MUSCLE (3.8) multiple sequence alignment

KLTH0H01210g       -MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNV
Kwal_56.24648      -MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKV
NDAI0E04460        ----MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNV
SAKL0F11418g       MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV
TBLA0E00440        ---MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNV
KNAG0B02610        -----MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSV
KLLA0D12298g       ---MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGV
ACL146C            ---MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGV
Ecym_4721          ---MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGV
TDEL0C01960        -----MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNV
CAGL0A03971g       ----MSAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNV
TPHA0F02990        -----MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNV
Kpol_530.29        -----MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNV
NCAS0E02860        -----MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNV
ZYRO0F11748g       -----MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNV
KAFR0L01490        -----MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNV
Smik_12.259        -----MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNV
YLR200W            -----MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNV
Skud_12.264        -----MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNV
Suva_10.295        -----MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNV
                          .    *   *  ** .: :*..*********** :*:  :  :  ::**** *

KLTH0H01210g       LLPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQARQQ------
Kwal_56.24648      LLPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASKR------
NDAI0E04460        LLPVDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ----------
SAKL0F11418g       LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTAKLPV-----
TBLA0E00440        LLPIEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPAPTPASAK--
KNAG0B02610        LLPVDQDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQAAAQANAAAPT
KLLA0D12298g       LLPVEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRSQQQQQQQQ--
ACL146C            LLPVEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG----------
Ecym_4721          LLPVEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS----------
TDEL0C01960        LLPVEQSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ--------
CAGL0A03971g       LLPVEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLISQQK----------
TPHA0F02990        MLPIEQFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN--------
Kpol_530.29        LLPVEQFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA--------
NCAS0E02860        LLPVEQDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG----------
ZYRO0F11748g       LLPVEQDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDTN------
KAFR0L01490        LLPIEQDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSGQ--------
Smik_12.259        LLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR-
YLR200W            LLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR-
Skud_12.264        LLPVEQSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER-
Suva_10.295        LLPVEQSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR-
                   :**::: :*  *: ***:**  ** .** *:. **   :  .  ::              

KLTH0H01210g       ----
Kwal_56.24648      ----
NDAI0E04460        ----
SAKL0F11418g       ----
TBLA0E00440        ----
KNAG0B02610        ASAK
KLLA0D12298g       ----
ACL146C            ----
Ecym_4721          ----
TDEL0C01960        ----
CAGL0A03971g       ----
TPHA0F02990        ----
Kpol_530.29        ----
NCAS0E02860        ----
ZYRO0F11748g       ----
KAFR0L01490        ----
Smik_12.259        ----
YLR200W            ----
Skud_12.264        ----
Suva_10.295        ----
                       

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0H01210g
-MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNV
LLPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQARQQ------
----
>Kwal_56.24648
-MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKV
LLPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASKR------
----
>NDAI0E04460
----MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNV
LLPVDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ----------
----
>SAKL0F11418g
MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV
LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTAKLPV-----
----
>TBLA0E00440
---MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNV
LLPIEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPAPTPASAK--
----
>KNAG0B02610
-----MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSV
LLPVDQDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQAAAQANAAAPT
ASAK
>KLLA0D12298g
---MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGV
LLPVEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRSQQQQQQQQ--
----
>ACL146C
---MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGV
LLPVEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG----------
----
>Ecym_4721
---MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGV
LLPVEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS----------
----
>TDEL0C01960
-----MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNV
LLPVEQSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ--------
----
>CAGL0A03971g
----MSAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNV
LLPVEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLISQQK----------
----
>TPHA0F02990
-----MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNV
MLPIEQFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN--------
----
>Kpol_530.29
-----MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNV
LLPVEQFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA--------
----
>NCAS0E02860
-----MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNV
LLPVEQDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG----------
----
>ZYRO0F11748g
-----MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNV
LLPVEQDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDTN------
----
>KAFR0L01490
-----MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNV
LLPIEQDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSGQ--------
----
>Smik_12.259
-----MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNV
LLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR-
----
>YLR200W
-----MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNV
LLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR-
----
>Skud_12.264
-----MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNV
LLPVEQSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER-
----
>Suva_10.295
-----MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNV
LLPVEQSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR-
----