKFD-----------
AFR449W            SIDLSFDGKAINKSDFLRMMDSFSLALDEED----------DN-----------------
KLLA0C06292g       SIELSFDGKAMNKNDIFRIVDSFSVAFDDDE-------YGEDG-----------------
SAKL0D01122g       SIDLSFDGKALDKSDILRIVDSFSVGFDDDD---------DDE-----------------
KAFR0A02880        SFDLSFDGKALDRNDIFRMVDSFSIAVSDNE---SSDIIANSSDISYTQTGNNIHYNNEK
TBLA0D03310        SFDLSFDGKALDRSDILRMVDSFSVAFSDEENDNEINIDKNKDKEKEKDPNTTTTMNKKS
NCAS0B00250        SFELSFDGKALDKSDILRIVDSFTMAFSDEE-----------------------------
CAGL0B02409g       SFDLSFDGKALDRSDIFRMVDSFSIAFSDDE-------DNEES-----------------
ZYRO0C14916g       SFELSFDGKALDRSDIFRMVDSFSVALSDDD--------AEDE-----------------
TDEL0B00210        SFDLSFDGKALDRSDIFRMVDSFSVAQSDDE-------PEEDN-----------------
TPHA0I00340        SFELSFDGKALDRSDILRMVDSFSVAFSDDD-------GDNDDYNEQAESTFDEEFGSKE
Kpol_237.3         SFELSFDGKALDRSDILRMVDSFSVAFSDDD-------DENDN-----------------
KLTH0C03652g       SVDLSFDGKAMNKSDIFKMVDSFSLFPDDDT----------DE-----------------
Kwal_27.10210      TADLSFDGKAMNRSDIFKIVDSFSLLPDDEE---------EDS-----------------
KNAG0G03490        SFDLSFDGKAMDRSDIFRMVDSFSIAPDEDD--------DEDP-----------------
Suva_13.24         SFELSFDGKAMDRSDIFRMVDSFSIAISDDD-------DDDDDED---------------
Skud_13.22         SFELSFDGKAMDRSDIFRMVDSFSIAISDED-------EDDDED----------------
YML119W            SFELSFDGKAMDRSDIFRMVDSFSIAISDED-------EEDEEED---------------
Smik_13.15         SFELSFDGKAMDRSDIFRMVDSFSIAISDDD-------DDDDDEED--------------
                   : :*******::..*::.::***::  .::                              

NDAI0E00240        LQLKDNININILPAEITNNNGNNNNDSPNNDENCLSSN
AFR449W            NKHYDFHSRNILPRDITS--GVY---------------
KLLA0C06292g       DDEYVKQPRNILTREVT---GVF---------------
SAKL0D01122g       GEPNIFSTTNILPREMTS--GVF---------------
KAFR0A02880        DNYTTTNSNNILPAEITSSNVAY---------------
TBLA0D03310        MLRFNPHSRNILPAEMTS--SAF---------------
NCAS0B00250        IDTNENENNNILPADLLNMDHHY---------------
CAGL0B02409g       SFISRRNNNDILPADMTN--NR----------------
ZYRO0C14916g       SSFVNSSGRNILPAEMTG--TVF---------------
TDEL0B00210        NNSSNLHSKNVLPAEMTS--SAF---------------
TPHA0I00340        NKYLRTLTNKILPAEITG--GGF---------------
Kpol_237.3         GEFIASLSNKFLPAEITS--SAL---------------
KLTH0C03652g       DEAPHFHMGSILPPEITN--STVPDL------------
Kwal_27.10210      EDILHLNNRSILLPEIAG--IASMDL------------
KNAG0G03490        SPTGRQVPRNILPAEITN--DSF---------------
Suva_13.24         SFQQRNRNSRILPAEILS--NGPLK-------------
Skud_13.22         NFQQRNKSNRILPAEILS--NGLLK-------------
YML119W            SFQQRSANNRILPAEILS--NEPLK-------------
Smik_13.15         DFQQRSESNRILPAEILS--NEPLE-------------
                             .*  ::                      

FASTA FORMAT for MUSCLE Version 3.6

>NDAI0E00240
-MMYSSASSSPTKRTLNNKLPFLN---KGFYPYTDTDNCNNNTARAYNHNAYSNDYNYEL
QTDSVPIIQQQQQFTVNHANDYKYSPQKSMKNNPYLNQRHQSISDHNSNNTGDMSNNNN-
NNNNNRRYQQD--FQQLQLQFQFQSQSQTTSQSPQRINYYVNNNNNNLDNRHSPIRQTSP
QRNINNSNNINHVYQYTKQNHYQNNNNNNNNN-NNNTTQYHQISSPQRQTTANYSPAKFQ
RTSPTKQYHYQEVKSESDI---LLTNSSYSK-LNIKNRYF---TENKEQLIKD-------
----G----DKLKPIINIIPKHSST--------TSKT----YKLLNPL--LSEKSITSMD
ISSILKLNNATISHGNSKHLLLANDPNFKIN----NLDEITMDLIMKKIKLINETKKKGK
TTTKSITDEKLSENNIKEKDKSKKVVVLDPTKSKLKNTTSLRKSNRHLINVITANSNPND
SFDLSFDGKAMDRSDIFRMVDSFTMALSDDERELSGIILDTNNKAKKFD-----------
LQLKDNININILPAEITNNNGNNNNDSPNNDENCLSSN
>AFR449W
--------------------------------------------------------MSFR
NNYNSYPVQD------------------AQYSGQYYMQPF---------HSNGRVSLSNR
TNNSNGQQKTT--EYRAK----------------GKYARSPVIVANSYVMVNP-------
----------------------KSGGQTVQHKQNSHH-----------------------
-----GNHGRTQVIEIPTA---ESISAPLHENRALKLRYM---AGPV-RPEGI-------
----K----VPKNPVINLSKKKAPETY--------------YKIAEPLLNVAHDSSKSNT
QRLAKLIAQRRSAYHRMQPIRLGSMDGYDVT----SLDQLGEIIE---------------
RY-----QVEKPVVKRRSLASSNYSTV----FQDRVDYL-------------IVPTNAND
SIDLSFDGKAINKSDFLRMMDSFSLALDEED----------DN-----------------
NKHYDFHSRNILPRDITS--GVY---------------
>KLLA0C06292g
--------MTEGRRLSNRSS----------------------------------------
-------------------------------------------------IRNTTHIFND-
TSSKTKG----------------------TKFKFKNGSGTRQSPNKQHISSSP-------
------------------------------------------------------------
-----------PILEVQNI---ADVDTSNT--FGQFNRIS---QPPSKNLNYD-------
----T----PKINVKLEYHTMQSSK--------II------YKIDVPI----SSKSDMEI
SPVITKLINET--HESAEAFKLCNDNRFGYT----TLDALPAVLS---------------
KY---ISQNMSVQRLPQRPKTKHLYNR----VDQLLAQE-------------NQFFSAND
SIELSFDGKAMNKNDIFRIVDSFSVAFDDDE-------YGEDG-----------------
DDEYVKQPRNILTREVT---GVF---------------
>SAKL0D01122g
-MSSQKPSGANNRRKLNNRNSFQS------------------------------------
YSLQQHPCLTSTQLKGHG----------GNQQN----------------SQRSLHTSKSD
LANVQIGVTTTDKKFKFK-----------NQYPRAQPTLIRQSNVVKDINIKQ-------
----------------------QPYSSSSH------------------------------
-----------SSTFVREI---PNISYIQRQ-ITRTPRYM---AAPV-KIDYE-------
----A----CRTNVVVNETQKRKSI--------AY------YKLCEPM--LSEASRRKPM
IAKIIDAKRNS--YNERQPIKLGANTEYQVV----SLEQFPDTVS---------------
KY---INDLKKPNRRTLASSTRVANNK----IDQLIAQE-------------SYSTCQND
SIDLSFDGKALDKSDILRIVDSFSVGFDDDD---------DDE-----------------
GEPNIFSTTNILPREMTS--GVF---------------
>KAFR0A02880
--MNSTPQRSLSRRVLNNKSSIVSINTNSGGFYPYSKETQNRNDL-----------NGQH
YYMPQYADLEKTSYSTSPNRI-------AILNSNVVMSSPSVIPAMQPRLINTSTRHQH-
HHHQQQQQQQQ--QQQHHYQYPLQTGSYYNTSQMNNNYYYSNMRNNNSINSNR-------
-----------MKQRNKMMNVTSPRYNQENTANNNKN-----------------------
--QKPKKVQYKEIKDVSEL---FKDATNQDVNSYLLSQYFNKNTKPV-DFGEF-------
----NHSNEMKSKAIIINTASRSWY--------KNSNKIQTYKLSTPI--LSSIKYGSTL
SKKIDSHYNDQ--NISAQPLFIAGNKNFKID----ELNEASVELI--------------D
KYLSQLDKSSTGRTLIKNSSLNSSKMQ----RQRRPL---------------INVSNYND
SFDLSFDGKALDRNDIFRMVDSFSIAVSDNE---SSDIIANSSDISYTQTGNNIHYNNEK
DNYTTTNSNNILPAEITSSNVAY---------------
>TBLA0D03310
--MEHLDTTRYRKDWNDPEWQSPT---KAGGNTYLNYASPQRSGFNTSPQRTVFGASPQR
TNPQPHVYTSPQRNNVFMNTS-------PQRNDAFINTSPQRLNTFMNVSPQRSNVFVN-
TSPQRTSFNPN--SNRPNLNWSTVESILPPNPMVNSPSKYNNNNNNNNNNNNNNNNNNNN
NNNRTSPYKNNSNTTNSNNKYYNKLNQSNSYLINNNNNNNSSNNRHSSPTKNSNNNNNNN
NNNKQKQLKLKEIYDENSL---PVMNRMYIE-QSIRSKYF---NNSI-DLNQFFNDSTTN
TNSSNNSSMNKLKPIINTLPKHLKN--------VSRKK---YKLIIPL-RKLQQDSKGDN
KTINELMATRN--DSNDQIIQSFGKPNLKIS----DLTKDEDKLI---------------
LKNYLLNTIKIVNPIHRKLINSNPHLQ---INPATTTAQTPASTTATATTANTASNLIQN
SFDLSFDGKALDRSDILRMVDSFSVAFSDEENDNEINIDKNKDKEKEKDPNTTTTMNKKS
MLRFNPHSRNILPAEMTS--SAF---------------
>NCAS0B00250
MQSNPYYPYNGTKDWNNPNYQCIY---RRDSVPNNTSPMLG---------------SPQR
QQQQYHYNTSPNKNNHAPQYN-------KYNNGSYYNY-----------YKNFPPSFNSR
RNSINKNVSPT--KMKFN----------SSSSSPSSPTKSMANSVANFIHIVE-------
------------------------------------------------------------
------------INNFNQV---PKDTISNYQNHNIKERYF---TKQN-NITNN-------
----T----EKLKPIINVVPKSNSK-------------IVIYKLTSNNHNNNNNKSNALG
NPKTKKMNSII--KQHLNSFNIDDTNTKDLKLINKKLESLKLQSP---------------
-------SQKKSHRSLMNLTHQPATME--------------------------------N
SFELSFDGKALDKSDILRIVDSFTMAFSDEE-----------------------------
IDTNENENNNILPADLLNMDHHY---------------
>CAGL0B02409g
-----------MSTWQKGDIMY----------------------------------SPTK
RTLNNKTSGSKIASGSNGNGNGS-----GNGSGSAYHDPGSSYSSL---QKSNKMVFQEQ
PMLVRNMYDQNYYYYDGQGYGSPPMSNRNAMANPVSPFLYSPVMLPNHVHASP-------
---------------------TTGRKKKVSLNRNPRNSNLVMPSSPIKNNNIDTGSKTAN
LSGPGKKYK--ELRDIDDL---PRSPCNYET-PNLKNRYF----GPVQKVEDN-------
---------TDRKANVNISYKNSKS--------KQKKPPVVYKLATPL---ASKDVNALD
NSFLLQPDTPR--YYKIQPIKFLHSEPIENF---AGLQDISTHLL---------------
-------DNNTPKKKSHISRVQPPPAA------------------------------TND
SFDLSFDGKALDRSDIFRMVDSFSIAFSDDE-------DNEES-----------------
SFISRRNNNDILPADMTN--NR----------------
>ZYRO0C14916g
--------MLGLEDGKAIDLSFPA---AELPEFDINSQSS----------------SPTK
RTLNNKKVLDTT----------------SYYNGGWEKGEATGLPLAAPATPATPATPATP
AAIPILSMNEN--------------------RLRRSPQRMGAKNTKSSLTGSP-------
----------------------HRKGPRSSNLQARGP-----------------------
-----PKYK--EISSIYEL---EKVDPVKQE-NNFTNRYF---SDPV-DLDSA-------
----RSDD-GRLKPIINTASKNGKS--------YPGNKI--YKLSIPL--LVCQDTHRAL
KNQIERVYRSK--YHSYQPLSLFGDMSIRYY----RLEDLQSRFI---------------
EF---LQKPRKPQPPLQVARSLNGTGA------------------------------LND
SFELSFDGKALDRSDIFRMVDSFSVALSDDD--------AEDE-----------------
SSFVNSSGRNILPAEMTG--TVF---------------
>TDEL0B00210
--MINSATNLSHPTEGEPKHRFTS---KIS--------------------------SPTK
RTLNNKNYLAEDAPAYHFKPNL------EEELNDKLKISSLEVPADFKKDENLEPLPQRQ
QGFPNRNYKNILETNGMPLRHGYPYQPRHDTISSAPDYRTRLSPTKNSKATNS-------
----------------------KSRNPRCK------------------------------
-----------EKNDASQV---PTLNKLEKD-KIIASRYF---SPPI-DLRKM-------
----KRAD-GKLRPIIYVTSSGSKN--------LTNSKI--YRLTVPL--MTCDESHQVV
RDEIEN-NRHR--YRQTQPLHRNQAPADDFG---ETVPNL--------------------
------------RNTKKTATLRRPLLA---------------------------GSSLND
SFDLSFDGKALDRSDIFRMVDSFSVAQSDDE-------PEEDN-----------------
NNSSNLHSKNVLPAEMTS--SAF---------------
>TPHA0I00340
---------MSTSRSLNNKIFFEK---KSATGEYPKEWMN----------------SAYG
GNLTHHQDSSQLQNQSYSKRNINST---VNNSFNYNNYDNNAANYGRENFHNNQAYSNN-
-AYSLKGLNNT--YILNNMRNDNKIKRGQKPIMNGRSMPYKNMNKQNSRALKQ-------
----------------------TKNPPNNAKNFTNKN-----------------------
-----IKFT--IVHDESEI---DNDKKHSN--DDICNKYF---SEPV-DLNYY-------
----KDSD-GKIKPVINLVSKKTQQ--------SIKKV---YKLSVPI--NYKDTTYSGV
SSLIETEYRPL--YSKDQSFKFYNKDSVLLF---KTLDAIVEKIK---------------
ASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTG-----------LKLTSNND
SFELSFDGKALDRSDILRMVDSFSVAFSDDD-------GDNDDYNEQAESTFDEEFGSKE
NKYLRTLTNKILPAEITG--GGF---------------
>Kpol_237.3
---------MSNSRTLNNKTFLVD---NREPVYNRN--------------------PNGH
GNARMNGVVDAKKNGGYSSHF-------INTDDNYNYSSGQVNNFKQPQYHLNRNLLRSD
KSKKGRSILNN--NNGGW-----------NSNRPDNQSNISNVNNRKINDTNL-------
----------------------RNPKQNLTFG-QNRN-----------------------
-----LKYT--IINSERDLLKVDNNELMRKT-GAIKNRYF---SSIT-NLNDF-------
----RGED-GKLKPLINTLPKNVQL--------NRKKN---YKLNKPV--MQEKTSYKVV
VELIDQVYNKY--YNKLQPYRSISDDNIDLGSIENAIEKLCERLE---------------
NST--ATNKRTPNNVHDIAKISNSRTL-------------------------LTSTIGND
SFELSFDGKALDRSDILRMVDSFSVAFSDDD-------DENDN-----------------
GEFIASLSNKFLPAEITS--SAL---------------
>KLTH0C03652g
MQNPQYSGVMGQSTLRNNMVRTVP--------------------------------SPNQ
ITMIPVPHLQA--------------------------------------HKGEKRTLRN-
TSPLRKS----------------------QDFEGSKPTNTGKSGAGANGHSNS-------
----------------------RQRWV---------------------------------
--------------DVKII---DDIKCPTS--NSEKPRYL---TVPG-KFDVK-------
----R----GRSGLIIGSSSRVAY-----------------YRLAEVP--FQGKNTKNEL
LRSIIDAAQPG--FFRKQPIGVSDDPKYLVS----TLKELPNAVH---------------
EY-----ADRVSGFTLKNSKANPLARL---ALQESAE--------------------VNE
SVDLSFDGKAMNKSDIFKMVDSFSLFPDDDT----------DE-----------------
DEAPHFHMGSILPPEITN--STVPDL------------
>Kwal_27.10210
---------MHNTRTYDAASQYTS---GNGKSFL----------------------PASL
KMAPTLSA---------------------------PQGEN---------SRSERRTLRN-
TSPLRRS----------------------QVVDGGKTSPSTKSVTISSGQLNS-------
----------------------RPRWI---------------------------------
--------------EAKTI---SDVEKPVA--KAGNQRYL---ASPC-KIDYK-------
----R----GKSSSVAEFVPQKVVH----------------YKLEELP--FKSKSGRTQL
IKDIILAQQEV--YFKKQPIGPAEDAKYQVQ----ALGELSGAVK---------------
KF-----TERSTRRIIRASKANPLTRL-----------------------TMQDPGDAND
TADLSFDGKAMNRSDIFKIVDSFSLLPDDEE---------EDS-----------------
EDILHLNNRSILLPEIAG--IASMDL------------
>KNAG0G03490
----------MYKRTLNNKSSVQG---EGYGL-------------------------PNR
RDAGLRQAGGGGGYVAAGVVP-------GTKN--YNVGGA---------YQNYHPTLYH-
TAN-----NQT--LYPV------------VNQSMNHPSVY---------HAAN-------
----------------------QPNYTTYPTV-RQPR-----------------------
-----RQVK--EATAAVSA---PTVPSSSGDLACILNRYF---TEDIVQLDRL-------
----RGAD-GKLRPLVASVKRQSKP--------GNSGNC--VKLLRPLERHTKQRTTALN
SLFVSKTSSIR-----GEPLLLFAGKRPVYT-----LSDLQNMEL---------------
-----VKGADRPTETVEPRQVEEKNVT---GSKRPVDQV-------------ASGGGHND
SFDLSFDGKAMDRSDIFRMVDSFSIAPDEDD--------DEDP-----------------
SPTGRQVPRNILPAEITN--DSF---------------
>Suva_13.24
---MSQSPSVSPRRTLNNKSSYIS---SNGGPLL----------------------PPAQ
LDLNQQPV---LNFQQKATFD-------SNQQFFYYPDSP---------TKKPRPRFNS-
ASQTNKDSNEN--YYTSG---------NNGNNGNNRSSRYPNTTSTANVNSN--------
-----------------------PHHQSVSHI-NSKS-----------------------
-----LRFH--QTKEADSI---QDIPFPSR--TCTAKRYF---TKPI-DLYGT-------
----RNNC-STVMPGLMSSPTKSKANFTIKKSILPRCVITTYKLPSPVYKTIDDISKKII
ILQISLNFEKS--YHFLQPIQLSTNKKTRVS---KSIEELCRDLL---------------
SPPPPSKSQHQLQSNIKPMKNAQNTNT----KQRTSI---------------NAGTNANE
SFELSFDGKAMDRSDIFRMVDSFSIAISDDD-------DDDDDED---------------
SFQQRNRNSRILPAEILS--NGPLK-------------
>Skud_13.22
---MSPSPSVSPRRTLNNKSSYIG---NGSGLVL----------------------PPTQ
VKLNQQPV---LSFQQKTTFD-------SNQQFFYYPESP---------TKSQRPRFNS-
VSQINKDTNEN--YYAGA-----------ANSNGNRPSRYPNA-GAANVNANP-------
----------------------HPHHQSVSHI-NSKA-----------------------
-----PKFN--QTKEVKSI---KDISFPSR--TCTAKRYF---TSPI-DLHGI-------
----RNNS-SNITPTLTNSPMKSKANFNIKKFILPRSVIITYKLASPVHETIDDISKKII
ILQISLNFEKS--YHSLQPIQLSTDRKTRIL---KSLDELCGEHL---------------
VLL--PKQQSQPQNNIKPVKNLPNINT----KQRTST---------------SIGTTANE
SFELSFDGKAMDRSDIFRMVDSFSIAISDED-------EDDDED----------------
NFQQRNKSNRILPAEILS--NGLLK-------------
>YML119W
---MSPSPSVSPRRTLNNKSSYIN---NSGGLVL----------------------PPTQ
FNLNQQPV---LSFQQKATFD-------SNQQFFYYPESP---------TKNLRPRFNS-
ISQVNKGVNED--HYTGG-----------GSSNNNRPSRYTNTMGAANTNVNS-------
----------------------HPHHQSVSHL-NSKS-----------------------
-----LKFN--QTKEVSSI---NEIIFPSR--TCTKKRYF---TKPI-DLYGT-------
----RSS--TSVAPKLTNSPTKSKTNFNIKKCILPRSVVTTYKLPSPVHETIDDISKKII
ILLISLKFEKN--YHFLQPIQLSTNSKTRIS---KSLDELCGVQL---------------
TST--LRQQKQLQGNSKPVKNLPNSNA----KQRAGA---------------SVSTNANE
SFELSFDGKAMDRSDIFRMVDSFSIAISDED-------EEDEEED---------------
SFQQRSANNRILPAEILS--NEPLK-------------
>Smik_13.15
---MSQSPSVSPRRTLNNKSSYIS---NGGGLAL----------------------PPSE
LKLNQQPI---LGFQQKATFD-------SNQQFFYYPESP---------TKNLRPRFNS-
TSQINKGFNEN--RYAGC------------NNNGNRSSRYANTTGAANVGASS-------
----------------------HPHHQSVSHL-NTKS-----------------------
-----LKFN--QTKEVNSI---KDITFPPR--TCTIKRYF---TSPI-DLSGA-------
----RKN--TSTAPALTNSPIKSKANFNIRKYILPRSVITTYKLSSPVYETIDDISKKVI
ILLISLKFEKN--YHFWQPIQLSVNKKTRIS---KTLDELCEEQL---------------
AST--FQQQSQLQNNVKSLKNPSNTNA----KQRTGA---------------SVALAANE
SFELSFDGKAMDRSDIFRMVDSFSIAISDDD-------DDDDDEED--------------
DFQQRSESNRILPAEILS--NEPLE-------------