MUSCLE (3.8) multiple sequence alignment

KLLA0D16390g       ---------------------------MVKSYQRFEQSGLFGLISTSNQSIYLP-----A
AGL196C            ---------------------------MVKSYQRFEQADVFGVVTANSNCVWLP----SQ
CAGL0M04279g       ---------------------------MVKSYQRFEQANVFGVISSNSNSVWIEPEASKR
Ecym_4255          ---------------------------MVNSYQRFEQRSFFGVIASNSNCVWIP---TEG
TDEL0F04500        ---------------------------MVKSYQRFEQSASFGVISSNSNCVYIP----PA
TBLA0A03950        ---------------------------MVKSYQRFEQSSVFGVISSNSNCVWVP--PSSK
KNAG0G02450        ---------------------------MVKSYQRFEQSAVFGVISSEANNVWLP-PLKGR
ZYRO0F10406g       ---------------------------MVKSYQRFEQSSVFGVVSSGDNSIWIP--AENK
Kpol_1036.69       ---------------------------MVKSYQRFEQASVFGVISTNANCVWMS--PESK
TPHA0C00810        ---------------------------MVKSYQRFEQDSVFGVITTNANCVWLP--SSDS
KLTH0G12276g       ---------------------------MVKSYQRFEQASVLGVISSNSNCIWIP----AE
Kwal_56.23920      ---------------------------MVKSYQRFEQESVFGVISSNSNCLWLP----AE
KAFR0H02260        ---------------------------MVKSYQRFEQTSVFGVISSNSNSVWIP------
Suva_10.222        ---------------------------MVKSYQRFEQAAAFGVIASNANCVWIPASSRTN
Skud_12.198        ---------------------------MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTN
YLR129W            ---------------------------MVKSYQRFEQAAAFGVIASNANCVWIPASSGNS
Smik_12.192        ---------------------------MVKSYQRFEQSASFGVIASNANCVWLPASSRTK
SAKL0H15532g       ---------------------------MVKSYQRFEQGSAFGVISSNTNCVWIA----SR
NDAI0G02580        ---------------------------MVKSYQRFEQESVFGVINSNSNCIWLP--SDSN
NCAS0C03260        MLPYSVVLHIYIIHRPGKSYRDRNSINMVKSYQRFEQASVFGVISSNSNCVWLP--STSS
                                              **:*******   :*:: :  : :::       

KLLA0D16390g       TNSTSGKLITGALENIQIWTLKTNE-VEVLTDGL--PIGAVETN-ISKPSVVTAMCFHKE
AGL196C            AKNSPGQVITGALEEVKCWEIKTGELLKTMRDGL--PPGAIDTK-AEKPAEATYLQYHEE
CAGL0M04279g       KTGNLGQVIVGGLENILVWDIKTGEQIAQLTDGL--PPGASDAK-LSKPAETTFLKYHPE
Ecym_4255          SRTSPGQIITSSLENINCWDIKTGNLLKTLSDSI--PPGSIDAK-YEKPAEVAYLEYHHE
TDEL0F04500        NRKGLGQVLTGGLEKVNLWDLKTGDLVSCLSDGL--PPGSIDAK-STKPAETTYLEYHAE
TBLA0A03950        KSKSLGKVITGALENISVWDLKTSELEYVLSDGL--PPGSVDLK-SSKPAEVSYLQFHSE
KNAG0G02450        SSGSPGQIITSALENVNIWDIKTGELIAQLQDGI--TPGSADSKVNTKPAEVTFLQYHPD
ZYRO0F10406g       RTNGPGQIITGALENVNIWDIKTGELVSHLSDGL--PPGAIDAR-TTKPAEVTYMQYYSD
Kpol_1036.69       KSNSPGSVITSALENINIWDIKTGELISVLSDGL--PAGSIDVK-SSKPAEVSYLHYHDE
TPHA0C00810        RKSNVGQVLTGALENINLWDIKTGELLSVLSDGL--PPGSIDVK-SSKPAEVTYLEYHDE
KLTH0G12276g       TRNASGQVLTGALENVNCWSMKSGDLLSTLSDGL--PPGAVDAK-SSKPAETTFLQYHPE
Kwal_56.23920      NRNSTGQVLTGALENVNCWSMKSGELIGTLTDGL--PPGAVDAK-STKPAETSYLQYHPE
KAFR0H02260        NGNGPGNIITSALENINIWDIKTGELVNQLTDGL-PPPGSIDSK-LSKPASVTYFKYHED
Suva_10.222        NGSGPGQLITSALENVNIWDIKTGDLVTTLSDGL--PPGASDAK-GSKPAECTYLEVHQD
Skud_12.198        KGSGPGQLITSALENVNIWDIKTGDLLATLSDGL--PPGASDAR-GSKPAECTYLEVHED
YLR129W            NGSGPGQLITSALEDVNIWDIKTGDLVSKLSDGL--PPGASDAR-GAKPAECTYLEAHKD
Smik_12.192        SGSGPGQLITSALENVNVWDIKTGDLMSTLSDGL--PPGASDAR-GAKPAECTYLEVHQD
SAKL0H15532g       NRGSAGQILTGALENVNCWDIKTGELSKILTDGL--PPGAVDAK-STKLAESTYLQYHPE
NDAI0G02580        PSTSPGQIITSALENINIWDIKTGELSSHLIDSLIPPPGSIDAK-STKPAETTYLQHHKD
NCAS0C03260        KKSHPGQIITGALENVNIWDLKTGELASFLNDGLVPPPGSVDAK-SSKPAETTFLQHHKE
                        *.::...**.:  * :*:.:    : *.:  . *: : .   * :  : :  : :

KLLA0D16390g       TELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDL
AGL196C            TFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDL
CAGL0M04279g       TNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL
Ecym_4255          TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDL
TDEL0F04500        TNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKSAVTILKFDITGTRLISGSQDSNIIMWDL
TBLA0A03950        TGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL
KNAG0G02450        SSLLAVGYRDGNIKVWDLVSKTVLINLNGHKSSITVLKFDVNCTRLVSGSSDSNIIIWDL
ZYRO0F10406g       TSLLAVGYADGVIKIWDMFSKTVLLSFNGHRSAVTQLLFDSTGTRLISGSRDSNIIVWDL
Kpol_1036.69       TNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL
TPHA0C00810        TNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL
KLTH0G12276g       TKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAITVLKFDSTGTRLISGSKDSDIIVWDL
Kwal_56.23920      TRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDL
KAFR0H02260        TNLLAAGYSDGVIKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGSNDSDIIVWDL
Suva_10.222        TNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL
Skud_12.198        TDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL
YLR129W            TDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL
Smik_12.192        TDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL
SAKL0H15532g       TNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL
NDAI0G02580        TNLLAVGYNDGVIKVWDLYSKTVLCNLNGHSSAITVLKFDSTGTRLISGSRDSNIIVWDL
NCAS0C03260        TNLLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDL
                   : ::..** :* :*:**: ::::*  : .* : :* : :*   *.*:*.* *: :*:***

KLLA0D16390g       VGEVGLMKLRSHKDAITGIWI----------DHNMDWLISVAKDGLIKVWDLKAGGQCVE
AGL196C            VAETGLCKLRSHKDAITGIWC----------END-DWLISVSKDGLIKLWDMKV-HQCVE
CAGL0M04279g       VGESGLYKLRSHKDAITGLWC----------EDE-NWLISTSKDGLVKIWDLKS-QQCVE
Ecym_4255          VGEVGLCKLRSHKDSITGIWF----------END-DWLISTSKDGLIKVWDIKS-QQCVE
TDEL0F04500        IGEVGLYKLRSHKGAISGLWL----------EKD-EWLISTSRDGLIKVWDLKT-QQCVE
TBLA0A03950        VSEVGLYKLRSHKGTITGLWC----------DSD-NWLISTSKDGLIKVWDLKT-QQCIE
KNAG0G02450        VSEVGICKLRSHKDRISDLYV----------DDDFNWLLSVSKDGLIKVWDLKT-NQCVE
ZYRO0F10406g       VSEVGLYKLRSHKDSITGLSL----------PDE-NWLMSVSKDGLIKLWDLKI-QQCVE
Kpol_1036.69       VSEVGLYKLRSHKDAISGIWC----------EGE-DWLVSTSKDGLIKIWDLKV-QQCIE
TPHA0C00810        VSEVGVFKLRSHKDAITGIWC----------EGE-DWLVSTAKDGLIKLWDLKT-QQCVE
KLTH0G12276g       VGEVGLFKLRSHKDSITGLWC----------EGE-DWLVSTSKDGLIKVWDLKT-QQCVE
Kwal_56.23920      VGEVGLYKLRSHKDSITGLWC----------EGE-EWLISTSKDGLIKVWDLKV-QQCVE
KAFR0H02260        VSEVGLYKLRSHKDNITGIWC----------SDDENWLISTSKDGLIKVWDLKI-QQCVE
Suva_10.222        VGEVGLYKLRSHKDAITGFWC----------QGE-DWLVSTSKDGLIKIWDLKT-QQCIE
Skud_12.198        VGEVGLYKLRSHKDCITGIWC----------QGE-DWLISTSKDGMIKLWDLKT-QQCIE
YLR129W            VGEVGLYKLRSHKDSITGFWC----------QGE-DWLISTSKDGMIKLWDLKT-HQCIE
Smik_12.192        VGEVGLYKLRSHKDSITGFWC----------QGE-DWLISTSKDGMIKLWDLKT-QQCIE
SAKL0H15532g       VGEVGLYKLRSHKDSITGIWC----------ENE-DWLISTSKDGLIKIWDLKT-QQCVE
NDAI0G02580        VSEVGLYKLRSHKDAITGIWCNEMQNNGEDDENELDWLISTSKDGLIKIWDLKI-QQCIE
NCAS0C03260        VSEVGLYKLRSHKDAITGIWCNEVTNNNQ-EENELDWLISTSKDGLIKIWDLKI-QQCVE
                   :.* *: ******. *:.:              : :**:*.:.**::*:**:*   **:*

KLLA0D16390g       THMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSN---GEKISERGTFETESKQRG
AGL196C            THMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN---GSMLLEKGSYEKQSKQRC
CAGL0M04279g       THLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN---GSKLTEKGIIEKQSKQRG
Ecym_4255          THMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN---GSKLKEKGIYEKQSRQRS
TDEL0F04500        THIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEA---GSKLIEKGIYEKQSNQRG
TBLA0A03950        THIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP---GSKLIEKGAFEKQSKQRG
KNAG0G02450        THIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEV---GSKLIEKGVYEKQSKQRG
ZYRO0F10406g       THIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADA---GVKVTEKGIFEKQSKQRG
Kpol_1036.69       THIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEA---GSKLIEKGVYDKQSKQRG
TPHA0C00810        THIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN---GSKIVEKGTYEKQSKQRG
KLTH0G12276g       THVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPV---GSMLTERGTHEKQSKQRG
Kwal_56.23920      THVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESA---GSMLIEKGTHEKQSRQRG
KAFR0H02260        THIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPN--GSKLVEKGIFEKQSKQRG
Suva_10.222        THIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKM--GEKLTEMGIFEKQSKQRG
Skud_12.198        THIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKM--GEKLTEVGVFEKQSKQRG
YLR129W            THIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKM--GGKLTEMGIFEKQSKQRG
Smik_12.192        THIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKL--GGKLTEMGTFEKQSKQRG
SAKL0H15532g       THMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDM---GSKLIEKGIYEKQSKQRG
NDAI0G02580        THIAHTGECWSVAVRNDLLITTSSDSQIKIWELNLDNDDDGKNKKLIEKGIYEKQSKQRG
NCAS0C03260        THIAHTGECWSLAVRNDLVITTSSDSQVKFWQLSLQDDTVPNGSKLIEKGIYEKQSKQRG
                   **:*:  :**.:.:  :. :* .  .: *:* :. .      .  : * *  :.:*.** 

KLLA0D16390g       VSTEFI-TAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKRLRDKGASEEEIQEA
AGL196C            TELSFT-TVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQES
CAGL0M04279g       VEIDFA-VAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEIKEA
Ecym_4255          VDVKIV-TNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLKEKGISEDEIQEK
TDEL0F04500        SSIEFV-TTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLKEKGLSDEEIKQN
TBLA0A03950        LSIEFT-TTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTEKGMTEEDIKTN
KNAG0G02450        TSVKFI-ENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREKRLKEKGMEDEDIQQN
ZYRO0F10406g       VAVSFI-TVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFKEKGMTDEEIQQN
Kpol_1036.69       LDIKFS-VAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLKEKGMTDEEIQQN
TPHA0C00810        LSVNFK-TTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMKEKGSTDEQIQQY
KLTH0G12276g       VSVEFT-TISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLSDKGLTGEEIQAN
Kwal_56.23920      VAIQFT-TVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLTEKGLSEDEIQQN
KAFR0H02260        LSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKREKRLKEKGMTDDEIAQN
Suva_10.222        LKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKREKRLREKGLTDEEISKS
Skud_12.198        LKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKREKRLREKGLTDEEIARS
YLR129W            LKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKREKRLKEKGLTEEEIAKS
Smik_12.192        LKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKREKRLREKGLTDEEITKS
SAKL0H15532g       VSVEFI-TTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKIQQN
NDAI0G02580        LSIEFI-DTADETGFFYIQNADKTVEIFRLRKQDEINKAIKKRTKRLTEKGMTPEDIEQN
NCAS0C03260        LNVEFI-DSIDGVGFFLIQNADRTVEIFRLRKEEEISKALKKREKRLTEKGMTPDEIKKS
                      .:     .   *:   * *.: *  *:* . *: .. ..* **: :**   :.*   

KLLA0D16390g       VNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTIESYQIPYSKRDAEP
AGL196C            FRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQ
CAGL0M04279g       M-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQ
Ecym_4255          IKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQ
TDEL0F04500        IQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEYYTIPYEKREPKL
TBLA0A03950        ISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEYYSVPYEKRDPTS
KNAG0G02450        IKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNTIEYYTIAYEKREPTQ
ZYRO0F10406g       FKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEYYSIPYEKREPKH
Kpol_1036.69       IKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTS
TPHA0C00810        FIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEYYSIPYEKRLPKN
KLTH0G12276g       LKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDYYSIPYNKKEPKL
Kwal_56.23920      LKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYYSIKYQKREPTM
KAFR0H02260        VDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSNTIEYYSVTYAKRIPQP
Suva_10.222        IKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKRDPTS
Skud_12.198        IKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKREATS
YLR129W            IKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSNTIEYYSIPYEKRDPTS
Smik_12.192        IKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTS
SAKL0H15532g       IKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYSIPYQKREPTR
NDAI0G02580        IKDSYISLIMHPFQIVRSIYKIKAVTWTIATPSKLELCLTTSNNTIEYYSTPYEKREPTQ
NCAS0C03260        LEDSFVSMMMHPFQIIRSIYKVKAATWTIATSTKLELTVTTANNTIEYYSIPYEKREPTQ
                   .     . : : *. :.* :*..:  :     :*::.  :* .*::: *   * :. .  

KLLA0D16390g       PV--RRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCS
AGL196C            PTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCC
CAGL0M04279g       PAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTC
Ecym_4255          VAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCC
TDEL0F04500        PAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMCLRTFDCGYALCC
TBLA0A03950        PTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTC
KNAG0G02450        PAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRTKQCIRTFDCGYALTC
ZYRO0F10406g       PTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTCLRTFECGYALTC
Kpol_1036.69       PAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTC
TPHA0C00810        PSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSCIRTFDCGYALTC
KLTH0G12276g       PSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSCIRTFECGYALAC
Kwal_56.23920      PSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALAC
KAFR0H02260        PS--KIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLKTHKCIRTFECGYALCC
Suva_10.222        PAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTC
Skud_12.198        PAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSC
YLR129W            PAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTC
Smik_12.192        PAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTC
SAKL0H15532g       PAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTC
NDAI0G02580        PTPNKLHTIELQGQRTDIRSIDISDDNKLLATASNGLLKIWNIKTKSCIRTFECGYSLTC
NCAS0C03260        PIANKLYNVELQGQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTC
                       . :.::  * *:*:*:  :* *. **::**** **:**: *. *:* :.***:* .

KLLA0D16390g       QMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLDLTSNGKRLVTGSADKS
AGL196C            KFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKT
CAGL0M04279g       KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKT
Ecym_4255          KFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKT
TDEL0F04500        RFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSDGKKLVTGSADKS
TBLA0A03950        KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS
KNAG0G02450        KFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDLTSNGKRLVTGSADKT
ZYRO0F10406g       KFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSDGRRLVTGSADKT
Kpol_1036.69       KFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKT
TPHA0C00810        KFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKS
KLTH0G12276g       KFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSADKS
Kwal_56.23920      KFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKT
KAFR0H02260        KFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLDITSDGKRLITGSADKT
Suva_10.222        KFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT
Skud_12.198        KFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKT
YLR129W            KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT
Smik_12.192        KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT
SAKL0H15532g       KFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT
NDAI0G02580        KFLPGGTLVIVGTRGGELQLFDLASSTLLETIEDAHDAAIWSLDLTSDGKRLVTGSADKS
NCAS0C03260        KFLPGGMLVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKS
                   .:**.* * ::*.. *.::*:*:.:*  : . : **  ******:* :*..*:*.****:

KLLA0D16390g       CKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVK
AGL196C            VKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVK
CAGL0M04279g       VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVK
Ecym_4255          VKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVK
TDEL0F04500        VKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDKYFAISLLDNTVK
TBLA0A03950        IKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVK
KNAG0G02450        VKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISPEDKHLAVSLLDNTVK
ZYRO0F10406g       VKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENKLLAVSLLDNTVK
Kpol_1036.69       IKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVK
TPHA0C00810        IKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVK
KLTH0G12276g       VRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRLLAISLLDNTVK
Kwal_56.23920      VCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVK
KAFR0H02260        VKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLSPDDKFLAVSLLDYTVK
Suva_10.222        VKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVK
Skud_12.198        VKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVK
YLR129W            VKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVK
Smik_12.192        VKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVK
SAKL0H15532g       VKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVK
NDAI0G02580        VKFWDFQLEQELVAGTVDKYLPKLKLFHDTTLELNDDILSVKISPEDKFLAVSLLDNTVK
NCAS0C03260        VKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVK
                     ** * : :  : .  ..  . : : **:*::: :*: .: :* ::. :*:**** ***

KLLA0D16390g       VFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQD
AGL196C            VFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
CAGL0M04279g       VFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQD
Ecym_4255          VFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQD
TDEL0F04500        VFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDFGDCHKSLFAHQD
TBLA0A03950        VFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD
KNAG0G02450        IFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWGLDFGDCHKSLFAHQD
ZYRO0F10406g       VFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
Kpol_1036.69       VFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
TPHA0C00810        VFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
KLTH0G12276g       VFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGDCHKSLFAHSD
Kwal_56.23920      VFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHND
KAFR0H02260        IFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHAD
Suva_10.222        VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
Skud_12.198        VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
YLR129W            VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
Smik_12.192        VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
SAKL0H15532g       VFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQD
NDAI0G02580        VFFMDTMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
NCAS0C03260        VFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
                   :*:::::**:************:*:* *:*:::*.*******:**:******.*:*** *

KLLA0D16390g       SIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTS
AGL196C            SIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVS
CAGL0M04279g       SIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTG
Ecym_4255          AIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVS
TDEL0F04500        SIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALAISNNGKYVVSAS
TBLA0A03950        SIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVS
KNAG0G02450        SIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVWCLAMGLDGSFVVSTS
ZYRO0F10406g       SIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALAVARSGTCVISVS
Kpol_1036.69       SIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISAS
TPHA0C00810        SIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSS
KLTH0G12276g       SIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIAISHDGTFVVSAS
Kwal_56.23920      SIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFVVSAS
KAFR0H02260        SIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEVWSIAIADDSSFVVSSS
Suva_10.222        SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS
Skud_12.198        SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS
YLR129W            SIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSS
Smik_12.192        SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS
SAKL0H15532g       SIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTS
NDAI0G02580        SIMNVKFVPESHNFFSCSKDGLIKYWDGDKFECIQKLAGHQSEVWSIAIANDASFIVSSS
NCAS0C03260        SIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSS
                   :** * *   ::****..**. :* *** .*: :*** .*: *** :::  ..  .:* .

KLLA0D16390g       HDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQFLRDKNSGDDGVI--
AGL196C            HDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAFISNNGDETAG----
CAGL0M04279g       HDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLSVKKGDNEES----
Ecym_4255          HDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARNSEEDTDV----
TDEL0F04500        HDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRKDVGGDEADQ---
TBLA0A03950        HDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKGDVKNDED-----
KNAG0G02450        HDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDAFKKDSVDGEG-----
ZYRO0F10406g       HDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQDEKDDDH-----
Kpol_1036.69       HDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFKGDAEKVE------
TPHA0C00810        HDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKADIEDGM------
KLTH0G12276g       HDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHGDGNGGAEIG---
Kwal_56.23920      HDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEKDGNGDGEIT---
KAFR0H02260        HDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDSAFKSDTKGSEDE----
Suva_10.222        HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKGDATGENVE----
Skud_12.198        HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADDAFKGDAAGEDVE----
YLR129W            HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKADASGEGVE----
Smik_12.192        HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKGDATGESVD----
SAKL0H15532g       HDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQRDIEGRGEDGEIT
NDAI0G02580        HDHSIRIWEETEDEVFLEEEREKELEELYEDTLLTSLEEDNGDDAFKKDGGEDK------
NCAS0C03260        HDHSIRIWEETEDEVFLEEERDKEMEEQYEDTLLASLEEGNGDDAFKGDTKGATNVEF--
                   ** *:*:* **:*:******.:.* :*  *  ** :** . .*  :  .           

KLLA0D16390g       DEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKK-SGEP-----PM
AGL196C            VESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKK--LGDQ-----PT
CAGL0M04279g       EEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK-KGIQ-----PI
Ecym_4255          TEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK-SGDQ-----PM
TDEL0F04500        DEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHK-GDAK-----PV
TBLA0A03950        DEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ-RIDA-----PV
KNAG0G02450        DEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKK-IGSE----MPV
ZYRO0F10406g       DDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKK-QGVE-----PE
Kpol_1036.69       DESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP-----PI
TPHA0C00810        DESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK-AGEP-----PV
KLTH0G12276g       DEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKK-SGPH-----PG
Kwal_56.23920      DQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKR-SGPH-----PG
KAFR0H02260        DEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKKIGGDA-----PI
Suva_10.222        DEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK-LGEA-----PM
Skud_12.198        DEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK-LGEA-----PM
YLR129W            DEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK-LGEA-----PI
Smik_12.192        DEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK-LGEA-----PI
SAKL0H15532g       DQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK-SGEP-----PS
NDAI0G02580        DEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEEYERELKNWQRKD-SNNKATQTVPI
NCAS0C03260        DEATDVHKQTMESLKAGERLMEAFDLGMAEIESFEEYDKNLKLWQRKK-TGEP-----PI
                    :   * :** ****:.*.:::*:::*.  :     :      ::.            * 

KLLA0D16390g       KPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIMKQKDLV
AGL196C            KPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVIL
CAGL0M04279g       RPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTKAALL
Ecym_4255          KPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQLV
TDEL0F04500        KPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLDNRIL
TBLA0A03950        KPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNIL
KNAG0G02450        KPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVLKNKKML
ZYRO0F10406g       RPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKKLL
Kpol_1036.69       KPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKKMT
TPHA0C00810        KPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEIL
KLTH0G12276g       RPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIEDKSLV
Kwal_56.23920      KPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKEKELA
KAFR0H02260        KPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIVLNDPKVL
Suva_10.222        KPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVMQNKTLL
Skud_12.198        KPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLL
YLR129W            KPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLL
Smik_12.192        KPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIMQNKSLL
SAKL0H15532g       KPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKDKKMQ
NDAI0G02580        KPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLVLPFSYIIKFLKFIDIVINSKKIL
NCAS0C03260        KPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLPFSYVLKFLKFINIVIGNKKML
                   .*  *::* *:   *  *:::.*  *. :*:**::: :**:*:: ::.* :       : 

KLLA0D16390g       LLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGFNIAGLN
AGL196C            HKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGLK
CAGL0M04279g       QKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNIEGMK
Ecym_4255          NNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGLK
TDEL0F04500        QHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNIEGLK
TBLA0A03950        NNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGLK
KNAG0G02450        HNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGFNIQGLK
ZYRO0F10406g       HNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEGLK
Kpol_1036.69       KNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQGLK
TPHA0C00810        KNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGLK
KLTH0G12276g       RRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNIQGLK
Kwal_56.23920      RRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNIQGLT
KAFR0H02260        NNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLGYNIQGLK
Suva_10.222        HNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGFNVQGLK
Skud_12.198        HSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGFNVQGLK
YLR129W            HSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGFNVQGLK
Smik_12.192        HSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGFNVQGLK
SAKL0H15532g       NNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNVQGLK
NDAI0G02580        NNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRVKDNLRNALKNNEDDLGFNIQGLK
NCAS0C03260        NNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKNELRNALKANEDDLGFNIQGMK
                      : *:*. *: ::. * .**.:*.*  ** .:  :*  :*  :.   * **:*: *:.

KLLA0D16390g       FIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETVR
AGL196C            FVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF-
CAGL0M04279g       FIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA
Ecym_4255          FIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV-
TDEL0F04500        FIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETIV
TBLA0A03950        FIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEY--SVP
KNAG0G02450        FIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV
ZYRO0F10406g       FIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETLS
Kpol_1036.69       FIKQQWNLKHNFDFTDDFD--KKEESSGKKRIFGTLS
TPHA0C00810        FIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTLA
KLTH0G12276g       FIKQQWNLKHNFEFSDDVIISKQDKK-VKKRVFETVV
Kwal_56.23920      FIKQQWNMKHNFEFSDDITVNKTNEK-AKKRVFETLV
KAFR0H02260        FIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV
Suva_10.222        FIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI
Skud_12.198        FIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI
YLR129W            FVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI
Smik_12.192        FIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV
SAKL0H15532g       FIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV
NDAI0G02580        FIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTII
NCAS0C03260        FIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV
                   *:..:*.: *: :: *:           .*     . 

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0D16390g
---------------------------MVKSYQRFEQSGLFGLISTSNQSIYLP-----A
TNSTSGKLITGALENIQIWTLKTNE-VEVLTDGL--PIGAVETN-ISKPSVVTAMCFHKE
TELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDL
VGEVGLMKLRSHKDAITGIWI----------DHNMDWLISVAKDGLIKVWDLKAGGQCVE
THMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSN---GEKISERGTFETESKQRG
VSTEFI-TAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKRLRDKGASEEEIQEA
VNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTIESYQIPYSKRDAEP
PV--RRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCS
QMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLDLTSNGKRLVTGSADKS
CKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVK
VFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQD
SIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTS
HDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQFLRDKNSGDDGVI--
DEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKK-SGEP-----PM
KPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIMKQKDLV
LLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGFNIAGLN
FIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETVR
>AGL196C
---------------------------MVKSYQRFEQADVFGVVTANSNCVWLP----SQ
AKNSPGQVITGALEEVKCWEIKTGELLKTMRDGL--PPGAIDTK-AEKPAEATYLQYHEE
TFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDL
VAETGLCKLRSHKDAITGIWC----------END-DWLISVSKDGLIKLWDMKV-HQCVE
THMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN---GSMLLEKGSYEKQSKQRC
TELSFT-TVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQES
FRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQ
PTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCC
KFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKT
VKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVS
HDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAFISNNGDETAG----
VESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKK--LGDQ-----PT
KPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVIL
HKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGLK
FVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF-
>CAGL0M04279g
---------------------------MVKSYQRFEQANVFGVISSNSNSVWIEPEASKR
KTGNLGQVIVGGLENILVWDIKTGEQIAQLTDGL--PPGASDAK-LSKPAETTFLKYHPE
TNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL
VGESGLYKLRSHKDAITGLWC----------EDE-NWLISTSKDGLVKIWDLKS-QQCVE
THLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN---GSKLTEKGIIEKQSKQRG
VEIDFA-VAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEIKEA
M-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQ
PAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTC
KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKT
VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTG
HDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLSVKKGDNEES----
EEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK-KGIQ-----PI
RPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTKAALL
QKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNIEGMK
FIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA
>Ecym_4255
---------------------------MVNSYQRFEQRSFFGVIASNSNCVWIP---TEG
SRTSPGQIITSSLENINCWDIKTGNLLKTLSDSI--PPGSIDAK-YEKPAEVAYLEYHHE
TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDL
VGEVGLCKLRSHKDSITGIWF----------END-DWLISTSKDGLIKVWDIKS-QQCVE
THMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN---GSKLKEKGIYEKQSRQRS
VDVKIV-TNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLKEKGISEDEIQEK
IKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQ
VAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCC
KFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKT
VKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQD
AIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVS
HDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARNSEEDTDV----
TEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK-SGDQ-----PM
KPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQLV
NNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGLK
FIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV-
>TDEL0F04500
---------------------------MVKSYQRFEQSASFGVISSNSNCVYIP----PA
NRKGLGQVLTGGLEKVNLWDLKTGDLVSCLSDGL--PPGSIDAK-STKPAETTYLEYHAE
TNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKSAVTILKFDITGTRLISGSQDSNIIMWDL
IGEVGLYKLRSHKGAISGLWL----------EKD-EWLISTSRDGLIKVWDLKT-QQCVE
THIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEA---GSKLIEKGIYEKQSNQRG
SSIEFV-TTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLKEKGLSDEEIKQN
IQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEYYTIPYEKREPKL
PAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMCLRTFDCGYALCC
RFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSDGKKLVTGSADKS
VKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDKYFAISLLDNTVK
VFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALAISNNGKYVVSAS
HDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRKDVGGDEADQ---
DEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHK-GDAK-----PV
KPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLDNRIL
QHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNIEGLK
FIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETIV
>TBLA0A03950
---------------------------MVKSYQRFEQSSVFGVISSNSNCVWVP--PSSK
KSKSLGKVITGALENISVWDLKTSELEYVLSDGL--PPGSVDLK-SSKPAEVSYLQFHSE
TGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL
VSEVGLYKLRSHKGTITGLWC----------DSD-NWLISTSKDGLIKVWDLKT-QQCIE
THIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP---GSKLIEKGAFEKQSKQRG
LSIEFT-TTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTEKGMTEEDIKTN
ISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEYYSVPYEKRDPTS
PTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTC
KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS
IKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVS
HDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKGDVKNDED-----
DEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ-RIDA-----PV
KPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNIL
NNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGLK
FIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEY--SVP
>KNAG0G02450
---------------------------MVKSYQRFEQSAVFGVISSEANNVWLP-PLKGR
SSGSPGQIITSALENVNIWDIKTGELIAQLQDGI--TPGSADSKVNTKPAEVTFLQYHPD
SSLLAVGYRDGNIKVWDLVSKTVLINLNGHKSSITVLKFDVNCTRLVSGSSDSNIIIWDL
VSEVGICKLRSHKDRISDLYV----------DDDFNWLLSVSKDGLIKVWDLKT-NQCVE
THIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEV---GSKLIEKGVYEKQSKQRG
TSVKFI-ENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREKRLKEKGMEDEDIQQN
IKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNTIEYYTIAYEKREPTQ
PAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRTKQCIRTFDCGYALTC
KFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDLTSNGKRLVTGSADKT
VKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISPEDKHLAVSLLDNTVK
IFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVWCLAMGLDGSFVVSTS
HDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDAFKKDSVDGEG-----
DEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKK-IGSE----MPV
KPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVLKNKKML
HNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGFNIQGLK
FIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV
>ZYRO0F10406g
---------------------------MVKSYQRFEQSSVFGVVSSGDNSIWIP--AENK
RTNGPGQIITGALENVNIWDIKTGELVSHLSDGL--PPGAIDAR-TTKPAEVTYMQYYSD
TSLLAVGYADGVIKIWDMFSKTVLLSFNGHRSAVTQLLFDSTGTRLISGSRDSNIIVWDL
VSEVGLYKLRSHKDSITGLSL----------PDE-NWLMSVSKDGLIKLWDLKI-QQCVE
THIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADA---GVKVTEKGIFEKQSKQRG
VAVSFI-TVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFKEKGMTDEEIQQN
FKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEYYSIPYEKREPKH
PTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTCLRTFECGYALTC
KFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSDGRRLVTGSADKT
VKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENKLLAVSLLDNTVK
VFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALAVARSGTCVISVS
HDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQDEKDDDH-----
DDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKK-QGVE-----PE
RPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKKLL
HNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEGLK
FIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETLS
>Kpol_1036.69
---------------------------MVKSYQRFEQASVFGVISTNANCVWMS--PESK
KSNSPGSVITSALENINIWDIKTGELISVLSDGL--PAGSIDVK-SSKPAEVSYLHYHDE
TNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL
VSEVGLYKLRSHKDAISGIWC----------EGE-DWLVSTSKDGLIKIWDLKV-QQCIE
THIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEA---GSKLIEKGVYDKQSKQRG
LDIKFS-VAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLKEKGMTDEEIQQN
IKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTS
PAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTC
KFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKT
IKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVK
VFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISAS
HDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFKGDAEKVE------
DESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP-----PI
KPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKKMT
KNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQGLK
FIKQQWNLKHNFDFTDDFD--KKEESSGKKRIFGTLS
>TPHA0C00810
---------------------------MVKSYQRFEQDSVFGVITTNANCVWLP--SSDS
RKSNVGQVLTGALENINLWDIKTGELLSVLSDGL--PPGSIDVK-SSKPAEVTYLEYHDE
TNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL
VSEVGVFKLRSHKDAITGIWC----------EGE-DWLVSTAKDGLIKLWDLKT-QQCVE
THIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN---GSKIVEKGTYEKQSKQRG
LSVNFK-TTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMKEKGSTDEQIQQY
FIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEYYSIPYEKRLPKN
PSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSCIRTFDCGYALTC
KFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKS
IKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSS
HDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKADIEDGM------
DESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK-AGEP-----PV
KPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEIL
KNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGLK
FIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTLA
>KLTH0G12276g
---------------------------MVKSYQRFEQASVLGVISSNSNCIWIP----AE
TRNASGQVLTGALENVNCWSMKSGDLLSTLSDGL--PPGAVDAK-SSKPAETTFLQYHPE
TKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAITVLKFDSTGTRLISGSKDSDIIVWDL
VGEVGLFKLRSHKDSITGLWC----------EGE-DWLVSTSKDGLIKVWDLKT-QQCVE
THVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPV---GSMLTERGTHEKQSKQRG
VSVEFT-TISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLSDKGLTGEEIQAN
LKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDYYSIPYNKKEPKL
PSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSCIRTFECGYALAC
KFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSADKS
VRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRLLAISLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGDCHKSLFAHSD
SIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIAISHDGTFVVSAS
HDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHGDGNGGAEIG---
DEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKK-SGPH-----PG
RPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIEDKSLV
RRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNIQGLK
FIKQQWNLKHNFEFSDDVIISKQDKK-VKKRVFETVV
>Kwal_56.23920
---------------------------MVKSYQRFEQESVFGVISSNSNCLWLP----AE
NRNSTGQVLTGALENVNCWSMKSGELIGTLTDGL--PPGAVDAK-STKPAETSYLQYHPE
TRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDL
VGEVGLYKLRSHKDSITGLWC----------EGE-EWLISTSKDGLIKVWDLKV-QQCVE
THVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESA---GSMLIEKGTHEKQSRQRG
VAIQFT-TVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLTEKGLSEDEIQQN
LKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYYSIKYQKREPTM
PSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALAC
KFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKT
VCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVK
VFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHND
SIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFVVSAS
HDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEKDGNGDGEIT---
DQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKR-SGPH-----PG
KPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKEKELA
RRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNIQGLT
FIKQQWNMKHNFEFSDDITVNKTNEK-AKKRVFETLV
>KAFR0H02260
---------------------------MVKSYQRFEQTSVFGVISSNSNSVWIP------
NGNGPGNIITSALENINIWDIKTGELVNQLTDGL-PPPGSIDSK-LSKPASVTYFKYHED
TNLLAAGYSDGVIKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGSNDSDIIVWDL
VSEVGLYKLRSHKDNITGIWC----------SDDENWLISTSKDGLIKVWDLKI-QQCVE
THIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPN--GSKLVEKGIFEKQSKQRG
LSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKREKRLKEKGMTDDEIAQN
VDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSNTIEYYSVTYAKRIPQP
PS--KIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLKTHKCIRTFECGYALCC
KFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLDITSDGKRLITGSADKT
VKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLSPDDKFLAVSLLDYTVK
IFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHAD
SIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEVWSIAIADDSSFVVSSS
HDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDSAFKSDTKGSEDE----
DEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKKIGGDA-----PI
KPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIVLNDPKVL
NNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLGYNIQGLK
FIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV
>Suva_10.222
---------------------------MVKSYQRFEQAAAFGVIASNANCVWIPASSRTN
NGSGPGQLITSALENVNIWDIKTGDLVTTLSDGL--PPGASDAK-GSKPAECTYLEVHQD
TNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL
VGEVGLYKLRSHKDAITGFWC----------QGE-DWLVSTSKDGLIKIWDLKT-QQCIE
THIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKM--GEKLTEMGIFEKQSKQRG
LKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKREKRLREKGLTDEEISKS
IKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKRDPTS
PAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTC
KFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT
VKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVK
VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS
HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKGDATGENVE----
DEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK-LGEA-----PM
KPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVMQNKTLL
HNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGFNVQGLK
FIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI
>Skud_12.198
---------------------------MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTN
KGSGPGQLITSALENVNIWDIKTGDLLATLSDGL--PPGASDAR-GSKPAECTYLEVHED
TDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL
VGEVGLYKLRSHKDCITGIWC----------QGE-DWLISTSKDGMIKLWDLKT-QQCIE
THIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKM--GEKLTEVGVFEKQSKQRG
LKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKREKRLREKGLTDEEIARS
IKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKREATS
PAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSC
KFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKT
VKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVK
VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS
HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADDAFKGDAAGEDVE----
DEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK-LGEA-----PM
KPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLL
HSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGFNVQGLK
FIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI
>YLR129W
---------------------------MVKSYQRFEQAAAFGVIASNANCVWIPASSGNS
NGSGPGQLITSALEDVNIWDIKTGDLVSKLSDGL--PPGASDAR-GAKPAECTYLEAHKD
TDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL
VGEVGLYKLRSHKDSITGFWC----------QGE-DWLISTSKDGMIKLWDLKT-HQCIE
THIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKM--GGKLTEMGIFEKQSKQRG
LKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKREKRLKEKGLTEEEIAKS
IKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSNTIEYYSIPYEKRDPTS
PAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTC
KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT
VKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVK
VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSS
HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKADASGEGVE----
DEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK-LGEA-----PI
KPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLL
HSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGFNVQGLK
FVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI
>Smik_12.192
---------------------------MVKSYQRFEQSASFGVIASNANCVWLPASSRTK
SGSGPGQLITSALENVNVWDIKTGDLMSTLSDGL--PPGASDAR-GAKPAECTYLEVHQD
TDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL
VGEVGLYKLRSHKDSITGFWC----------QGE-DWLISTSKDGMIKLWDLKT-QQCIE
THIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKL--GGKLTEMGTFEKQSKQRG
LKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKREKRLREKGLTDEEITKS
IKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTS
PAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTC
KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT
VKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVK
VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS
HDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKGDATGESVD----
DEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK-LGEA-----PI
KPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIMQNKSLL
HSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGFNVQGLK
FIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV
>SAKL0H15532g
---------------------------MVKSYQRFEQGSAFGVISSNTNCVWIA----SR
NRGSAGQILTGALENVNCWDIKTGELSKILTDGL--PPGAVDAK-STKLAESTYLQYHPE
TNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL
VGEVGLYKLRSHKDSITGIWC----------ENE-DWLISTSKDGLIKIWDLKT-QQCVE
THMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDM---GSKLIEKGIYEKQSKQRG
VSVEFI-TTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKIQQN
IKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYSIPYQKREPTR
PAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTC
KFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT
VKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVK
VFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTS
HDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQRDIEGRGEDGEIT
DQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK-SGEP-----PS
KPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKDKKMQ
NNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNVQGLK
FIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV
>NDAI0G02580
---------------------------MVKSYQRFEQESVFGVINSNSNCIWLP--SDSN
PSTSPGQIITSALENINIWDIKTGELSSHLIDSLIPPPGSIDAK-STKPAETTYLQHHKD
TNLLAVGYNDGVIKVWDLYSKTVLCNLNGHSSAITVLKFDSTGTRLISGSRDSNIIVWDL
VSEVGLYKLRSHKDAITGIWCNEMQNNGEDDENELDWLISTSKDGLIKIWDLKI-QQCIE
THIAHTGECWSVAVRNDLLITTSSDSQIKIWELNLDNDDDGKNKKLIEKGIYEKQSKQRG
LSIEFI-DTADETGFFYIQNADKTVEIFRLRKQDEINKAIKKRTKRLTEKGMTPEDIEQN
IKDSYISLIMHPFQIVRSIYKIKAVTWTIATPSKLELCLTTSNNTIEYYSTPYEKREPTQ
PTPNKLHTIELQGQRTDIRSIDISDDNKLLATASNGLLKIWNIKTKSCIRTFECGYSLTC
KFLPGGTLVIVGTRGGELQLFDLASSTLLETIEDAHDAAIWSLDLTSDGKRLVTGSADKS
VKFWDFQLEQELVAGTVDKYLPKLKLFHDTTLELNDDILSVKISPEDKFLAVSLLDNTVK
VFFMDTMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFVPESHNFFSCSKDGLIKYWDGDKFECIQKLAGHQSEVWSIAIANDASFIVSSS
HDHSIRIWEETEDEVFLEEEREKELEELYEDTLLTSLEEDNGDDAFKKDGGEDK------
DEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEEYERELKNWQRKD-SNNKATQTVPI
KPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLVLPFSYIIKFLKFIDIVINSKKIL
NNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRVKDNLRNALKNNEDDLGFNIQGLK
FIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTII
>NCAS0C03260
MLPYSVVLHIYIIHRPGKSYRDRNSINMVKSYQRFEQASVFGVISSNSNCVWLP--STSS
KKSHPGQIITGALENVNIWDLKTGELASFLNDGLVPPPGSVDAK-SSKPAETTFLQHHKE
TNLLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDL
VSEVGLYKLRSHKDAITGIWCNEVTNNNQ-EENELDWLISTSKDGLIKIWDLKI-QQCVE
THIAHTGECWSLAVRNDLVITTSSDSQVKFWQLSLQDDTVPNGSKLIEKGIYEKQSKQRG
LNVEFI-DSIDGVGFFLIQNADRTVEIFRLRKEEEISKALKKREKRLTEKGMTPDEIKKS
LEDSFVSMMMHPFQIIRSIYKVKAATWTIATSTKLELTVTTANNTIEYYSIPYEKREPTQ
PIANKLYNVELQGQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTC
KFLPGGMLVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKS
VKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVK
VFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD
SIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSS
HDHSIRIWEETEDEVFLEEERDKEMEEQYEDTLLASLEEGNGDDAFKGDTKGATNVEF--
DEATDVHKQTMESLKAGERLMEAFDLGMAEIESFEEYDKNLKLWQRKK-TGEP-----PI
KPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLPFSYVLKFLKFINIVIGNKKML
NNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKNELRNALKANEDDLGFNIQGMK
FIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV