MUSCLE (3.8) multiple sequence alignment

ACL153C                  ----MLGLV--------RNMCRAVQL--AR-----VPFVRPLSLQAVAVNKSGGSAV---
Ecym_4728                ----MFSVAR-------GLWKRSLPV--GR-----QLCRSLSLQQYTCRNNQIPIS----
KAFR0L01475              -----------------MMFRQLTRLMVPR-----TVLIRPSVLCSMNRGYHATSG----
CAGL0A03883g             MQKLKLKLMLNCSS---IATTTSARMSLLR-----MVRPFMAVVPGVRRVSSVPVAGVR-
Kpol_2001.72             -----------------MMFRSVLG---VS-----AKQGFFNVGKLVSTTKLSPIS----
NDAI0E04490              --MLPLFFSRMPASRPLSILKGNARF--LSTQLKNTNQSYHHHGDDTMISTMMNLSKSRL
SAKL0F11264g             -MATIFGSMRHIC----SVTSLMART--QV-----VSRSFYSMQCATTSVRSVFAP----
KNAG0B02635              ----ML-----------SVLRHCARA--AA-----TPLSAAARGYGLRR-----------
YLR204W                  ----MLGRALRPGWL--GITRTVVKK--PS-----CGSYFNRTFQTAINTTMPPMQ----
Skud_12.267              ----MLGRALRPGWL--GITRTVARN--PT-----CGACFNRTMQTTTNTGMSVMQ----
Smik_12.262              ----MLGRALRPGWL--GITRAVARK--PI-----CGSCFVRTLQTEMNTGMPAMH----
Suva_10.298              ----MLGRALRPGWL--GITRATARY--PI-----CGTCANRTMHTPTTTSMPAMQ----
KLLA0D12452g             ----ML-----------RSITTRLTS--PI-----SGSLRCLSVACCNTQMAVPMG----
Zrou_YGOB_Anc_7.345      -----------------MFLCSIRRL--PR-----LALRPLSTLTSCSVGTPKP------
TPHA0D04575              ----MFGIVRNCAWKAPRALHGVFN---LK-----LRKNYLHTFVDSRASSILGNP----
KLTH0H01364g             ----MLGAFT-------RAFSSLVK---TR-----APAARLSSTLHAFRGFELPLR----
Kwal_56.24628            ----MLGAFR-------HAFTSLIK---PR-----LSIARYSSGLQSYHGFDLSTK----
                                                                                     

ACL153C                  --------------WSELRSMRAAAS----APLAVACTQAVLVWG--ERSV------GQA
Ecym_4728                --------------TGMLMNIGRTGS----SRLNIVVPDTWKVSIDMKEGV------LKE
KAFR0L01475              --------------VIN-------------DSISFIPWIPWK-----KPTSLLQAVGAAS
CAGL0A03883g             --------------VSMPMPFGKMPLPLRASIQTTVQATVQATVQTMQPTVQPLPV-TPQ
Kpol_2001.72             --------------IITPSFRQCLSTYSQFDSTNNIPNPAIINW---LPLSEP----NNN
NDAI0E04490              INSNDIFELSSKSALGLDRKFQCNIN----DISNMIPMFGRTLIENAEQVVINDVTNLSN
SAKL0F11264g             --------------LLVPQPIRCSTI----TEESA----------------------GNE
KNAG0B02635              --------------LVSLSSLVCKTH----PPSGVLTWPTVG-----LPQD------GPT
YLR204W                  --------------EGMLSTMMMMT-----ATATRITGTVS------EPLN------GSN
Skud_12.267              --------------EGMLSAMTIM------MTTTRIGSKVN------EPLS------GPN
Smik_12.262              --------------EGMLSTIMMTT-----TTGTRISNTVR------ESLS------ESS
Suva_10.298              --------------EGMLSTMMMMTT----MTTTRIGSTVS------EPLT------GSS
KLLA0D12452g             --------------MPMGMPIGMTAG----IPTGSLGLPVQENNHMTEPIVSITDLIKKQ
Zrou_YGOB_Anc_7.345      --------------FLPSMLMQNTQL----NPVNPLKLQLQPQF---EPLQEPVN--NGD
TPHA0D04575              --------------VINSKVLVQLNL----RPLAPL-----------APVRDVPH--QNI
KLTH0H01364g             --------------CMEPLML----L----RPLAPV-----------ERAP------TAM
Kwal_56.24628            --------------FLEPIPL----L----RPAASI-----------EPAP------TQL
                                                                                     

ACL153C                  A---PLEADSVMRKRRTKMKKHKWRKRRKAQRAERRKLSQGR
Ecym_4728                LEQEEMHMDSVMRKRRTKMKKHKLRKRRKKQRAERRKLSQGK
KAFR0L01475              VQEDGMFTDSVLRKRRKKMKKHKLRKRRKRERADKRKLSQGK
CAGL0A03883g             ALDKEVYVDSVMRKRRKKMKKHKLRKRRRKEKAERRKLSQGR
Kpol_2001.72             V---SLELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGK
NDAI0E04490              V---EMHLDSVLRKRRKKMKKHKLRKRRKRQRAEKRKLSQGR
SAKL0F11264g             L---EMVLDSVMRKRKLKMKKHKLRKRRKRQKAEKRKQSQGN
KNAG0B02635              ILGEVIQLDSVLRKRRKKMKKHKLRKRRKREKAERLKLSQGR
YLR204W                  I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
Skud_12.267              I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
Smik_12.262              I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
Suva_10.298              I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
KLLA0D12452g             E---EYRMDSVMRKRRTKMKKHKLRKRRKRQKAEKRKQSQG-
Zrou_YGOB_Anc_7.345      V---RMELDSVMRKRRKKMKKHKLRKRRKREKAEKRKLTQGR
TPHA0D04575              V---EMELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGR
KLTH0H01364g             E---EMLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK
Kwal_56.24628            E---ELFADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK
                                 ***:***. ****** ****. :.*:. * :** 

FASTA FORMAT for MUSCLE Version 3.6

>ACL153C
----MLGLV--------RNMCRAVQL--AR-----VPFVRPLSLQAVAVNKSGGSAV---
--------------WSELRSMRAAAS----APLAVACTQAVLVWG--ERSV------GQA
A---PLEADSVMRKRRTKMKKHKWRKRRKAQRAERRKLSQGR
>Ecym_4728
----MFSVAR-------GLWKRSLPV--GR-----QLCRSLSLQQYTCRNNQIPIS----
--------------TGMLMNIGRTGS----SRLNIVVPDTWKVSIDMKEGV------LKE
LEQEEMHMDSVMRKRRTKMKKHKLRKRRKKQRAERRKLSQGK
>KAFR0L01475
-----------------MMFRQLTRLMVPR-----TVLIRPSVLCSMNRGYHATSG----
--------------VIN-------------DSISFIPWIPWK-----KPTSLLQAVGAAS
VQEDGMFTDSVLRKRRKKMKKHKLRKRRKRERADKRKLSQGK
>CAGL0A03883g
MQKLKLKLMLNCSS---IATTTSARMSLLR-----MVRPFMAVVPGVRRVSSVPVAGVR-
--------------VSMPMPFGKMPLPLRASIQTTVQATVQATVQTMQPTVQPLPV-TPQ
ALDKEVYVDSVMRKRRKKMKKHKLRKRRRKEKAERRKLSQGR
>Kpol_2001.72
-----------------MMFRSVLG---VS-----AKQGFFNVGKLVSTTKLSPIS----
--------------IITPSFRQCLSTYSQFDSTNNIPNPAIINW---LPLSEP----NNN
V---SLELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGK
>NDAI0E04490
--MLPLFFSRMPASRPLSILKGNARF--LSTQLKNTNQSYHHHGDDTMISTMMNLSKSRL
INSNDIFELSSKSALGLDRKFQCNIN----DISNMIPMFGRTLIENAEQVVINDVTNLSN
V---EMHLDSVLRKRRKKMKKHKLRKRRKRQRAEKRKLSQGR
>SAKL0F11264g
-MATIFGSMRHIC----SVTSLMART--QV-----VSRSFYSMQCATTSVRSVFAP----
--------------LLVPQPIRCSTI----TEESA----------------------GNE
L---EMVLDSVMRKRKLKMKKHKLRKRRKRQKAEKRKQSQGN
>KNAG0B02635
----ML-----------SVLRHCARA--AA-----TPLSAAARGYGLRR-----------
--------------LVSLSSLVCKTH----PPSGVLTWPTVG-----LPQD------GPT
ILGEVIQLDSVLRKRRKKMKKHKLRKRRKREKAERLKLSQGR
>YLR204W
----MLGRALRPGWL--GITRTVVKK--PS-----CGSYFNRTFQTAINTTMPPMQ----
--------------EGMLSTMMMMT-----ATATRITGTVS------EPLN------GSN
I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
>Skud_12.267
----MLGRALRPGWL--GITRTVARN--PT-----CGACFNRTMQTTTNTGMSVMQ----
--------------EGMLSAMTIM------MTTTRIGSKVN------EPLS------GPN
I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
>Smik_12.262
----MLGRALRPGWL--GITRAVARK--PI-----CGSCFVRTLQTEMNTGMPAMH----
--------------EGMLSTIMMTT-----TTGTRISNTVR------ESLS------ESS
I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
>Suva_10.298
----MLGRALRPGWL--GITRATARY--PI-----CGTCANRTMHTPTTTSMPAMQ----
--------------EGMLSTMMMMTT----MTTTRIGSTVS------EPLT------GSS
I---VMQLDSVMRKRKKKMKKHKLRKRRKREKAERRKLSQGR
>KLLA0D12452g
----ML-----------RSITTRLTS--PI-----SGSLRCLSVACCNTQMAVPMG----
--------------MPMGMPIGMTAG----IPTGSLGLPVQENNHMTEPIVSITDLIKKQ
E---EYRMDSVMRKRRTKMKKHKLRKRRKRQKAEKRKQSQG-
>Zrou_YGOB_Anc_7.345
-----------------MFLCSIRRL--PR-----LALRPLSTLTSCSVGTPKP------
--------------FLPSMLMQNTQL----NPVNPLKLQLQPQF---EPLQEPVN--NGD
V---RMELDSVMRKRRKKMKKHKLRKRRKREKAEKRKLTQGR
>TPHA0D04575
----MFGIVRNCAWKAPRALHGVFN---LK-----LRKNYLHTFVDSRASSILGNP----
--------------VINSKVLVQLNL----RPLAPL-----------APVRDVPH--QNI
V---EMELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGR
>KLTH0H01364g
----MLGAFT-------RAFSSLVK---TR-----APAARLSSTLHAFRGFELPLR----
--------------CMEPLML----L----RPLAPV-----------ERAP------TAM
E---EMLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK
>Kwal_56.24628
----MLGAFR-------HAFTSLIK---PR-----LSIARYSSGLQSYHGFDLSTK----
--------------FLEPIPL----L----RPAASI-----------EPAP------TQL
E---ELFADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK