MUSCLE (3.8) multiple sequence alignment

NCAS0A14120        -------MFAFKSP------AATQLSLHPVSLFAIDSRISS--HRTLVGFVKNALGIDPP
NDAI0A01930        MLAVKTGNMTTANM------ILKSIPLQECSISYFKNNYQKFSNRHFVGFVKNALGMEPP
KNAG0C03750        -------MLLSRVL------TLGKHAPYESFHTEIVRYTFH---RTIMGYVRNAFGLEPR
KAFR0B00840        -------MLLSGAP------HVYARGRLQHLQRRV----LS---RTLVGFVRNALGLEPP
TBLA0E00500        -----------MTL------LYNTTKPILSKNIIACSNYSK---RNLMGFVRSTLGLDPP
ACL152W            -------MLVSRLP------QLAARPYAVGRGCAAGACGQR---RPIMGFVRNALGLDPP
KNAG0B02630        -------MLCTWTL------RPGVRSAHRALRASGLPCIAR---RQLMGFVRNALGLEPP
NDAI0E04480        MLCRCVSRLPTAYRSRLPTTLCFTPNPRNFRNNAHVSHHSS---RSLMGFVRNALGLDPK
Ecym_4727          -------MLLPVTK------RLGRPGFISSSSSRVCGKQQR---RQIMGFVRNALGLDPP
KLLA0D12430g       -------MLASRTP------VVYRAKPMT---------------RPIMGFVRNALGLDPP
NCAS0E02880        -------MFLRTSV------PVYRTTLLPRNAFNV-AGNQT---RHLMGFVRNALGLDPP
CAGL0A03927g       --------------------MIRTRTRAVQNTGKFYACVSK---RQLMGFVRNALGLDPP
TPHA0F02930        --MTVLMSSINTLR------HPMSMNILNKNTLTSLPSSQK---RSLMGFVKNALGLDPS
Suva_10.297        -MTALYAPSGAAQL------YSHLLRRSPQNRLVV-SHQTR---RHLMGFVRNALGLDPP
Skud_12.266        -MTALYAPSGAAQM------YSHLLRRSPYNRLVV-YHQTR---RHLMGFVRNALGLDPP
YLR203C            -MTVLYAPSGATQL------YFHLLRKSPHNRLVV-SHQTR---RHLMGFVRNALGLDPP
Smik_12.261        -MTALYVPSGATQL------YSHLLRRSSHNRLVL-SHQTR---RHLMGFVRNALGLDPP
Kpol_530.35        ----------MSTA------VKLPMRLGAGSYSLI----QK---RSLMGFVRNALGLDPP
ZYRO0F11616g       -----------------------MLRSIRLCRPIT----QR---RTIIGFVRNALGLDPP
TDEL0C02020        -------MMLSATS------RFPSLRAQRCGKVFN----QR---RFIIGFVRNALGLDPP
SAKL0F11286g       -------MLLSAYK------RC-SIAPASATRI------QK---RHIIGFVRNALGLDPP
KLTH0H01342g       -----------MQR------CILSRNTVRSCQHNV----QK---RHIMGFVRNALGLDPP
Kwal_56.24631      -----------MQR------YILNRSSLRNSHCSL----QK---RHIMGFVRNALGLDPP
                                                               * ::*:*..::*::* 

NCAS0A14120        PLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEA
NDAI0A01930        PSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEINYTCPISGIPTHHSKEA
KNAG0C03750        DSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKA
KAFR0B00840        PTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREA
TBLA0E00500        PSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKE
ACL152W            ASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDIRYSCERSGIPTHHSREA
KNAG0B02630        PSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREA
NDAI0E04480        SSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNA
Ecym_4727          TSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEA
KLLA0D12430g       ASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQFTCPLSGIPTHHSREA
NCAS0E02880        TSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREA
CAGL0A03927g       PSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQYTCPISGIPTHHSREA
TPHA0F02930        PSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREA
Suva_10.297        PSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
Skud_12.266        PSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
YLR203C            PSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
Smik_12.261        PSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
Kpol_530.35        PSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDINYTCPLSGIPTHHDKEA
ZYRO0F11616g       PSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKEINYTCPLSGIPTHHSKEA
TDEL0C02020        PSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREA
SAKL0F11286g       PSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEINYTCPQSGIPTHHSREA
KLTH0H01342g       PSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREA
Kwal_56.24631      PSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHHSREA
                     *  *   ***: *: **   :* *** *.: * **::   : ::*  ******:. : 

NCAS0A14120        WENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQ
NDAI0A01930        WENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQ
KNAG0C03750        WEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQ
KAFR0B00840        WEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRS
TBLA0E00500        WEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRN
ACL152W            WEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQ
KNAG0B02630        WEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRG
NDAI0E04480        WEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRS
Ecym_4727          WKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRS
KLLA0D12430g       WEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRS
NCAS0E02880        WEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRA
CAGL0A03927g       WEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRS
TPHA0F02930        WEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRN
Suva_10.297        WEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRS
Skud_12.266        WEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRS
YLR203C            WEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRS
Smik_12.261        WEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRS
Kpol_530.35        WLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRLINLTNWDLFFYTRS
ZYRO0F11616g       WEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFDRTVNMTNWDLFFYTRQ
TDEL0C02020        WEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQ
SAKL0F11286g       WEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQ
KLTH0H01342g       WENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRG
Kwal_56.24631      WEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRG
                   *  *  *: .:    *.***::********.* ** **     *  :.: ***:::*** 

NCAS0A14120        FYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----
NDAI0A01930        FVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYSL----
KNAG0C03750        FYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTL----
KAFR0B00840        FYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSL----
TBLA0E00500        FFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYTLNNNS
ACL152W            FYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTL----
KNAG0B02630        FYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTL----
NDAI0E04480        FYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTL----
Ecym_4727          FFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTL----
KLLA0D12430g       FYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLEGLKSLAALRYTL----
NCAS0E02880        FYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTL----
CAGL0A03927g       FYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGLKSLAALRYTL----
TPHA0F02930        FYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSL----
Suva_10.297        FYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
Skud_12.266        FYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
YLR203C            FYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
Smik_12.261        FYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
Kpol_530.35        FYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLEGLKSLAALRYTL----
ZYRO0F11616g       FYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLEGLKSLAALRYTL----
TDEL0C02020        FYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTL----
SAKL0F11286g       FYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTL----
KLTH0H01342g       FYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTL----
Kwal_56.24631      FFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGLKSLAALRYTL----
                   * ***::*::*:******** ::.*:* ::.** * *.**::******:**:.*:*    

NCAS0A14120        -------RNNA---FA--TTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFI
NDAI0A01930        -------RHNE---FE--TTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEINFI
KNAG0C03750        YPK----LGKT----S--LSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEIHFI
KAFR0B00840        YPS----QHKS---SRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTFEIIFI
TBLA0E00500        LSDTSSGNSDSTTITA--TSKNRPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFI
ACL152W            YPES---ESAR-------AVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHFI
KNAG0B02630        YSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFI
NDAI0E04480        YPF----HNKS--FMT--LTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFI
Ecym_4727          YPE----QNRR---VR--SIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIELHFV
KLLA0D12430g       YPE----QSGR---FR--AGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIELHFV
NCAS0E02880        YPM----QNRL--VIS--TTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTFEIHFI
CAGL0A03927g       YPL----QNRA--VTT--TAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFEIHFI
TPHA0F02930        YPF----QRKS-NISL--KLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFI
Suva_10.297        YPL----ENRS--VLA--TTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFI
Skud_12.266        YPL----ENRS--VLA--TTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFV
YLR203C            YPL----ENRS--LPT--TTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFI
Smik_12.261        YPL----ENRS--LLT--ATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFI
Kpol_530.35        YPY----QNKSQNVKV--NTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQEFEIHFI
ZYRO0F11616g       YPF----ENKT---VA--ATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFELHFI
TDEL0C02020        YPL----ENKT---IS--STKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFELHFV
SAKL0F11286g       YPQ----QHRK--VSA--ATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFELHFI
KLTH0H01342g       YPE----QNRR--VTS--ITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELHFV
Kwal_56.24631      YPD----QNRR--VTS--IAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQMEIHFV
                                       .  .:*:*::*:***: ** *:***:.:::.   :*: *:

NCAS0A14120        GPECSLLEQDSNYLSSDS--------------RIVKRVDESLTLAYYPDYFDKFHKAQDF
NDAI0A01930        GPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDF
KNAG0C03750        GPECQLKEPKN----TST--------------PLIKKVDDTLSLIYHPQYFHELHKSGDL
KAFR0B00840        GPECQL-REPSNSVGGAN--------------NIVKRIDDTISLVYHPKLFHDIHKAQDF
TBLA0E00500        GPESLLSKDKSHYVTSTT--------------PITKRIDDSMSLVYHTDYFHVYHKAQDF
ACL152W            GPEALYDRQRKEYVHSST--------------PVSKRVDGTLKLVHHTDYLHVFHEAQDF
KNAG0B02630        GPESYYDRARGQYVRSPT--------------PVVEKVDETLKFIHYTDYFHVLHESQDF
NDAI0E04480        GPEAYYDKEKKQYLKLDK--------------PLIQTIDDTLKLTFITEYFHTLHESQDL
Ecym_4727          GPESNYDREKREYVTSSI--------------PVVKRIDDTMKMHYHTDYFHVFHEAQDF
KLLA0D12430g       GPESFYDREKRSYVQSSTE-------------TIVKRIDEKMQLFYHTDFFHVFHEAQDF
NCAS0E02880        GPESYYDKDKKKYIQLTT--------------PITESVDETLKLIYHTEYFHKLHEAQDF
CAGL0A03927g       GPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHTAQDF
TPHA0F02930        GTECLLNNEKNKYIKSAI--------------PVVKKIDETMKLIYHSDYFHVYHEAQDF
Suva_10.297        GPECLYKRDKQEYVKSAT--------------PVVQRIDETLKFFHHTDFFQVFHEAQDF
Skud_12.266        GPECLYKRDKQEYVKSAT--------------PVVQRVDETLRFIHHTDFFDVFHEAQDF
YLR203C            GPECLYKRDKQEYVKSTT--------------PVVQRVDETLKFIYRTNFFEVFHEAQDF
Smik_12.261        GPECLYKRDKQEYVKSTT--------------PVVQRVDETLKFIHRTDFFEVFHEAQDF
Kpol_530.35        GPECYLNKEKNQYITSST--------------PIVKKVDDTLKLVFHPDYFHVFHEAQDF
ZYRO0F11616g       GPECLVNKEKHQYVSSPA--------------PVVKRIDETLSFVYHTDYFHVYHDAQDF
TDEL0C02020        GPECLLNKEKHQYVTSST--------------PVVKRVDETISFVYHTDFFHVLHEAQDF
SAKL0F11286g       GPESFYDREKREYITSST--------------PIVRRVDETLSFVYHTDYFHVFHEAQDF
KLTH0H01342g       GPESYYDRNKREYVHSSS--------------PIVRRVDETLSFVYHTDYFHVFHEAQDF
Kwal_56.24631      GPESYYDRNKREYVHSAA--------------PIIRRVDETLNFVYHTDYFHVFHEAQDF
                   *.*.                             :   :*  : : . .. :   * : *:

NCAS0A14120        FPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQD
NDAI0A01930        FPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQE
KNAG0C03750        FPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDK
KAFR0B00840        FPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNK
TBLA0E00500        YPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLNK
ACL152W            FPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRA
KNAG0B02630        FPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE
NDAI0E04480        FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE
Ecym_4727          FPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKE
KLLA0D12430g       FPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQD
NCAS0E02880        FPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQD
CAGL0A03927g       FPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQILQD
TPHA0F02930        VPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKA
Suva_10.297        FPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKS
Skud_12.266        FPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKS
YLR203C            FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKS
Smik_12.261        FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKS
Kpol_530.35        FPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKN
ZYRO0F11616g       FPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMD
TDEL0C02020        FPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKD
SAKL0F11286g       FPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVRE
KLTH0H01342g       FPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVG
Kwal_56.24631      FPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVA
                    **:.: * ** **** .       *: .*:  *::::*.:* **.    :  *.  :  

NCAS0A14120        TYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA---
NDAI0A01930        TYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV---
KNAG0C03750        CYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI---
KAFR0B00840        MYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI---
TBLA0E00500        NFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATETGKS
ACL152W            SHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV---
KNAG0B02630        KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR---
NDAI0E04480        KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL---
Ecym_4727          KYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL---
KLLA0D12430g       KYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL---
NCAS0E02880        KYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR---
CAGL0A03927g       TYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV---
TPHA0F02930        RYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR---
Suva_10.297        KYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
Skud_12.266        KYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
YLR203C            KYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
Smik_12.261        KYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
Kpol_530.35        RYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV---
ZYRO0F11616g       KHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI---
TDEL0C02020        KYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV---
SAKL0F11286g       KYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV---
KLTH0H01342g       KHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV---
Kwal_56.24631      EYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV---
                    .  .:* :: *  * :**.****:* :*:.::*:**:::.:***** . :    

FASTA FORMAT for MUSCLE Version 3.6

>NCAS0A14120
-------MFAFKSP------AATQLSLHPVSLFAIDSRISS--HRTLVGFVKNALGIDPP
PLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEA
WENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQ
FYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----
-------RNNA---FA--TTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFI
GPECSLLEQDSNYLSSDS--------------RIVKRVDESLTLAYYPDYFDKFHKAQDF
FPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQD
TYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA---
>NDAI0A01930
MLAVKTGNMTTANM------ILKSIPLQECSISYFKNNYQKFSNRHFVGFVKNALGMEPP
PSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEINYTCPISGIPTHHSKEA
WENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQ
FVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYSL----
-------RHNE---FE--TTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEINFI
GPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDF
FPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQE
TYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV---
>KNAG0C03750
-------MLLSRVL------TLGKHAPYESFHTEIVRYTFH---RTIMGYVRNAFGLEPR
DSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKA
WEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQ
FYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTL----
YPK----LGKT----S--LSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEIHFI
GPECQLKEPKN----TST--------------PLIKKVDDTLSLIYHPQYFHELHKSGDL
FPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDK
CYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI---
>KAFR0B00840
-------MLLSGAP------HVYARGRLQHLQRRV----LS---RTLVGFVRNALGLEPP
PTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREA
WEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRS
FYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSL----
YPS----QHKS---SRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTFEIIFI
GPECQL-REPSNSVGGAN--------------NIVKRIDDTISLVYHPKLFHDIHKAQDF
FPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNK
MYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI---
>TBLA0E00500
-----------MTL------LYNTTKPILSKNIIACSNYSK---RNLMGFVRSTLGLDPP
PSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKE
WEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRN
FFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYTLNNNS
LSDTSSGNSDSTTITA--TSKNRPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFI
GPESLLSKDKSHYVTSTT--------------PITKRIDDSMSLVYHTDYFHVYHKAQDF
YPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLNK
NFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATETGKS
>ACL152W
-------MLVSRLP------QLAARPYAVGRGCAAGACGQR---RPIMGFVRNALGLDPP
ASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDIRYSCERSGIPTHHSREA
WEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQ
FYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTL----
YPES---ESAR-------AVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHFI
GPEALYDRQRKEYVHSST--------------PVSKRVDGTLKLVHHTDYLHVFHEAQDF
FPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRA
SHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV---
>KNAG0B02630
-------MLCTWTL------RPGVRSAHRALRASGLPCIAR---RQLMGFVRNALGLEPP
PSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREA
WEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRG
FYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTL----
YSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFI
GPESYYDRARGQYVRSPT--------------PVVEKVDETLKFIHYTDYFHVLHESQDF
FPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE
KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR---
>NDAI0E04480
MLCRCVSRLPTAYRSRLPTTLCFTPNPRNFRNNAHVSHHSS---RSLMGFVRNALGLDPK
SSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNA
WEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRS
FYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTL----
YPF----HNKS--FMT--LTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFI
GPEAYYDKEKKQYLKLDK--------------PLIQTIDDTLKLTFITEYFHTLHESQDL
FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE
KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL---
>Ecym_4727
-------MLLPVTK------RLGRPGFISSSSSRVCGKQQR---RQIMGFVRNALGLDPP
TSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEA
WKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRS
FFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTL----
YPE----QNRR---VR--SIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIELHFV
GPESNYDREKREYVTSSI--------------PVVKRIDDTMKMHYHTDYFHVFHEAQDF
FPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKE
KYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL---
>KLLA0D12430g
-------MLASRTP------VVYRAKPMT---------------RPIMGFVRNALGLDPP
ASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQFTCPLSGIPTHHSREA
WEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRS
FYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLEGLKSLAALRYTL----
YPE----QSGR---FR--AGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIELHFV
GPESFYDREKRSYVQSSTE-------------TIVKRIDEKMQLFYHTDFFHVFHEAQDF
FPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQD
KYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL---
>NCAS0E02880
-------MFLRTSV------PVYRTTLLPRNAFNV-AGNQT---RHLMGFVRNALGLDPP
TSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREA
WEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRA
FYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTL----
YPM----QNRL--VIS--TTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTFEIHFI
GPESYYDKDKKKYIQLTT--------------PITESVDETLKLIYHTEYFHKLHEAQDF
FPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQD
KYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR---
>CAGL0A03927g
--------------------MIRTRTRAVQNTGKFYACVSK---RQLMGFVRNALGLDPP
PSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQYTCPISGIPTHHSREA
WEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRS
FYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGLKSLAALRYTL----
YPL----QNRA--VTT--TAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFEIHFI
GPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHTAQDF
FPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQILQD
TYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV---
>TPHA0F02930
--MTVLMSSINTLR------HPMSMNILNKNTLTSLPSSQK---RSLMGFVKNALGLDPS
PSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREA
WEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRN
FYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSL----
YPF----QRKS-NISL--KLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFI
GTECLLNNEKNKYIKSAI--------------PVVKKIDETMKLIYHSDYFHVYHEAQDF
VPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKA
RYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR---
>Suva_10.297
-MTALYAPSGAAQL------YSHLLRRSPQNRLVV-SHQTR---RHLMGFVRNALGLDPP
PSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
WEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRS
FYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
YPL----ENRS--VLA--TTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFI
GPECLYKRDKQEYVKSAT--------------PVVQRIDETLKFFHHTDFFQVFHEAQDF
FPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKS
KYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
>Skud_12.266
-MTALYAPSGAAQM------YSHLLRRSPYNRLVV-YHQTR---RHLMGFVRNALGLDPP
PSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
WEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRS
FYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
YPL----ENRS--VLA--TTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFV
GPECLYKRDKQEYVKSAT--------------PVVQRVDETLRFIHHTDFFDVFHEAQDF
FPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKS
KYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
>YLR203C
-MTVLYAPSGATQL------YFHLLRKSPHNRLVV-SHQTR---RHLMGFVRNALGLDPP
PSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
WEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRS
FYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
YPL----ENRS--LPT--TTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFI
GPECLYKRDKQEYVKSTT--------------PVVQRVDETLKFIYRTNFFEVFHEAQDF
FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKS
KYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
>Smik_12.261
-MTALYVPSGATQL------YSHLLRRSSHNRLVL-SHQTR---RHLMGFVRNALGLDPP
PSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREA
WEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRS
FYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTL----
YPL----ENRS--LLT--ATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFI
GPECLYKRDKQEYVKSTT--------------PVVQRVDETLKFIHRTDFFEVFHEAQDF
FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKS
KYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ--
>Kpol_530.35
----------MSTA------VKLPMRLGAGSYSLI----QK---RSLMGFVRNALGLDPP
PSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDINYTCPLSGIPTHHDKEA
WLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRLINLTNWDLFFYTRS
FYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLEGLKSLAALRYTL----
YPY----QNKSQNVKV--NTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQEFEIHFI
GPECYLNKEKNQYITSST--------------PIVKKVDDTLKLVFHPDYFHVFHEAQDF
FPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKN
RYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV---
>ZYRO0F11616g
-----------------------MLRSIRLCRPIT----QR---RTIIGFVRNALGLDPP
PSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKEINYTCPLSGIPTHHSKEA
WEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFDRTVNMTNWDLFFYTRQ
FYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLEGLKSLAALRYTL----
YPF----ENKT---VA--ATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFELHFI
GPECLVNKEKHQYVSSPA--------------PVVKRIDETLSFVYHTDYFHVYHDAQDF
FPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMD
KHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI---
>TDEL0C02020
-------MMLSATS------RFPSLRAQRCGKVFN----QR---RFIIGFVRNALGLDPP
PSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREA
WEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQ
FYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTL----
YPL----ENKT---IS--STKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFELHFV
GPECLLNKEKHQYVTSST--------------PVVKRVDETISFVYHTDFFHVLHEAQDF
FPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKD
KYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV---
>SAKL0F11286g
-------MLLSAYK------RC-SIAPASATRI------QK---RHIIGFVRNALGLDPP
PSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEINYTCPQSGIPTHHSREA
WEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQ
FYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTL----
YPQ----QHRK--VSA--ATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFELHFI
GPESFYDREKREYITSST--------------PIVRRVDETLSFVYHTDYFHVFHEAQDF
FPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVRE
KYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV---
>KLTH0H01342g
-----------MQR------CILSRNTVRSCQHNV----QK---RHIMGFVRNALGLDPP
PSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREA
WENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRG
FYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTL----
YPE----QNRR--VTS--ITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELHFV
GPESYYDRNKREYVHSSS--------------PIVRRVDETLSFVYHTDYFHVFHEAQDF
FPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVG
KHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV---
>Kwal_56.24631
-----------MQR------YILNRSSLRNSHCSL----QK---RHIMGFVRNALGLDPP
PSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHHSREA
WEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRG
FFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGLKSLAALRYTL----
YPD----QNRR--VTS--IAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQMEIHFV
GPESYYDRNKREYVHSAA--------------PIIRRVDETLNFVYHTDYFHVFHEAQDF
FPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVA
EYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV---