MUSCLE (3.8) multiple sequence alignment

ACL147W            -------------MFRVC--------------------RRLYHPNTLEHAVG-NRLRPLA
Ecym_4722          -----MNIRCHRIMLGGF--------------------RRFYHVNSAEYAVG-NTLRPLI
CAGL0A03949g       MSLYNNLRLVTRQKQVSGLLSA----------------VRRYHPTSNEYVNP-KVWEPLT
KNAG0B02620        ----MSIRLLKNSVSRRALLS-----------------TRLYHPNPIEYANS-TVVAPLT
KAFR0L01480        MVMSSFTPLNKSLLRTTQFKCL----------------RRLYHPASNEYVNP-TTISPLT
TBLA0E00450        ---MSFLASSKSVLKTNSRCFLLNPNSILLSKHIKNNGIRTYYSVSNDVKKS-DHLEPLL
TPHA0F02980        -------MINRGRLIFRKSGVN----------------ARFFHPATDEYVLP-NKLSPCT
NDAI0E04470        -------MLLNRILSKNVKLSI----------------NRAFHSNTLEYAKA-ATLSPLT
NCAS0E02870        -------MLNRSILKKGLFSY------------------RSYHPSLKEYVKP-ATLSPLT
Smik_12.260        -------MLCRNILRKGCTSF------------------RLYHPNPIEHVKS-HHIKPLT
YLR201C            -------MLCRNTARTGCKFF------------------RLYHSNPIEHVKP-IHIKPLT
Suva_10.296        -------MFSRNAVRKASASL------------------RLYHSNPIEHVNP-LHIKPLA
Skud_12.265        -------MFCRNVARNGCKFH------------------RLYHSNPIEHVKP-LHIKPLT
Kpol_530.30        -------MLKNFVPKRTAFGL-----------------TRFYHPNPKEYVPQ-LTLPPLL
ZYRO0F11726g       ------------MFKRLCQVS-----------------LRRYHPSKGEHLNS-SRLGPLN
TDEL0C01970        --------MISKRLIAGSRIF-----------------ARGYRPAGFEYINPINSRGPLK
SAKL0F11396g       ------------MFKQAFSKIA----------------RRGYHPNNLEHASS-KVLPPLI
KLLA0D12320g       ----------------MSRVF-----------------TRLYHPNNLEHALP-KIIKPLT
KLTH0H01232g       -------------MLALSRILA----------------RRLYHPSALEHQLA-HSFAPLT
Kwal_56.24644      ------------MLARSFRTLG----------------RRFYQPNPLEYQLT-TKLAPLA
                                                          * :     :         *  

ACL147W            YEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYG--SAVLSALAAPNSPALLNV-
Ecym_4722          YGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN--SAVLAAIGANNSPAMFNV-
CAGL0A03949g       YTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMP--SGMLTTIGASNSATFLHS-
KNAG0B02620        YTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYD--SSMMSVLGASNSPSIFHS-
KAFR0L01480        YSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYS--SSMMSVIGASNSPSFAHS-
TBLA0E00450        YGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYN--SSMISVLGSSNTHNILHS-
TPHA0F02980        YTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHS-
NDAI0E04470        YNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLS--SSLFSVLGSSNSPSIFRSI
NCAS0E02870        YNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFS--SSLLSVIGASNSPAIFRSI
Smik_12.260        YGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYP--SSMISSISASNSPSFFHS-
YLR201C            YGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYP--SSMISSIGAPNSPSFFHS-
Suva_10.296        YGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYP--SSMISSIGASNSPSFVHS-
Skud_12.265        YGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYP--SSMVSSIGASNSPSFFHS-
Kpol_530.30        YGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYP--SSILSVIGSSNTPSFLHS-
ZYRO0F11726g       YGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYP--STMLSVIGASNSPSLLHS-
TDEL0C01970        YGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYP--STMLSVIGSSNGPSFFHS-
SAKL0F11396g       YSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYS--SSFLSVLGASNSPSFFNS-
KLLA0D12320g       YGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMG--SSYLSVLGSSNSPSFFNV-
KLTH0H01232g       YGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLG--PSLLSVIGASNSPSFLNA-
Kwal_56.24644      YGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLG--SQVLSSIGAPNSPPLLNS-
                   *   * :  :*   :   *.  **.: ::  :   :     .  .: :.: *   : .  

ACL147W            PSAVLELVKFHLVTKRVALAD-------AAAQGNVSMEQLFLQRVEADRPLAGQLTQLLS
Ecym_4722          STSVQELVKFHLVTKRYGLQED--------QEGTKTLEELFLKRLEANKSLGPHLKEVLS
CAGL0A03949g       SPAVMELIKFQLVEKRHRMVEGITEI--AEASKLPSLESLLLKRLKMDVPIASHLTQMTA
KNAG0B02620        SPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHLLVKRLQMDVPLSKQLGDLFT
KAFR0L01480        SPAVLELIKYNLVSKRIELTKD------TNDNTTTTLKELLLKRLEMDIPISSQLRGLFA
TBLA0E00450        SPAVLELLKFNLVSKRLKLSEGIDPE----TKDLPSLEYLLLKRLQMDKAIQSRLNEMIT
TPHA0F02980        SPSVMELLKFNLVLKRYRMIEGLDPLT-MQQEELPSLESLLLKRLEMDIPIGKHISAFMS
NDAI0E04470        SPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLIERLKMDQPLNNQLSSLFN
NCAS0E02870        SPAVMELIKFQLVSKRYELTENLCPDT-TPKNELPSLESLLLKRLEMDKAIGKQIPHLFA
Smik_12.260        STAVMELIKFQLVDKRYRLTEAINPDV-TPQYKLPSLEHLLLRRLEMDKPIGGCLSELMS
YLR201C            STAVMELIKFQLVDKRYRLTEGINPDV-TPQYKLPSLEHLLLKRLEMDKPIGGHLSELMS
Suva_10.296        STAVMELLKFQLVDKRYRLTEGINPDV-TPHYKLPSLEHLLLKRLEMDKPVGEQLTDLMS
Skud_12.265        STAVMELVKFQLVDKRYRLTEGINPDV-TSRYKLPSLEHLLLKRLEMDKLIGGQLADLMS
Kpol_530.30        STALMELLKFNLVAKRYQLSEDIPLD--TPVEELPSLEDLLIKRLKMDVPIGPHLSQLIA
ZYRO0F11726g       SPAVMELVKFHLVQKRLQLSQDLS------SEEKPSLEDLFIKRLELNVPIAGHLSQLLS
TDEL0C01970        SPALMELLKFHLVDKRLNLTENISLE--TPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLS
SAKL0F11396g       SPAVLELLKFHLVSKRYSLTDGVA----DGTLESPSLENLFLKRLEMNKPIAAHLSQLLS
KLLA0D12320g       SPSVLELVKFHLVSKRNQLITDLPL---DSDKPLPDLKTLFLQRLKLNEHVAPHLSQLLS
KLTH0H01232g       SPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLS
Kwal_56.24644      SPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHKRLELNIPIAQHMTQLLA
                   ..:: **:*::** **  :                 :: *.  *:: :  :   :  .  

ACL147W            ILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAVAMAYVSTNLFMARDR
Ecym_4722          ILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKDS
CAGL0A03949g       QLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDK
KNAG0B02620        QLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDN
KAFR0L01480        QLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDT
TBLA0E00450        KLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVSTTYIASQIFMAQDT
TPHA0F02980        QLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDN
NDAI0E04470        QLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNN
NCAS0E02870        ELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDN
Smik_12.260        QLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSKLFMAQDK
YLR201C            QLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSKLFMAQDK
Suva_10.296        QLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSQLFMAQDK
Skud_12.265        QLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLAVSSTYIGSKLFMAQDK
Kpol_530.30        QLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDR
ZYRO0F11726g       HVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISCAYVSSELFMAQDK
TDEL0C01970        QLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSKRLAVSCAYVSSELFMAQDR
SAKL0F11396g       CLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAISTAYVSSELFMAQDK
KLLA0D12320g       IMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIALSTAYVSSELFMAQDK
KLTH0H01232g       SLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDR
Kwal_56.24644      ILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRAAISCAFVSSELFMAQDK
                    :  *. :  . .:.** .*:**::::* * *  * ***:** .:: ::  :: :* .: 

ACL147W            SPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKSQLTRG
Ecym_4722          SPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQLVRG
CAGL0A03949g       SHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKSQMARV
KNAG0B02620        SLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRAKAGFSRH
KAFR0L01480        SNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQFSRM
TBLA0E00450        SVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQLARS
TPHA0F02980        SCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNMVKSRMSRA
NDAI0E04470        GENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNLVKARLARG
NCAS0E02870        SRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLVRARLARS
Smik_12.260        SHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVKSQLVRG
YLR201C            SHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIKSQLVRG
Suva_10.296        SHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVKSQLARG
Skud_12.265        SHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVKSQLARG
Kpol_530.30        SPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKSKAARG
ZYRO0F11726g       SHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQMARG
TDEL0C01970        SPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTINLVKSQLARG
SAKL0F11396g       SIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKSQMTRS
KLLA0D12320g       SHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAKSQITRG
KLTH0H01232g       SANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLAKSQLTRS
Kwal_56.24644      SPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLAKSQITRS
                   .     *. **  .: .   :*  *.* **: *: :: : .  .:   * 

FASTA FORMAT for MUSCLE Version 3.6

>ACL147W
-------------MFRVC--------------------RRLYHPNTLEHAVG-NRLRPLA
YEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYG--SAVLSALAAPNSPALLNV-
PSAVLELVKFHLVTKRVALAD-------AAAQGNVSMEQLFLQRVEADRPLAGQLTQLLS
ILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAVAMAYVSTNLFMARDR
SPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKSQLTRG
>Ecym_4722
-----MNIRCHRIMLGGF--------------------RRFYHVNSAEYAVG-NTLRPLI
YGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN--SAVLAAIGANNSPAMFNV-
STSVQELVKFHLVTKRYGLQED--------QEGTKTLEELFLKRLEANKSLGPHLKEVLS
ILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKDS
SPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQLVRG
>CAGL0A03949g
MSLYNNLRLVTRQKQVSGLLSA----------------VRRYHPTSNEYVNP-KVWEPLT
YTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMP--SGMLTTIGASNSATFLHS-
SPAVMELIKFQLVEKRHRMVEGITEI--AEASKLPSLESLLLKRLKMDVPIASHLTQMTA
QLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDK
SHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKSQMARV
>KNAG0B02620
----MSIRLLKNSVSRRALLS-----------------TRLYHPNPIEYANS-TVVAPLT
YTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYD--SSMMSVLGASNSPSIFHS-
SPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHLLVKRLQMDVPLSKQLGDLFT
QLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDN
SLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRAKAGFSRH
>KAFR0L01480
MVMSSFTPLNKSLLRTTQFKCL----------------RRLYHPASNEYVNP-TTISPLT
YSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYS--SSMMSVIGASNSPSFAHS-
SPAVLELIKYNLVSKRIELTKD------TNDNTTTTLKELLLKRLEMDIPISSQLRGLFA
QLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDT
SNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQFSRM
>TBLA0E00450
---MSFLASSKSVLKTNSRCFLLNPNSILLSKHIKNNGIRTYYSVSNDVKKS-DHLEPLL
YGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYN--SSMISVLGSSNTHNILHS-
SPAVLELLKFNLVSKRLKLSEGIDPE----TKDLPSLEYLLLKRLQMDKAIQSRLNEMIT
KLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVSTTYIASQIFMAQDT
SVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQLARS
>TPHA0F02980
-------MINRGRLIFRKSGVN----------------ARFFHPATDEYVLP-NKLSPCT
YTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHS-
SPSVMELLKFNLVLKRYRMIEGLDPLT-MQQEELPSLESLLLKRLEMDIPIGKHISAFMS
QLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDN
SCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNMVKSRMSRA
>NDAI0E04470
-------MLLNRILSKNVKLSI----------------NRAFHSNTLEYAKA-ATLSPLT
YNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLS--SSLFSVLGSSNSPSIFRSI
SPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLIERLKMDQPLNNQLSSLFN
QLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNN
GENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNLVKARLARG
>NCAS0E02870
-------MLNRSILKKGLFSY------------------RSYHPSLKEYVKP-ATLSPLT
YNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFS--SSLLSVIGASNSPAIFRSI
SPAVMELIKFQLVSKRYELTENLCPDT-TPKNELPSLESLLLKRLEMDKAIGKQIPHLFA
ELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDN
SRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLVRARLARS
>Smik_12.260
-------MLCRNILRKGCTSF------------------RLYHPNPIEHVKS-HHIKPLT
YGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYP--SSMISSISASNSPSFFHS-
STAVMELIKFQLVDKRYRLTEAINPDV-TPQYKLPSLEHLLLRRLEMDKPIGGCLSELMS
QLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSKLFMAQDK
SHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVKSQLVRG
>YLR201C
-------MLCRNTARTGCKFF------------------RLYHSNPIEHVKP-IHIKPLT
YGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYP--SSMISSIGAPNSPSFFHS-
STAVMELIKFQLVDKRYRLTEGINPDV-TPQYKLPSLEHLLLKRLEMDKPIGGHLSELMS
QLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSKLFMAQDK
SHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIKSQLVRG
>Suva_10.296
-------MFSRNAVRKASASL------------------RLYHSNPIEHVNP-LHIKPLA
YGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYP--SSMISSIGASNSPSFVHS-
STAVMELLKFQLVDKRYRLTEGINPDV-TPHYKLPSLEHLLLKRLEMDKPVGEQLTDLMS
QLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSQLFMAQDK
SHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVKSQLARG
>Skud_12.265
-------MFCRNVARNGCKFH------------------RLYHSNPIEHVKP-LHIKPLT
YGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYP--SSMVSSIGASNSPSFFHS-
STAVMELVKFQLVDKRYRLTEGINPDV-TSRYKLPSLEHLLLKRLEMDKLIGGQLADLMS
QLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLAVSSTYIGSKLFMAQDK
SHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVKSQLARG
>Kpol_530.30
-------MLKNFVPKRTAFGL-----------------TRFYHPNPKEYVPQ-LTLPPLL
YGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYP--SSILSVIGSSNTPSFLHS-
STALMELLKFNLVAKRYQLSEDIPLD--TPVEELPSLEDLLIKRLKMDVPIGPHLSQLIA
QLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDR
SPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKSKAARG
>ZYRO0F11726g
------------MFKRLCQVS-----------------LRRYHPSKGEHLNS-SRLGPLN
YGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYP--STMLSVIGASNSPSLLHS-
SPAVMELVKFHLVQKRLQLSQDLS------SEEKPSLEDLFIKRLELNVPIAGHLSQLLS
HVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISCAYVSSELFMAQDK
SHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQMARG
>TDEL0C01970
--------MISKRLIAGSRIF-----------------ARGYRPAGFEYINPINSRGPLK
YGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYP--STMLSVIGSSNGPSFFHS-
SPALMELLKFHLVDKRLNLTENISLE--TPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLS
QLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSKRLAVSCAYVSSELFMAQDR
SPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTINLVKSQLARG
>SAKL0F11396g
------------MFKQAFSKIA----------------RRGYHPNNLEHASS-KVLPPLI
YSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYS--SSFLSVLGASNSPSFFNS-
SPAVLELLKFHLVSKRYSLTDGVA----DGTLESPSLENLFLKRLEMNKPIAAHLSQLLS
CLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAISTAYVSSELFMAQDK
SIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKSQMTRS
>KLLA0D12320g
----------------MSRVF-----------------TRLYHPNNLEHALP-KIIKPLT
YGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMG--SSYLSVLGSSNSPSFFNV-
SPSVLELVKFHLVSKRNQLITDLPL---DSDKPLPDLKTLFLQRLKLNEHVAPHLSQLLS
IMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIALSTAYVSSELFMAQDK
SHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAKSQITRG
>KLTH0H01232g
-------------MLALSRILA----------------RRLYHPSALEHQLA-HSFAPLT
YGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLG--PSLLSVIGASNSPSFLNA-
SPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLS
SLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDR
SANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLAKSQLTRS
>Kwal_56.24644
------------MLARSFRTLG----------------RRFYQPNPLEYQLT-TKLAPLA
YGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLG--SQVLSSIGAPNSPPLLNS-
SPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHKRLELNIPIAQHMTQLLA
ILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRAAISCAFVSSELFMAQDK
SPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLAKSQITRS