MUSCLE (3.8) multiple sequence alignment

ACL154W            ----MATKSENTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRH
NDAI0E04500        -------------MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRH
NCAS0E02890        -------------MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRH
Kpol_530.36        -----------------MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKH
TPHA0F02920        ---------------MSNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRH
CAGL0A03905g       -------------------------------------------------MSVRFAVALRH
Suva_10.299        -----------MEDSTSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRH
Skud_12.268        -------------MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRH
Smik_12.263        -------------MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRH
YLR205C            -------------MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRH
Ecym_4729          MVYKETMNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRH
KLLA0D12474g       -------------MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRH
KLTH0H01386g       ------------------MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKH
Kwal_56.24624      ------------------MSTIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKH
SAKL0F11242g       ----------------MSATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKH
ZYRO0F11594g       ------------------MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKH
TDEL0C02030        --------------MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKH
KNAG0B02640        -----------------MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRH
KAFR0L01470        -----------------MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRH
                                                                    .  .  .*:.*

ACL154W            PSIYRQGLLAMYYIFRSVEQHIDRLLR----------APATADEARIGEILRAFWRPEFA
NDAI0E04500        GDIYRQGILTYYYIFQAVESEINYLLS--------FNTDATKEQKRTGSLLSKIWLTEFN
NCAS0E02890        GFIYRQGILTYYYIFKVVEEEIIKLTT----------SPTTSEEVKIGNLLSKTWIPEFN
Kpol_530.36        GFIYREGLVVFYHIFNTIETEIDLVLN-------------NQDDSQMKLILSSFYLDEFR
TPHA0F02920        GFIYRQGLVAFYHIFGTIENEIDNLLN-------TLDSELDSVQIQTKKILKSFYVNEFR
CAGL0A03905g       GKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASKIVKQFWMPEFR
Suva_10.299        GFIYRQGILAYYYVFDAIEQEIDRLLN----------DAVSEKELQACGILKQFWLEDFR
Skud_12.268        GFIYRQGILAYYYVFDAIEQEIDRLLH----------DPVTEKELQTSTILKQFWLEDFR
Smik_12.263        GFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTGKELQTSAILKQFWLEDFR
YLR205C            GFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTEEELQTSTILKQFWLEDFR
Ecym_4729          GFIYRQGILAFYYIFHAVEQQIDRLLE----------TPSTKEELQISAILRQFWCEEFR
KLLA0D12474g       GFIYRQGIVAYYYVFHAIEQEIDRLLE----------HPVTVQDEKVKGILQQFWCEEFR
KLTH0H01386g       GFIYRQGVLAFFYVFQAIEQELDRLRQ----------EAQTPEEEQTRDILNQFWTEEFR
Kwal_56.24624      GFIYRQGLLAFFYVFQAIEQEIDRLLQ----------NAQTAEEVQTRDILLQFWVSSFS
SAKL0F11242g       GHIYRQGILAFYYIFAAVEQEIDNLLQ----------NASTPLELQTQKILNQFWCEEFR
ZYRO0F11594g       GWIFRQGILAYYYIFQAIEQELDRIMD----------HARNEKEMQMQNVLGKFWMNDFR
TDEL0C02030        GFIYRQGILAFYHIFDAVEQELDRLLN----------DPQNDEERQMQHVLRQFWLEEFR
KNAG0B02640        SFIYTDILKTFYTVFGTVEQRIDELIA-------------SEGGDGVGAILGEFYVPEFR
KAFR0L01470        SFIYKDILLSYYYVFRTLEDEIDFIIS--------------NDRSHIGEILRGFFNDKFR
                     :: : :   : :*  :*  :  :                        ::   :  .* 

ACL154W            RAPALVQDFEVYYAAEYSTS-AQLHQFLDS-YE-LP----PRLAAAVADIEAAALRQPWT
NDAI0E04500        RTDKLFKDLKLLYSDRFQND-QDLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCC
NCAS0E02890        RTENLLKDLQLLYHDEYPTK-EALQLFLETNATELP----PVLDSFIKYIHQSILENPCS
Kpol_530.36        RKDKILKDLELLYYPEFQNDRPQLLEFINS-DR-FTNDS-EQLQNFVKYIQTNATEDPCT
TPHA0F02920        RKDNLLQDLTVLYYPEFKGNRQDVLDFLNS-ET-FNKENYPELNFFTDYIKDTTKEKPYT
CAGL0A03905g       RTEQLYKDLLLLYSPEYPTS-TELDAMLVD-HQ-LP----PQLQGFVDMVHATVRQNPVT
Suva_10.299        RSTQIYKDLKLLYSNTFKST-ESLNEFLAT-FE-KP----PLLQQFVDDIHDNIRQEPCT
Skud_12.268        RSTQIYKDLKLLYSNLFKST-ESLNEFLAK-FE-KP----PLLQQFVNDIHENIRKEPCT
Smik_12.263        RSTQIYKDLKLLYSNTFKST-ESLNEFLAT-FE-KP----PVLQQFVNNIHENIQKEPCT
YLR205C            RSTQIYKDLKLLYSNTFKST-ESLNEFLAT-FQ-KP----PLLQQFINNIHENIHKEPCT
Ecym_4729          RSGRLLRDLEFFYHHEYPTQ-NELQQFLND-FE-LP----PKLQRFVDFIRDKTMENPST
KLLA0D12474g       RSDKLVLDLQVLYNDEYPGS-EQLQEFLDG-FQ-LP----AKLQEFVDEIHSNVQKEPHT
KLTH0H01386g       RAPRILQDLELLYAKEFPTS-ASLRTFLEE-TT-LA----PELQGFVDYVHASIRSRPTA
Kwal_56.24624      RTPRIYQDLKLLYAKEFPSD-EQLSLFLQQ-NT-LP----PEQQGFVDFVHESVRARPTS
SAKL0F11242g       RSNMIFQDLELLYSKEYSTR-TELHAFLDD-NV-LP----PQQQAFVEYIHQTVREKPYT
ZYRO0F11594g       RTDRIFQDLTLLYSPEFPTE-SSLEQFLTSGNH-LA----PTLQAFVDSIHKNVQEEPCT
TDEL0C02030        RTNRIFKDLEVLYSPEYSDS-ESLRNFVEH-QP-LA----PQLQSFVDSIHSTVQQDSCT
KNAG0B02640        RADKIKRDLVFL---------GEWDTVESGQWT-PP----PQLAGFLQYLRSEMDRDPIT
KAFR0L01470        RKDQILKDLKFL---------NVIQDQSDDQWLSSR----PELCKFLNFIKSNLHEHPVD
                   *   :  *: .                                      :       .  

ACL154W            ILAHCHVLYLALFAGGRVMRSALSRQLGLL--PRA-------AGLSARETQLRGTHFFTF
NDAI0E04500        ILAYCHVLYLALFAGGKIIKSKIYKNLGFL--PNF-------NHLSSKELFNNATNFFQF
NCAS0E02890        IFAYCHVLYLALFAGGKIIRSKIYKNLGFL--PNF-------NHLSSKEVFEKGTNFFKF
Kpol_530.36        LLAYCHVLYLALFAGGKIMKSNVTKHLGIF--PKF-------EHLSHKEIIARGTNFYQF
TPHA0F02920        IIAYCHVLYLALFAGGKIMKSNVLKNVGLF--PKF-------DHMSHEEVTNQGSNFFRF
CAGL0A03905g       VLAYCHVMYLALFAGGKVMRSTLYRNTGLF--PKF-------EHLSSKELARKGTNFFTF
Suva_10.299        ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------EKLTQKELVKKGTNFFTF
Skud_12.268        ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------ERLSQKELVKKGTNFFTF
Smik_12.263        ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------EKLSQKELVKKGTNFFTF
YLR205C            ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------EKLSQKELVKKGTNFFTF
Ecym_4729          ILAYCHVLYNALFAGGKVMRSNIYRNIGLF--PKP-------KGISAAESSRNGTNFFTF
KLLA0D12474g       ILAYCHVLYLALFAGGRVMKSNLYRHIGLF--PKF-------GHLSPKELVRRATNFFTF
KLTH0H01386g       ILAYCHVLYLALFAGGRVMRSTIYRSTGLF--PKF-------PNLTTEEVVRRGTNFFTF
Kwal_56.24624      ILAFCHVLYLALFAGGRVMRSTIYRSTGLF--PKF-------PDLTPEEVVRKGTNFFTF
SAKL0F11242g       ILAYCHVLYLALFAGGKLMKSNIYRHTGLF--PKF-------QHLTPEQIVRRGTNFFTF
ZYRO0F11594g       ILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKF-------QHLSPRELVQRGTNFFTF
TDEL0C02030        ILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKF-------EYLTPKELVIRGTNFFTF
KNAG0B02640        VLAPCHVLYLALFAGGRVFKSSLFKNLGFL--PNFRDKNGPGEEMSDHTLVSNATNFFQF
KAFR0L01470        VLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKF-------DKMSHTDVIMNATNFFKF
                   ::: ***:* ******.::.: : .  .::  *.          ::      ..::*: *

ACL154W            G---------AGAGE--ENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQAVM
NDAI0E04500        TENSDSLEGINSISN--ENKLKLKFKRNFELNTRSNLNENEKLTIIEIAKQIFQWNLESM
NCAS0E02890        GS--------DGVIE--ETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIFDYNLMAM
Kpol_530.36        TD--------STNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSKDVFVMLENCI
TPHA0F02920        TQ--------EDTAD-FDSKLRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVMLENVI
CAGL0A03905g       SD--------AGVDV--ENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDII
Suva_10.299        SE--------LGPTE--ETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIV
Skud_12.268        SD--------LGPTE--ETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWNFHIV
Smik_12.263        SD--------LGPTE--ETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIV
YLR205C            SD--------LGPTE--ETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIV
Ecym_4729          SD--------DGVDE--ENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVMDIL
KLLA0D12474g       SE--------EGVDD--ENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQRNMEVV
KLTH0H01386g       SD--------AGVQA--ENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNTRVV
Kwal_56.24624      SD--------DGVQA--ENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWNTRVI
SAKL0F11242g       SE--------EGADA--EGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNMDVI
ZYRO0F11594g       SE--------EGSEA--ENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWNMETI
TDEL0C02030        SD--------EGSDA--ENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNMDVI
KNAG0B02640        AE---------TIED--ENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTFAVI
KAFR0L01470        -D--------KDIVS--ENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLL
                                    : . .  :*  ::: *.  * * :*  ::  :   *      :

ACL154W            AELAVRNRQELLGSPSYRLLTFLGEEWRYRTK-NSPQL------LALAAVLSALFLYAAA
NDAI0E04500        EELGQRNQKELMNLFSFKLINYLFEEWKFNDS-IKKNF--KAILMFVILLL--LIQFFVS
NCAS0E02890        EELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRG--KHLIMVVMVLLHMLFAFFIL
Kpol_530.36        AEVGTRNRNELMNIFSYKLFTFIVEEWKYNSS-ISPFL--KKSLMFILIIIQFTLASVLL
TPHA0F02920        AEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK-LTKTN--KQIILLIISIINILITYTII
CAGL0A03905g       QEIGQLNKEALTNN-KLDLLQYVFEELKFYNK--DRSH--QQLVYAVLVLLALLVLYRIV
Suva_10.299        AEIGELNRRELMSKFSFKCVTYVYEEWMFSKG-SASRKAFSTTMLLMLSITAVWILYYFV
Skud_12.268        AEIGELNRRELMGKFSFKCVTYVYEEWMSDKD-SAFRKAFNTAMLLMLSIIAVWVIYLLV
Smik_12.263        AEIGELNRRELMGKFSFKCVTYVYEEWMFNKE-SATRKSFNTVLLLILSIIAIWTLYFLV
YLR205C            AEIGELNRRELMGKFSFKCITYLYEEWMFNKD-SATRRALHTVMLLVLSIIAIWVLYFLV
Ecym_4729          GEIGETNKKELMNIFSFKLLTFLSNEWRYNQK-LSSEV--KQALAIAVFFINFLMIYFTL
KLLA0D12474g       AEIGEINRAELMGKFSYKLISFLSEEWKYSEK-LTPEV--KKLIVFALIVFNMVFVYTIL
KLTH0H01386g       TEIGEINRQELMGKLSFRLLTFVIEEWQYSDK-LTRKQ--KSLVLATGVVLQILMMYWVL
Kwal_56.24624      SEIGEINRQELMGKLSFKLVSFAIDEWKHTEK-LTRRQ--KSIVLATGAVIQILVMYWML
SAKL0F11242g       GELGEINRNELMGKFSFKLVSFILEEWKYSEK-LSKEN--KITILVIFAILQFLLAYWLL
ZYRO0F11594g       AEIGELNRQELMGSVSFRLLTYLHEEWKHTDK-LSKNQ--KDLLVLAVLVVQFLIVYLVL
TDEL0C02030        GEIGEMNRNELMSKFSFKLLTYLSEEWKYSTI-LSKRS--KDSIIVMAILIQFLVAYIVL
KNAG0B02640        EEICQQNHDELMSFRSFKIVTYFLEEWKFNKN-FKRGV--LWGVAFLAQFLFVVLYCCFL
KAFR0L01470        QEIGTVNKDELMKNFNYKMVTYVVEEWKFRKP----QI--KKYVILFLIIFHLFVFINLF
                    *:   *.  *    .   . :  :*                       .          

ACL154W            RVLVARA-
NDAI0E04500        RSLFT---
NCAS0E02890        KRFL----
Kpol_530.36        NRYI----
TPHA0F02920        KWFLS---
CAGL0A03905g       YR------
Suva_10.299        RQNFLSVV
Skud_12.268        KKNFLSIV
Smik_12.263        KKSFLSIV
YLR205C            KSFLSIV-
Ecym_4729          RTIFW---
KLLA0D12474g       RRLI----
KLTH0H01386g       RKFF----
Kwal_56.24624      RKFL----
SAKL0F11242g       RKLF----
ZYRO0F11594g       RRILA---
TDEL0C02030        RKFI----
KNAG0B02640        RR------
KAFR0L01470        KKFYLQAI
                           

FASTA FORMAT for MUSCLE Version 3.6

>ACL154W
----MATKSENTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRH
PSIYRQGLLAMYYIFRSVEQHIDRLLR----------APATADEARIGEILRAFWRPEFA
RAPALVQDFEVYYAAEYSTS-AQLHQFLDS-YE-LP----PRLAAAVADIEAAALRQPWT
ILAHCHVLYLALFAGGRVMRSALSRQLGLL--PRA-------AGLSARETQLRGTHFFTF
G---------AGAGE--ENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQAVM
AELAVRNRQELLGSPSYRLLTFLGEEWRYRTK-NSPQL------LALAAVLSALFLYAAA
RVLVARA-
>NDAI0E04500
-------------MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRH
GDIYRQGILTYYYIFQAVESEINYLLS--------FNTDATKEQKRTGSLLSKIWLTEFN
RTDKLFKDLKLLYSDRFQND-QDLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCC
ILAYCHVLYLALFAGGKIIKSKIYKNLGFL--PNF-------NHLSSKELFNNATNFFQF
TENSDSLEGINSISN--ENKLKLKFKRNFELNTRSNLNENEKLTIIEIAKQIFQWNLESM
EELGQRNQKELMNLFSFKLINYLFEEWKFNDS-IKKNF--KAILMFVILLL--LIQFFVS
RSLFT---
>NCAS0E02890
-------------MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRH
GFIYRQGILTYYYIFKVVEEEIIKLTT----------SPTTSEEVKIGNLLSKTWIPEFN
RTENLLKDLQLLYHDEYPTK-EALQLFLETNATELP----PVLDSFIKYIHQSILENPCS
IFAYCHVLYLALFAGGKIIRSKIYKNLGFL--PNF-------NHLSSKEVFEKGTNFFKF
GS--------DGVIE--ETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIFDYNLMAM
EELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRG--KHLIMVVMVLLHMLFAFFIL
KRFL----
>Kpol_530.36
-----------------MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKH
GFIYREGLVVFYHIFNTIETEIDLVLN-------------NQDDSQMKLILSSFYLDEFR
RKDKILKDLELLYYPEFQNDRPQLLEFINS-DR-FTNDS-EQLQNFVKYIQTNATEDPCT
LLAYCHVLYLALFAGGKIMKSNVTKHLGIF--PKF-------EHLSHKEIIARGTNFYQF
TD--------STNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSKDVFVMLENCI
AEVGTRNRNELMNIFSYKLFTFIVEEWKYNSS-ISPFL--KKSLMFILIIIQFTLASVLL
NRYI----
>TPHA0F02920
---------------MSNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRH
GFIYRQGLVAFYHIFGTIENEIDNLLN-------TLDSELDSVQIQTKKILKSFYVNEFR
RKDNLLQDLTVLYYPEFKGNRQDVLDFLNS-ET-FNKENYPELNFFTDYIKDTTKEKPYT
IIAYCHVLYLALFAGGKIMKSNVLKNVGLF--PKF-------DHMSHEEVTNQGSNFFRF
TQ--------EDTAD-FDSKLRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVMLENVI
AEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK-LTKTN--KQIILLIISIINILITYTII
KWFLS---
>CAGL0A03905g
-------------------------------------------------MSVRFAVALRH
GKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASKIVKQFWMPEFR
RTEQLYKDLLLLYSPEYPTS-TELDAMLVD-HQ-LP----PQLQGFVDMVHATVRQNPVT
VLAYCHVMYLALFAGGKVMRSTLYRNTGLF--PKF-------EHLSSKELARKGTNFFTF
SD--------AGVDV--ENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDII
QEIGQLNKEALTNN-KLDLLQYVFEELKFYNK--DRSH--QQLVYAVLVLLALLVLYRIV
YR------
>Suva_10.299
-----------MEDSTSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRH
GFIYRQGILAYYYVFDAIEQEIDRLLN----------DAVSEKELQACGILKQFWLEDFR
RSTQIYKDLKLLYSNTFKST-ESLNEFLAT-FE-KP----PLLQQFVDDIHDNIRQEPCT
ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------EKLTQKELVKKGTNFFTF
SE--------LGPTE--ETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIV
AEIGELNRRELMSKFSFKCVTYVYEEWMFSKG-SASRKAFSTTMLLMLSITAVWILYYFV
RQNFLSVV
>Skud_12.268
-------------MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRH
GFIYRQGILAYYYVFDAIEQEIDRLLH----------DPVTEKELQTSTILKQFWLEDFR
RSTQIYKDLKLLYSNLFKST-ESLNEFLAK-FE-KP----PLLQQFVNDIHENIRKEPCT
ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------ERLSQKELVKKGTNFFTF
SD--------LGPTE--ETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWNFHIV
AEIGELNRRELMGKFSFKCVTYVYEEWMSDKD-SAFRKAFNTAMLLMLSIIAVWVIYLLV
KKNFLSIV
>Smik_12.263
-------------MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRH
GFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTGKELQTSAILKQFWLEDFR
RSTQIYKDLKLLYSNTFKST-ESLNEFLAT-FE-KP----PVLQQFVNNIHENIQKEPCT
ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------EKLSQKELVKKGTNFFTF
SD--------LGPTE--ETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIV
AEIGELNRRELMGKFSFKCVTYVYEEWMFNKE-SATRKSFNTVLLLILSIIAIWTLYFLV
KKSFLSIV
>YLR205C
-------------MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRH
GFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTEEELQTSTILKQFWLEDFR
RSTQIYKDLKLLYSNTFKST-ESLNEFLAT-FQ-KP----PLLQQFINNIHENIHKEPCT
ILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNF-------EKLSQKELVKKGTNFFTF
SD--------LGPTE--ETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIV
AEIGELNRRELMGKFSFKCITYLYEEWMFNKD-SATRRALHTVMLLVLSIIAIWVLYFLV
KSFLSIV-
>Ecym_4729
MVYKETMNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRH
GFIYRQGILAFYYIFHAVEQQIDRLLE----------TPSTKEELQISAILRQFWCEEFR
RSGRLLRDLEFFYHHEYPTQ-NELQQFLND-FE-LP----PKLQRFVDFIRDKTMENPST
ILAYCHVLYNALFAGGKVMRSNIYRNIGLF--PKP-------KGISAAESSRNGTNFFTF
SD--------DGVDE--ENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVMDIL
GEIGETNKKELMNIFSFKLLTFLSNEWRYNQK-LSSEV--KQALAIAVFFINFLMIYFTL
RTIFW---
>KLLA0D12474g
-------------MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRH
GFIYRQGIVAYYYVFHAIEQEIDRLLE----------HPVTVQDEKVKGILQQFWCEEFR
RSDKLVLDLQVLYNDEYPGS-EQLQEFLDG-FQ-LP----AKLQEFVDEIHSNVQKEPHT
ILAYCHVLYLALFAGGRVMKSNLYRHIGLF--PKF-------GHLSPKELVRRATNFFTF
SE--------EGVDD--ENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQRNMEVV
AEIGEINRAELMGKFSYKLISFLSEEWKYSEK-LTPEV--KKLIVFALIVFNMVFVYTIL
RRLI----
>KLTH0H01386g
------------------MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKH
GFIYRQGVLAFFYVFQAIEQELDRLRQ----------EAQTPEEEQTRDILNQFWTEEFR
RAPRILQDLELLYAKEFPTS-ASLRTFLEE-TT-LA----PELQGFVDYVHASIRSRPTA
ILAYCHVLYLALFAGGRVMRSTIYRSTGLF--PKF-------PNLTTEEVVRRGTNFFTF
SD--------AGVQA--ENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNTRVV
TEIGEINRQELMGKLSFRLLTFVIEEWQYSDK-LTRKQ--KSLVLATGVVLQILMMYWVL
RKFF----
>Kwal_56.24624
------------------MSTIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKH
GFIYRQGLLAFFYVFQAIEQEIDRLLQ----------NAQTAEEVQTRDILLQFWVSSFS
RTPRIYQDLKLLYAKEFPSD-EQLSLFLQQ-NT-LP----PEQQGFVDFVHESVRARPTS
ILAFCHVLYLALFAGGRVMRSTIYRSTGLF--PKF-------PDLTPEEVVRKGTNFFTF
SD--------DGVQA--ENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWNTRVI
SEIGEINRQELMGKLSFKLVSFAIDEWKHTEK-LTRRQ--KSIVLATGAVIQILVMYWML
RKFL----
>SAKL0F11242g
----------------MSATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKH
GHIYRQGILAFYYIFAAVEQEIDNLLQ----------NASTPLELQTQKILNQFWCEEFR
RSNMIFQDLELLYSKEYSTR-TELHAFLDD-NV-LP----PQQQAFVEYIHQTVREKPYT
ILAYCHVLYLALFAGGKLMKSNIYRHTGLF--PKF-------QHLTPEQIVRRGTNFFTF
SE--------EGADA--EGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNMDVI
GELGEINRNELMGKFSFKLVSFILEEWKYSEK-LSKEN--KITILVIFAILQFLLAYWLL
RKLF----
>ZYRO0F11594g
------------------MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKH
GWIFRQGILAYYYIFQAIEQELDRIMD----------HARNEKEMQMQNVLGKFWMNDFR
RTDRIFQDLTLLYSPEFPTE-SSLEQFLTSGNH-LA----PTLQAFVDSIHKNVQEEPCT
ILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKF-------QHLSPRELVQRGTNFFTF
SE--------EGSEA--ENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWNMETI
AEIGELNRQELMGSVSFRLLTYLHEEWKHTDK-LSKNQ--KDLLVLAVLVVQFLIVYLVL
RRILA---
>TDEL0C02030
--------------MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKH
GFIYRQGILAFYHIFDAVEQELDRLLN----------DPQNDEERQMQHVLRQFWLEEFR
RTNRIFKDLEVLYSPEYSDS-ESLRNFVEH-QP-LA----PQLQSFVDSIHSTVQQDSCT
ILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKF-------EYLTPKELVIRGTNFFTF
SD--------EGSDA--ENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNMDVI
GEIGEMNRNELMSKFSFKLLTYLSEEWKYSTI-LSKRS--KDSIIVMAILIQFLVAYIVL
RKFI----
>KNAG0B02640
-----------------MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRH
SFIYTDILKTFYTVFGTVEQRIDELIA-------------SEGGDGVGAILGEFYVPEFR
RADKIKRDLVFL---------GEWDTVESGQWT-PP----PQLAGFLQYLRSEMDRDPIT
VLAPCHVLYLALFAGGRVFKSSLFKNLGFL--PNFRDKNGPGEEMSDHTLVSNATNFFQF
AE---------TIED--ENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTFAVI
EEICQQNHDELMSFRSFKIVTYFLEEWKFNKN-FKRGV--LWGVAFLAQFLFVVLYCCFL
RR------
>KAFR0L01470
-----------------MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRH
SFIYKDILLSYYYVFRTLEDEIDFIIS--------------NDRSHIGEILRGFFNDKFR
RKDQILKDLKFL---------NVIQDQSDDQWLSSR----PELCKFLNFIKSNLHEHPVD
VLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKF-------DKMSHTDVIMNATNFFKF
-D--------KDIVS--ENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLL
QEIGTVNKDELMKNFNYKMVTYVVEEWKFRKP----QI--KKYVILFLIIFHLFVFINLF
KKFYLQAI