MUSCLE (3.8) multiple sequence alignment

SAKL0A09394g      MSYKQ------------------------------------EKNFEKFERTS-TSSLEQT
KLTH0D06754g      MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQVVEHGENSSDSSSLGQE
Kwal_26.7996      -MSKE------------------------------VKKVETLQVWEKVENSSESSSQE--
                     *:                                     :  *: *.:* :**    

SAKL0A09394g      VPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNS
KLTH0D06754g      LSPGGSHVTYLSRGHLANEGA-----GAEGKTEQEIIEEEELTEQ--TVWEGNVSLLQNS
Kwal_26.7996      ------HVPHVINKD-----------GAGIVVEEEESEAEGITDQ--TIWEGDVTALPNS
                        :*.:: .             .*    *:   : . : :*  ::***: : * **

SAKL0A09394g      PYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVIC
KLTH0D06754g      PFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVC
Kwal_26.7996      PFPEVRATVPATDDPTIVVNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLSINFLVAQVVC
                  *:******** ****** :*************:********************:****:*

SAKL0A09394g      YPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFY
KLTH0D06754g      YPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFY
Kwal_26.7996      YPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFY
                  **:***** **:..* * *:*:**************************************

SAKL0A09394g      NMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKT
KLTH0D06754g      NMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKT
Kwal_26.7996      NMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDAS
                  ****.*** :********* ******:*****.**:*:************:**. .:* :

SAKL0A09394g      IVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVES
KLTH0D06754g      KVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVES
Kwal_26.7996      VVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVES
                   ****.*:**.**: *:  **:***:*****.******.:***.*********:******

SAKL0A09394g      GLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASVLLFFVVILPILYFTNTWYAKYMP
KLTH0D06754g      GIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMP
Kwal_26.7996      GIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVFIFFILILPILYFTNTWYAKYMP
                  *:**:**:*****:***::*******:*****: **..:**::*****************

SAKL0A09394g      IISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVH
KLTH0D06754g      VISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVH
Kwal_26.7996      VISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNFAAVVAVFVH
                  :** .*:** *:.***:.***.*:*:*:****.****:**************** *****

SAKL0A09394g      CALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDT
KLTH0D06754g      CFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNS
Kwal_26.7996      CALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDS
                  * **:**:* .*:**.*:**.*******::********** .***: :.***.::*.:::

SAKL0A09394g      HFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYG
KLTH0D06754g      HLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYG
Kwal_26.7996      HLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYG
                  *:*****.:** *** *::*******:*************:******:.****:******

SAKL0A09394g      FIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKT
KLTH0D06754g      FIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSST
Kwal_26.7996      FIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCSST
                  *****:**:*************.******:****::************** **. :**.*

SAKL0A09394g      QKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSN
KLTH0D06754g      QPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGN
Kwal_26.7996      QPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFALQRVFKHN
                  * *** *.*************:*::**********:********.**:*** **. *  *

SAKL0A09394g      QFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRWFGKYNFVMGSGVEA
KLTH0D06754g      EMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVET
Kwal_26.7996      QAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVET
                  : :*: *:****:**..*********:*:** *: ** ****:* **.***:***:***:

SAKL0A09394g      GVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGETFGYDKWW
KLTH0D06754g      GVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKFGYDKWW
Kwal_26.7996      GVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDKWW
                  ****:*.***********.:*****.*:****** *.*:* *:***.*******

FASTA FORMAT for MUSCLE Version 3.6

>SAKL0A09394g
MSYKQ------------------------------------EKNFEKFERTS-TSSLEQT
VPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNS
PYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVIC
YPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFY
NMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKT
IVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVES
GLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASVLLFFVVILPILYFTNTWYAKYMP
IISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVH
CALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDT
HFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYG
FIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKT
QKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSN
QFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRWFGKYNFVMGSGVEA
GVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGETFGYDKWW
>KLTH0D06754g
MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQVVEHGENSSDSSSLGQE
LSPGGSHVTYLSRGHLANEGA-----GAEGKTEQEIIEEEELTEQ--TVWEGNVSLLQNS
PFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVC
YPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFY
NMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKT
KVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVES
GIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMP
VISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVH
CFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNS
HLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYG
FIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSST
QPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGN
EMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVET
GVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKFGYDKWW
>Kwal_26.7996
-MSKE------------------------------VKKVETLQVWEKVENSSESSSQE--
------HVPHVINKD-----------GAGIVVEEEESEAEGITDQ--TIWEGDVTALPNS
PFPEVRATVPATDDPTIVVNHWRTWFLTTVFVVVFAGVNQFFSLRYPSLSINFLVAQVVC
YPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFY
NMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLISVSLFDSLHNRTVDAS
VVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSKTRHNFIANTIFGVES
GIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVFIFFILILPILYFTNTWYAKYMP
VISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLLSYALNFAAVVAVFVH
CALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQVVMLGLGFATICGFDS
HLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYMLPFKPMANVLFKLYG
FIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGIQEWMRSNIKELCSST
QPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLAVPLIVFALQRVFKHN
QAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPLWFSKYNYVMGAGVET
GVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKGETFGYDKWW