MUSCLE (3.8) multiple sequence alignment

CAGL0E01353g      ------MDIVQLLFKR---DDDDGPPPA--------------CAVDNDFNGHTNLRILSV
CAGL0M04301g      --------MHNELLGR--------SVDT--------------CSTENDYNGEQNLRILAV
KLLA0D16434g      MLEAIAYAAAELLFKRQDVVTDGDTTEVDTHDHDEEDEDHVECESDNDYDGKDNMRVCAL
TBLA0H01270       --MLDAQTLLDVIVKRHGADDDSDHVPA--------------CETSNDYDGRMNLRILSV
KNAG0A05180       -----MDPITFLLFKR---DDDSGPAPA--------------CADTNEYDGRSNLRILSI
SAKL0H15510g      ----------MQFSAR------DDEVDV--------------CDNDNEYDGRDSLRILAV
TPHA0A01550       -----MSSQFIELVLR-----DGDSTDT--------------CDTQSSYNGSTNMRVLAL
Kpol_543.64       -------MDVLRLLVR----DTEGVVDT--------------CEATNDFDGRINLRVLSI
KAFR0B05730       ---------MSELIPR----------DT--------------CQTSNDYNGSDNLRILAV
KAFR0H02250       ------MLSITELIPR--------AIDT--------------CSTSNDYDGNNNLRILSV
KNAG0G02460       ----MLDLAFAALLPR-----DDDDVVA--------------CAVSNSYNGHNGLRILAV
NDAI0G02570       ---------MLELLAR-------DDAVV--------------CEISNDYNGHSGLRILAV
NCAS0C03250       --------MIDIILAR--------DVDT--------------CEVSNTYNGHAGLRILAI
NDAI0J01010       ------------------------MTDT--------------CLNTNDFNGRTNIRILSI
NCAS0B03580       ------------------------MTDT--------------CQAQNDYNGETNIRILSV
Suva_10.223       ---------MIDLLIR------DDSTDS--------------CQASNDYNGHSGLRILAV
Skud_12.199       ---------MIDLVVR------DDSTDS--------------CQASNDYNGHAGLRILAV
YLR130C           ---------MVDLIAR------DDSVDT--------------CQASNGYNGHAGLRILAV
Smik_12.193       ---------MIDLIVR------DDSTDS--------------CQASNDYNGHAGLRILAV
                                                            *   . ::*  .:*: ::

CAGL0E01353g      FMVLISSAIGVYFPLLASRYSFINLPSWVFFIAKFFGSGVIVATAFIHLLEPASDSLGNP
CAGL0M04301g      FIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHLLQPAAEALTDD
KLLA0D16434g      FIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGFIHLLEPAADALGEE
TBLA0H01270       FILLISSGIGVNFPILASQYSFIRLPKWCFFIAKFFGSGVIIATAFVHLLEPAADALGNA
KNAG0A05180       FIILISSAMGSFFPILSSKYSFIRLPDWCFFLAKFFGSGVIVATAFVHLLQPANEALTDE
SAKL0H15510g      FMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKFFGSGVIVATGFIHLLKPATDNLGNT
TPHA0A01550       FIILISSGLGSFFPILASTYSFIRLPDCCFFVAKFFGSGVIVATAFIHLLDPAVEALSNT
Kpol_543.64       FMIMISSGLGVFFPLLASRYSFIRLPEWCFFIAKFFGSGVIVSTAFIHLLVPAAEALGND
KAFR0B05730       FMILISSALGAFFPLLSSKYSFIKLPNWCFFIAKFFGSGVIVATAFIHLLEPASDALTND
KAFR0H02250       FILLISASIGVFFPILASRYSFINLPGWCFFIAKFFGSGVIVATAFIHLLEPASEELGDD
KNAG0G02460       FIILISSGVGVFFPIMASRYSFIRLPDWCFFIAKFFGSGVIVATAFIHLLQPASEALGDP
NDAI0G02570       FIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAFIHLLDPAAEALGNE
NCAS0C03250       FIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEALGNS
NDAI0J01010       FMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSGVIVATAFIHLLEPASDALGDP
NCAS0B03580       FMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSGVIVATAFVHLLQPASEALSDP
Suva_10.223       FIILISSGLGVYFPILSSRYSFIRLPDCCFFIAKFFGSGVIVATAFIHLLQPAAEALGNE
Skud_12.199       FIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDE
YLR130C           FIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDE
Smik_12.193       FIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDE
                  *::::*..:*  **:::: ** *.**   **:*********::*.*:*** ** : * : 

CAGL0E01353g      CLGGTFANYPWAFGICLMALFALFLIEIVSHHYVGKT-MG-G-GHNHSHNMPTTFGQTHM
CAGL0M04301g      CLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKK-FN----HSHAE-----------
KLLA0D16434g      CLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKS-YGFQNDHVHSH-----------
TBLA0H01270       CLGGTFAEYPWAFGICLMSLFFLFFTEIISHHIIDQR-LA-K-EHGHGH-----------
KNAG0A05180       CLTGTFQSYPWAFGICLMSLFLLFLMELVSHYLIAKT-FG-HAAHDHSD-----------
SAKL0H15510g      CLGGTFADYPWAFGICLMSLFALFFSEIITHHFFIKA-NG-NSDHTNSH-----------
TPHA0A01550       CLGGTFTEYPWAFGICLMSLFLLFLIEIMTHHMLTHDEHG-DGGHSHGD-----------
Kpol_543.64       CLGGTFVEYPWAFGICLMSLFLLFFTEIITHYFMSKS-LD-N-DHGDSGHSHSHFGNQNK
KAFR0B05730       CLGGTFADYPWAFGICLMSLFFLFFSEICSHYFILRA-YG-NEDHSH-------------
KAFR0H02250       CLGGTFAEYPWAFGICLMSLFFLFLVEIISHYFVNKN-FG-H-DHGHDE-----------
KNAG0G02460       CLGGTFAEYPWAFGICLMSLFMLFFTEIVSHHFISKS-LG-DSHESHGG-----------
NDAI0G02570       CLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKS-FG-DEHHDHGN-NINSVHDDDA
NCAS0C03250       CLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS-FG---DHDHDGGHSNHHEDDIT
NDAI0J01010       CLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKA-FE-TVSHSASG-----------
NCAS0B03580       CLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKA-FS--------------------
Suva_10.223       CLGGTFAEYPWAFGICLISLFLLFFTEIITHYFVAKT-LG-H-DHGDHG---EVAAIDSR
Skud_12.199       CLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKT-LG-H-DHGDNE---GVGTVDAD
YLR130C           CLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKT-LG-H-DHGDHG---EVTSIDVD
Smik_12.193       CLGGTFAEYPWAFGICLMSLFLLFFTEIITHYYVAKT-LG-H-DHGDHG---ENTSIDVD
                  ** *** .*********::** **: *  :..   .                        

CAGL0E01353g      HGVEDDMVDEDGSS--STHSHSHVAMDDKYGDVVKN---NNYNYDDGSDDIESQKRPAFN
CAGL0M04301g      -------------------TDNANALPDIILKDIQI---STDDLSEGMLNCAGHQDSLQD
KLLA0D16434g      -------------------------------FPSSK---DQKSLEDEDDEDSDKYNQVVD
TBLA0H01270       ---------------------------DEEHAAIER---VDTIECCEENSCDEEPNPMVI
KNAG0A05180       -----------------------------FGNFVRK---DSKELIDESDSESLHKGS---
SAKL0H15510g      ----------------SHFGEPNHTTHQQFPDESEK---KD-DEEEADVECAAEYIPLKV
TPHA0A01550       --------------DTSYTASSIDDKEADSIDADVR---KDANDDSYDINSILNFDKNKD
Kpol_543.64       D-------IEINSHFSSDEDEVDNKDISEERTYQMK---YDFELDTKKVNEQTSPLYSVS
KAFR0B05730       -------------------------------FPSGN---DDSKLSDVDSDKNTETRISNH
KAFR0H02250       ---------------------------------------TGTIVHHIPREEDEEEEDSLD
KNAG0G02460       -------------------ADSVYGDDDDSEFSVSK---QREIVDSQKGELFIKDKFEQE
NDAI0G02570       DSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCK---LAQSAQNPDDDDDDEEEEDDK
NCAS0C03250       SFEADGFTDLERQNGIVRSTDHNNNSNNNNVLPMKKNQVDEKSIDEDDDGDDEDKEQDPA
NDAI0J01010       ----------------------------NIHSHSNE---DDDDHDHDKDSVDIKNKHTTT
NCAS0B03580       --------------------------------------------DEKDSSDTISKDSSYD
Suva_10.223       VPSSEYTIGNLHSDTASFNDEAVYSIHNNKNSYTAK---NEELVATSVKEKE--SDMLK-
Skud_12.199       IASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTR---NEEIVGTPVKEKDPNSNVIN-
YLR130C           APSSGFVIRNMDSDPVSFNNEAAYSIHNDKTPYTTR---NEEIVATPIKEKEPGSNVTN-
Smik_12.193       VPSSDLAVSNIDSQPASFNNEAVYFIHNNKTPYTTR---NEEIGATPIKEKEPSSNITN-
                                                                              

CAGL0E01353g      -VAQQKVRNDSNENDSLVG-HVHNTTVDPL-EHMPGHNHFS---HDEVHQ---DITQIGS
CAGL0M04301g      SKKIETGVSTNLKRVDD--------------SGFEGQYEYK---RESTDETWIDENTLTT
KLLA0D16434g      --EENVSLTVANNNNGAEI-----TATNPH-PSMPGSNHFS---HDKSHQ---DLATIGT
TBLA0H01270       -QEENSATTYIDSKNKDEK-KAADVQINEH-LQYDSQEKTVDLENSISHH---D------
KNAG0A05180       -LRFEVNSNSAPEEDIEENPHTILGNSDKM-ASMPGKGHYD---HAVFHQ---DPAQLGS
SAKL0H15510g      -GYFKDDEELRCSASQGVS-RKSDRKPSV---SVPGKDHFS---HEQDHQ---DLSQLGT
TPHA0A01550       -YDIEANHYEVSMEDRNNT-KMDNYKISQT-KSTPGQDHFS---HDSEHQ---DLVQLGT
Kpol_543.64       -SYAQVG--TSSSKNSILP-KETNIKLKQL-ESIPGKNHYS---HDKNHQ---DPSQLGT
KAFR0B05730       -RDIESGSFIRDAGPTSGN------------SFIPGRDHYS---HDAVHQ---DPSQLGT
KAFR0H02250       -EDFKKGDIESQTSPDIRT-----HKLDRL-ASILGKDHFS---HDSTHQ---DPSQLGT
KNAG0G02460       -VDLSQGITTVPSTRDYAN-----LTSTELEPTIPGKDHFA---HDTEHQ---DPSQLGT
NDAI0G02570       -LKEEKEREALQDRQNISGNNKNNDNMTRF-NSIPGKDHFS---HDTDHQ---DQTQLGT
NCAS0C03250       SNDLASSSRINNNDNLVNT----NTNISRFVSSVPGKDHFG---HDDVHQ---DSSQIGT
NDAI0J01010       NNDLESLQSTSPGIIGLATFTRSHDNVNKQ-MGTIGSNHYD---HALVHQ---DPGQMGT
NCAS0B03580       -SDLEANQVIPVN------------------DSRPGKQHFS---HEEDHQ---DAIQIGT
Suva_10.223       -YDLEVGKTESIANGIVPS----SSHMSNF-ASVPGKDHYS---HENDHQ---DASQLGT
Skud_12.199       -YDLETGNTESIANGLIPM----NSHATNL-TSVPGKDHYS---HENYHQ---DASELGK
YLR130C           -YDLEPGKTESLANELVPT----SSHATNL-ASVPGKDHYS---HENDHQ---DVSQLAT
Smik_12.193       -YDLEAGNTESIANELFPM----SSHATNI-PSVPGKDHFS---HENDHQ---DASQLGT
                                                     .        .        *      

CAGL0E01353g      KANDQQ-KEQYLNQLTSLFILEFGILFHSVFVGLSLSVSG-DEFKTLFVVIVFHQMFEGM
CAGL0M04301g      GNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAG-SEFKVLFIVITFHQMFEGL
KLLA0D16434g      PAQMTS-KEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGM
TBLA0H01270       GMTRAE-REQYLNQLVAVMVLEAGVIVHSVFIGLSLAVTG-DNFVTLFIVLTFHQMFEGL
KNAG0A05180       PLEEPN-KEKYANQIMAVLFLEFGILFHSVFIGLSLAVAG-DEFKTLFIVLVFHQMFEGL
SAKL0H15510g      LVRQKE-REQYLSQVFAVFILEFGVVFHSVFVGLSLAVAG-DEFNTLFIVLVFHQMFEGL
TPHA0A01550       PVEQLD-KEKYMGQIVSVIILEFGVIFHSIFTGLSLAVSG-DEFETLFIVLVFHQMFEGL
Kpol_543.64       PVEEID-KEQYLGQIVGVTILEIGVIFHSIFVGLSLAVSG-EEFITLFIVLVFHQMFEGL
KAFR0B05730       PAESSD-KENYANQIFAVSILEFGIVFHSVFIGLSLAVAG-EEFKTLFVVLIFHQMFEGL
KAFR0H02250       STEEFQ-KEQYLNQIVALFILESGIIFHSIFIGLSLAVTG-AEFKTLFIVLTFHQMFEGL
KNAG0G02460       PVQEQD-KEQYLNQIVAVTILEAGIIFHSVFVGLSLSVSG-EEFETLFIVLTFHQMFEGL
NDAI0G02570       PIEEED-KEQYLNQMFAVFILEFGIIFHSVFVGLSLSVSG-EEFETLFIVLTFHQMFEGL
NCAS0C03250       PVEEEN-KEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSG-EEFETLFIVLIFHQMFEGL
NDAI0J01010       SLNDSA-KEQYANQLLAVTILEFGIVFHSVFIGLSLAVSG-EEFTTLFIVLIFHQMFEGL
NCAS0B03580       PANDKA-KEQYTNQVFAVFILEFGILFHSIFIGLSLAVSG-DEFHTLFIVLIFHQMFEGL
Suva_10.223       QIEEED-KEQYINQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
Skud_12.199       GIEEED-KEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
YLR130C           RIEEED-KEQYLNQILAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
Smik_12.193       RIEEED-KEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
                           .* .::  : .** *::.**:* **:*:*:*  :* .**:*: *******:

CAGL0E01353g      GLGARITECYWPHS--KRWLPYLLGFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVF
CAGL0M04301g      GLGTRIAETEWPPS--KWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVF
KLLA0D16434g      GLGARIAEVSWAKK--HRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCF
TBLA0H01270       GLGTRVAETPWPKS--KRMTPWLMALAFTLTTPVAVAIGLGVRNSWVPGSRTSLIANGIF
KNAG0A05180       GLGTRIAETKWPEN--RRLTPWMLALGFTLTTPVAIAIGLGVRHSFIPGSRKALVSNGVF
SAKL0H15510g      GLGTRIAETTWPAS--KRYTPWLLGLGYTLSTPIAIAIGIGVRHSFAPGSKKALITNGVF
TPHA0A01550       GLGTRIAETNWPKS--KKNTPWLLALGFTISTPIAIGIGIGVRYTFIPGSRTALITNGIF
Kpol_543.64       GLGTRLAEANWPHS--KRYTPWLMALGFTLTTPIAIAIGIGVRYSWIPGSRKSLIANGVF
KAFR0B05730       GLGTRLAETNWPKS--KKLTPWIMALGYSITTPISTAIGIGVRHSFLPESRKALIVNGVF
KAFR0H02250       GLGTRISEANWPQS--KKYIPWLMGLAFALTTAIAVAIGIGVRHSWVPGSRNALIASGIF
KNAG0G02460       GLGTRVAETNWPEN--RKNTPWLMGLAFMLTSPIAVAIGIGVRHSWVPGSRKSLIANGVF
NDAI0G02570       GLGTRVAETNWPSN--RRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVF
NCAS0C03250       GLGTRVAETNWPKS--KRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVF
NDAI0J01010       GLGTRLAEVPWDKS--KRFTPWLMALGFSLTTPIAIAIGLGVRHSFVPTSRRALISNGCF
NCAS0B03580       GLGTRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIGLGVRHSWVPGSRRALIANGVF
Suva_10.223       GLGTRVAETNWPDS--KRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGIF
Skud_12.199       GLGTRVAETNWPES--KRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVF
YLR130C           GLGTRVAETNWPES--KKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGVF
Smik_12.193       GLGTRVAETNWPES--KRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRKALIANGVF
                  ***:*::*  *  .  ..  *:::. .: : :.:: .:*:*** :: * *. :*: .* *

CAGL0E01353g      DAISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFVMALGAGLMALLGRWA
CAGL0M04301g      DSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA
KLLA0D16434g      DAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA
TBLA0H01270       DAISAGILIYTGLVELMAHEFLYSGQFKGENGLKQMLSAYFVMCCGAALMALLGKWA
KNAG0A05180       DSISSGILIYTGLVELMAHEFLYSNQFNGADGFKKMILAYVIMCFGVGLMALLGKWA
SAKL0H15510g      DSISAGILIYTGLVELMAHEFLYSQQFKGEGGCKRMIGAYFIMCLGAGLMALLGRWA
TPHA0A01550       DSISSGILIYTGLVELMAHEFLFSKQFSGRDGFKKMIFAYVIMCCGAALMALLGKWA
Kpol_543.64       DAISSGILIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAYFVMCCGAALMAVLGRWA
KAFR0B05730       DAFSAGILIYTGLVELMAHEFLYSSTFKQKDGLKRMLLAYLCMATGAGIMALLGKWA
KAFR0H02250       DSISAGILIYTGLVELMAHEFLYSNQFKGPDGFKRMLFAYFIMCCGAALMALLGKWA
KNAG0G02460       DAISSGILIYTGLVELMAHEFLFSNQFKGPGGLKKMLYAYFIMCLGAGLMALLGKWA
NDAI0G02570       DSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCLGAGLMALLGKWA
NCAS0C03250       DSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA
NDAI0J01010       DAISAGILIYTGLVELMAHEFLYSNQFKGENGFKKMISAYICMCFGAGLMALLGKWA
NCAS0B03580       DSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYAYFFMCCGAGIMALLGKWA
Suva_10.223       DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLRKMLSAYFIMCCGAALMALLGKWA
Skud_12.199       DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA
YLR130C           DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGAALMALLGKWA
Smik_12.193       DSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIMCCGAALMALLGKWA
                  *::*:***:*:**:*******:::  *.   . ..*: *:. *. *..:**:**.**

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0E01353g
------MDIVQLLFKR---DDDDGPPPA--------------CAVDNDFNGHTNLRILSV
FMVLISSAIGVYFPLLASRYSFINLPSWVFFIAKFFGSGVIVATAFIHLLEPASDSLGNP
CLGGTFANYPWAFGICLMALFALFLIEIVSHHYVGKT-MG-G-GHNHSHNMPTTFGQTHM
HGVEDDMVDEDGSS--STHSHSHVAMDDKYGDVVKN---NNYNYDDGSDDIESQKRPAFN
-VAQQKVRNDSNENDSLVG-HVHNTTVDPL-EHMPGHNHFS---HDEVHQ---DITQIGS
KANDQQ-KEQYLNQLTSLFILEFGILFHSVFVGLSLSVSG-DEFKTLFVVIVFHQMFEGM
GLGARITECYWPHS--KRWLPYLLGFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVF
DAISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFVMALGAGLMALLGRWA
>CAGL0M04301g
--------MHNELLGR--------SVDT--------------CSTENDYNGEQNLRILAV
FIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHLLQPAAEALTDD
CLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKK-FN----HSHAE-----------
-------------------TDNANALPDIILKDIQI---STDDLSEGMLNCAGHQDSLQD
SKKIETGVSTNLKRVDD--------------SGFEGQYEYK---RESTDETWIDENTLTT
GNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAG-SEFKVLFIVITFHQMFEGL
GLGTRIAETEWPPS--KWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVF
DSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA
>KLLA0D16434g
MLEAIAYAAAELLFKRQDVVTDGDTTEVDTHDHDEEDEDHVECESDNDYDGKDNMRVCAL
FIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGFIHLLEPAADALGEE
CLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKS-YGFQNDHVHSH-----------
-------------------------------FPSSK---DQKSLEDEDDEDSDKYNQVVD
--EENVSLTVANNNNGAEI-----TATNPH-PSMPGSNHFS---HDKSHQ---DLATIGT
PAQMTS-KEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGM
GLGARIAEVSWAKK--HRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCF
DAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA
>TBLA0H01270
--MLDAQTLLDVIVKRHGADDDSDHVPA--------------CETSNDYDGRMNLRILSV
FILLISSGIGVNFPILASQYSFIRLPKWCFFIAKFFGSGVIIATAFVHLLEPAADALGNA
CLGGTFAEYPWAFGICLMSLFFLFFTEIISHHIIDQR-LA-K-EHGHGH-----------
---------------------------DEEHAAIER---VDTIECCEENSCDEEPNPMVI
-QEENSATTYIDSKNKDEK-KAADVQINEH-LQYDSQEKTVDLENSISHH---D------
GMTRAE-REQYLNQLVAVMVLEAGVIVHSVFIGLSLAVTG-DNFVTLFIVLTFHQMFEGL
GLGTRVAETPWPKS--KRMTPWLMALAFTLTTPVAVAIGLGVRNSWVPGSRTSLIANGIF
DAISAGILIYTGLVELMAHEFLYSGQFKGENGLKQMLSAYFVMCCGAALMALLGKWA
>KNAG0A05180
-----MDPITFLLFKR---DDDSGPAPA--------------CADTNEYDGRSNLRILSI
FIILISSAMGSFFPILSSKYSFIRLPDWCFFLAKFFGSGVIVATAFVHLLQPANEALTDE
CLTGTFQSYPWAFGICLMSLFLLFLMELVSHYLIAKT-FG-HAAHDHSD-----------
-----------------------------FGNFVRK---DSKELIDESDSESLHKGS---
-LRFEVNSNSAPEEDIEENPHTILGNSDKM-ASMPGKGHYD---HAVFHQ---DPAQLGS
PLEEPN-KEKYANQIMAVLFLEFGILFHSVFIGLSLAVAG-DEFKTLFIVLVFHQMFEGL
GLGTRIAETKWPEN--RRLTPWMLALGFTLTTPVAIAIGLGVRHSFIPGSRKALVSNGVF
DSISSGILIYTGLVELMAHEFLYSNQFNGADGFKKMILAYVIMCFGVGLMALLGKWA
>SAKL0H15510g
----------MQFSAR------DDEVDV--------------CDNDNEYDGRDSLRILAV
FMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKFFGSGVIVATGFIHLLKPATDNLGNT
CLGGTFADYPWAFGICLMSLFALFFSEIITHHFFIKA-NG-NSDHTNSH-----------
----------------SHFGEPNHTTHQQFPDESEK---KD-DEEEADVECAAEYIPLKV
-GYFKDDEELRCSASQGVS-RKSDRKPSV---SVPGKDHFS---HEQDHQ---DLSQLGT
LVRQKE-REQYLSQVFAVFILEFGVVFHSVFVGLSLAVAG-DEFNTLFIVLVFHQMFEGL
GLGTRIAETTWPAS--KRYTPWLLGLGYTLSTPIAIAIGIGVRHSFAPGSKKALITNGVF
DSISAGILIYTGLVELMAHEFLYSQQFKGEGGCKRMIGAYFIMCLGAGLMALLGRWA
>TPHA0A01550
-----MSSQFIELVLR-----DGDSTDT--------------CDTQSSYNGSTNMRVLAL
FIILISSGLGSFFPILASTYSFIRLPDCCFFVAKFFGSGVIVATAFIHLLDPAVEALSNT
CLGGTFTEYPWAFGICLMSLFLLFLIEIMTHHMLTHDEHG-DGGHSHGD-----------
--------------DTSYTASSIDDKEADSIDADVR---KDANDDSYDINSILNFDKNKD
-YDIEANHYEVSMEDRNNT-KMDNYKISQT-KSTPGQDHFS---HDSEHQ---DLVQLGT
PVEQLD-KEKYMGQIVSVIILEFGVIFHSIFTGLSLAVSG-DEFETLFIVLVFHQMFEGL
GLGTRIAETNWPKS--KKNTPWLLALGFTISTPIAIGIGIGVRYTFIPGSRTALITNGIF
DSISSGILIYTGLVELMAHEFLFSKQFSGRDGFKKMIFAYVIMCCGAALMALLGKWA
>Kpol_543.64
-------MDVLRLLVR----DTEGVVDT--------------CEATNDFDGRINLRVLSI
FMIMISSGLGVFFPLLASRYSFIRLPEWCFFIAKFFGSGVIVSTAFIHLLVPAAEALGND
CLGGTFVEYPWAFGICLMSLFLLFFTEIITHYFMSKS-LD-N-DHGDSGHSHSHFGNQNK
D-------IEINSHFSSDEDEVDNKDISEERTYQMK---YDFELDTKKVNEQTSPLYSVS
-SYAQVG--TSSSKNSILP-KETNIKLKQL-ESIPGKNHYS---HDKNHQ---DPSQLGT
PVEEID-KEQYLGQIVGVTILEIGVIFHSIFVGLSLAVSG-EEFITLFIVLVFHQMFEGL
GLGTRLAEANWPHS--KRYTPWLMALGFTLTTPIAIAIGIGVRYSWIPGSRKSLIANGVF
DAISSGILIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAYFVMCCGAALMAVLGRWA
>KAFR0B05730
---------MSELIPR----------DT--------------CQTSNDYNGSDNLRILAV
FMILISSALGAFFPLLSSKYSFIKLPNWCFFIAKFFGSGVIVATAFIHLLEPASDALTND
CLGGTFADYPWAFGICLMSLFFLFFSEICSHYFILRA-YG-NEDHSH-------------
-------------------------------FPSGN---DDSKLSDVDSDKNTETRISNH
-RDIESGSFIRDAGPTSGN------------SFIPGRDHYS---HDAVHQ---DPSQLGT
PAESSD-KENYANQIFAVSILEFGIVFHSVFIGLSLAVAG-EEFKTLFVVLIFHQMFEGL
GLGTRLAETNWPKS--KKLTPWIMALGYSITTPISTAIGIGVRHSFLPESRKALIVNGVF
DAFSAGILIYTGLVELMAHEFLYSSTFKQKDGLKRMLLAYLCMATGAGIMALLGKWA
>KAFR0H02250
------MLSITELIPR--------AIDT--------------CSTSNDYDGNNNLRILSV
FILLISASIGVFFPILASRYSFINLPGWCFFIAKFFGSGVIVATAFIHLLEPASEELGDD
CLGGTFAEYPWAFGICLMSLFFLFLVEIISHYFVNKN-FG-H-DHGHDE-----------
---------------------------------------TGTIVHHIPREEDEEEEDSLD
-EDFKKGDIESQTSPDIRT-----HKLDRL-ASILGKDHFS---HDSTHQ---DPSQLGT
STEEFQ-KEQYLNQIVALFILESGIIFHSIFIGLSLAVTG-AEFKTLFIVLTFHQMFEGL
GLGTRISEANWPQS--KKYIPWLMGLAFALTTAIAVAIGIGVRHSWVPGSRNALIASGIF
DSISAGILIYTGLVELMAHEFLYSNQFKGPDGFKRMLFAYFIMCCGAALMALLGKWA
>KNAG0G02460
----MLDLAFAALLPR-----DDDDVVA--------------CAVSNSYNGHNGLRILAV
FIILISSGVGVFFPIMASRYSFIRLPDWCFFIAKFFGSGVIVATAFIHLLQPASEALGDP
CLGGTFAEYPWAFGICLMSLFMLFFTEIVSHHFISKS-LG-DSHESHGG-----------
-------------------ADSVYGDDDDSEFSVSK---QREIVDSQKGELFIKDKFEQE
-VDLSQGITTVPSTRDYAN-----LTSTELEPTIPGKDHFA---HDTEHQ---DPSQLGT
PVQEQD-KEQYLNQIVAVTILEAGIIFHSVFVGLSLSVSG-EEFETLFIVLTFHQMFEGL
GLGTRVAETNWPEN--RKNTPWLMGLAFMLTSPIAVAIGIGVRHSWVPGSRKSLIANGVF
DAISSGILIYTGLVELMAHEFLFSNQFKGPGGLKKMLYAYFIMCLGAGLMALLGKWA
>NDAI0G02570
---------MLELLAR-------DDAVV--------------CEISNDYNGHSGLRILAV
FIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAFIHLLDPAAEALGNE
CLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKS-FG-DEHHDHGN-NINSVHDDDA
DSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCK---LAQSAQNPDDDDDDEEEEDDK
-LKEEKEREALQDRQNISGNNKNNDNMTRF-NSIPGKDHFS---HDTDHQ---DQTQLGT
PIEEED-KEQYLNQMFAVFILEFGIIFHSVFVGLSLSVSG-EEFETLFIVLTFHQMFEGL
GLGTRVAETNWPSN--RRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVF
DSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCLGAGLMALLGKWA
>NCAS0C03250
--------MIDIILAR--------DVDT--------------CEVSNTYNGHAGLRILAI
FIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEALGNS
CLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS-FG---DHDHDGGHSNHHEDDIT
SFEADGFTDLERQNGIVRSTDHNNNSNNNNVLPMKKNQVDEKSIDEDDDGDDEDKEQDPA
SNDLASSSRINNNDNLVNT----NTNISRFVSSVPGKDHFG---HDDVHQ---DSSQIGT
PVEEEN-KEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSG-EEFETLFIVLIFHQMFEGL
GLGTRVAETNWPKS--KRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVF
DSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA
>NDAI0J01010
------------------------MTDT--------------CLNTNDFNGRTNIRILSI
FMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSGVIVATAFIHLLEPASDALGDP
CLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKA-FE-TVSHSASG-----------
----------------------------NIHSHSNE---DDDDHDHDKDSVDIKNKHTTT
NNDLESLQSTSPGIIGLATFTRSHDNVNKQ-MGTIGSNHYD---HALVHQ---DPGQMGT
SLNDSA-KEQYANQLLAVTILEFGIVFHSVFIGLSLAVSG-EEFTTLFIVLIFHQMFEGL
GLGTRLAEVPWDKS--KRFTPWLMALGFSLTTPIAIAIGLGVRHSFVPTSRRALISNGCF
DAISAGILIYTGLVELMAHEFLYSNQFKGENGFKKMISAYICMCFGAGLMALLGKWA
>NCAS0B03580
------------------------MTDT--------------CQAQNDYNGETNIRILSV
FMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSGVIVATAFVHLLQPASEALSDP
CLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKA-FS--------------------
--------------------------------------------DEKDSSDTISKDSSYD
-SDLEANQVIPVN------------------DSRPGKQHFS---HEEDHQ---DAIQIGT
PANDKA-KEQYTNQVFAVFILEFGILFHSIFIGLSLAVSG-DEFHTLFIVLIFHQMFEGL
GLGTRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIGLGVRHSWVPGSRRALIANGVF
DSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYAYFFMCCGAGIMALLGKWA
>Suva_10.223
---------MIDLLIR------DDSTDS--------------CQASNDYNGHSGLRILAV
FIILISSGLGVYFPILSSRYSFIRLPDCCFFIAKFFGSGVIVATAFIHLLQPAAEALGNE
CLGGTFAEYPWAFGICLISLFLLFFTEIITHYFVAKT-LG-H-DHGDHG---EVAAIDSR
VPSSEYTIGNLHSDTASFNDEAVYSIHNNKNSYTAK---NEELVATSVKEKE--SDMLK-
-YDLEVGKTESIANGIVPS----SSHMSNF-ASVPGKDHYS---HENDHQ---DASQLGT
QIEEED-KEQYINQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
GLGTRVAETNWPDS--KRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGIF
DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLRKMLSAYFIMCCGAALMALLGKWA
>Skud_12.199
---------MIDLVVR------DDSTDS--------------CQASNDYNGHAGLRILAV
FIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDE
CLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKT-LG-H-DHGDNE---GVGTVDAD
IASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTR---NEEIVGTPVKEKDPNSNVIN-
-YDLETGNTESIANGLIPM----NSHATNL-TSVPGKDHYS---HENYHQ---DASELGK
GIEEED-KEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
GLGTRVAETNWPES--KRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVF
DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA
>YLR130C
---------MVDLIAR------DDSVDT--------------CQASNGYNGHAGLRILAV
FIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDE
CLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKT-LG-H-DHGDHG---EVTSIDVD
APSSGFVIRNMDSDPVSFNNEAAYSIHNDKTPYTTR---NEEIVATPIKEKEPGSNVTN-
-YDLEPGKTESLANELVPT----SSHATNL-ASVPGKDHYS---HENDHQ---DVSQLAT
RIEEED-KEQYLNQILAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
GLGTRVAETNWPES--KKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGVF
DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGAALMALLGKWA
>Smik_12.193
---------MIDLIVR------DDSTDS--------------CQASNDYNGHAGLRILAV
FIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDE
CLGGTFAEYPWAFGICLMSLFLLFFTEIITHYYVAKT-LG-H-DHGDHG---ENTSIDVD
VPSSDLAVSNIDSQPASFNNEAVYFIHNNKTPYTTR---NEEIGATPIKEKEPSSNITN-
-YDLEAGNTESIANELFPM----SSHATNI-PSVPGKDHFS---HENDHQ---DASQLGT
RIEEED-KEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGL
GLGTRVAETNWPES--KRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRKALIANGVF
DSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIMCCGAALMALLGKWA