MUSCLE (3.8) multiple sequence alignment

TBLA0A03930        ----------------------MMASDQTL-----------------KEFMSLANS-DLS
KLLA0D16346g       MFYFIFVSSFRVKKKAIYSRQNARASDHLLVDNNPSEISSYCVFIMEKEFMNLTGC-TYS
AGL194C            -------------------MQSNARQRELI-----------------REFLAVTSA-TSA
Ecym_4253          -------------------MQSNARQRKQI-----------------KQFMSITSM-NRA
KLTH0G12320g       ------------------------MRNQDI-----------------EEFIALTKA-SRS
Kwal_56.23914      ---------------MANAQLFMLQRDRDV-----------------EEFVALTKC-SKK
SAKL0H15576g       MVCQRIWLLDTTAELSYTNNLSMAQPKETI-----------------NEFMSLTNC-TKD
TPHA0C00820        -------------------------MDSIV-----------------REFQQLTSS-SNK
KNAG0G02440        ------------------------MEEDAI-----------------HDFIELTQCRDRK
ZYRO0F10362g       -------------------------MENLV-----------------ATFKSLAQC-SDR
KAFR0H02270        --------------------MVKSMEEEAI-----------------VHFIGFTQC-EPA
Smik_12.191        ------------------------------------------------------------
Suva_10.221        ------------------------------------------------------------
Skud_12.197        ------------------------------------------------------------
YLR128W            ------------MSNNKIKRKDASPEQEAI-----------------ESFTSLTKC-DPK
CAGL0M04257g       --------------------MVSRHEKELM-----------------KTFQSLTSCTDEG
Kpol_1036.68       -------------------------MPDIT-----------------EEFIGLTNC-DKK
TDEL0F04480        ----------------------MPQKDDLV-----------------SEFVSLTQC-ESK
NDAI0G02590        ------------------------------------------------------------
NCAS0C03270        ------------------------------------------------------------
                                                                               

TBLA0A03930        TAQKYLKRNKWRLEYALNDFYDN--EIGSFLIQDLARDNKILG----IEYVRPLTELYNH
KLLA0D16346g       VAQEYLRKNGGRVEYALNDYYDNVDTIGGMR----------------QSYNPSLVAIFEK
AGL194C            AAETYLERNHWSLDHALDDFYTQ--SGGGGRA---------------EQYSAELVATFER
Ecym_4253          TAEKFLNDNRWSLDYALDDLYTR--GTSYLNTE--------------RTYDAELYSTFQN
KLTH0G12320g       TARAYLSNNNWALEYALNDFYDT--VQGGFTS---------------RPPPPQLLTLFNE
Kwal_56.23914      IAQQFLSNNNWALDYALNDYYDT--VHGGFTTDD-------------RPYSPELLKVFQK
SAKL0H15576g       TATKYLSRNSWALSYALNEYYDK--KQGGFVNKKP------------VKYSHELVETFDK
TPHA0C00820        VARKYLSGNDWNLNYALNEFYDQ--ELGGFVHDVP------------REYPAELIELFER
KNAG0G02440        KAERYLRESHWNVNYALNDFYDK--EVGNFFSTYKDVPQDN------VVYPPELIHVFDQ
ZYRO0F10362g       TARDYLNTHNWDVNQALNDYYDSEHDQD-------------------QSYSPELPQLFRK
KAFR0H02270        MARKYLSKNRWNINYALNDFYDS--ELGGFTKEHERSNRR-------AVYPKELVQLFRD
Smik_12.191        ------------------------------------------------------------
Suva_10.221        ------------------------------------------------------------
Skud_12.197        ------------------------------------------------------------
YLR128W            VSRKYLQRNHWNINYALNDYYDK--EIGTFTDEVSTVAHP-------PVYPKELTQVFEH
CAGL0M04257g       KAKRYLSANNWNINYALNEYYDK--EVGGFTEDHMIRHQ--------FKYPDELVSLFGH
Kpol_1036.68       VATKYLKRNNWNLNYALNEYYDK--EVGSFLVEEEV-----------IEYPEELIQIFKK
TDEL0F04480        TAKDFLRRNQWKLEYALNDYYDQ--MPGGFIEEPHTP----------VTYPEELLALYDK
NDAI0G02590        MAKKYLSRNNWRLNYALNEYYDK--EIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKK
NCAS0C03270        ------------------------------------------------------------
                                                                               

TBLA0A03930        YAID-----------SGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSN
KLLA0D16346g       YSNG---------VSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQ
AGL194C            YAAG------------GAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQ
Ecym_4253          YASE-----------NGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQ
KLTH0G12320g       YKKG----------EEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEM
Kwal_56.23914      YKSE----------DKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDT
SAKL0H15576g       YADS-----------KRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQ
TPHA0C00820        YNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ
KNAG0G02440        YSEA------------GVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQ
ZYRO0F10362g       YAVV--------TPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQ
KAFR0H02270        YCSE-----------DTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDD
Smik_12.191        ------------------------------------------------------------
Suva_10.221        --------------------MDSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRET
Skud_12.197        --------------------MDSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRET
YLR128W            YINN------------NLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKRED
CAGL0M04257g       YAAL------IEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQ
Kpol_1036.68       YSND----------NGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQ
TDEL0F04480        YVLE----------DQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQ
NDAI0G02590        YSSK------NNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQ
NCAS0C03270        --------------------MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQ
                                                                               

TBLA0A03930        FIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLE-------------
KLLA0D16346g       FLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTD-------------
AGL194C            FLSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLD-------------
Ecym_4253          FLSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVD-------------
KLTH0G12320g       FVQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALE-------------
Kwal_56.23914      FIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALE-------------
SAKL0H15576g       FLSSWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVE-------------
TPHA0C00820        FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITE-------------
KNAG0G02440        FLAQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVE-------------
ZYRO0F10362g       FSYNWQQNGCTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALD-------------
KAFR0H02270        FLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDD-----------
Smik_12.191        ---------------MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLD-------------
Suva_10.221        FLSAWFMQGCSTLPNMKKCVKGLDAKLHEDLQYFTEIYDYTFHLILD-------------
Skud_12.197        FLSTWFMQGCSTLPDMQGCIKRLDVKLHEDLQYYTQVYDYAFRLILD-------------
YLR128W            FLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILD-------------
CAGL0M04257g       FLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLNA--------------
Kpol_1036.68       FLSTWYEQGCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRD-------------
TDEL0F04480        FLHNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALD-------------
NDAI0G02590        FLSNWYLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNI
NCAS0C03270        FLGNWFLQGCSDIAQMKQVLVDLNDKLHSDKQYFIDIYNYTFGLITD-------------
                                  :   :     .*  :  *   :*   : :                

TBLA0A03930        -----------------EGKKTIDSETAQEYWDLFFACQN--YP--IKVQSDQYQQWFKY
KLLA0D16346g       -----------------EGSRHLPKDVAIEYWNIFFKDNK--YA--LKISKERLNSWLEF
AGL194C            -----------------AGGRRLSVETAIAYWSLFFLDHT--YA--VTVPAPRLRSWFEF
Ecym_4253          -----------------GKRRQLSIDTAISYWTLLFLDHS--FA--TKIPRTRLESWFRF
KLTH0G12320g       -----------------PNEKQLDLETAIAYWHLLFPTDG-AYA--IQIPQKRLCSWTAF
Kwal_56.23914      -----------------PQQKQLGLETSIAYWELLFSPAK-PYA--IKVPQERLQSWIQY
SAKL0H15576g       -----------------ESERHLNIDTAAEYWELFFHNSH--YA--VTISDSRLKTWIEF
TPHA0C00820        -----------------ENMKSIQIDTAKEYWKLFFGDGT---P--LHIEKEQLDNWNKF
KNAG0G02440        -----------------PDQNKLDAASTIEYWKLFFDQEK-KYP--MIIDQELLDPWFVY
ZYRO0F10362g       -----------------PGAKTLETHTAVQYWTLFFATGQ--YP--VIVEQQFFQLWISF
KAFR0H02270        -----------------TRNQSIDMDIAIEYWKLFFLNES-IQS--VEISNELLSLWFQF
Smik_12.191        -----------------SYRKDIDINECIQYWKLFFRPE---YP--VSIEQNLLEAWFRF
Suva_10.221        -----------------TNRKDIDTEEAIQYWTLLFQPE---YP--IHMEPGLLEAWFRF
Skud_12.197        -----------------SNRKNIDIDDAIQYWTLFFQPV---YP--VHIESNLLESWFHF
YLR128W            -----------------PNRKDIDTDEGIQYWKLFFQPE---YP--VRMEPDLLEAWFRF
CAGL0M04257g       -----------------SKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKF
Kpol_1036.68       -----------------SNEKCIEKDMAIEYWKLFFSSK---CP--ITINELQLNSWIEF
TDEL0F04480        -----------------QNKRDLDTDTAAEYWRLFFQPGT---A--VHVNPALLNSWLAF
NDAI0G02590        GDDTTNSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNE-QYP--VKVNKELLSLWFQF
NCAS0C03270        ------------------PDKDLEVETAVAYWKLFLQPKEGEFP--VRVDPTLLNLWFQF
                                         :       ** :::       .    :       *  :

TBLA0A03930        LSNAN---IKE-ITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLEDNNK
KLLA0D16346g       INSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDK
AGL194C            LRAGD---HS--VSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVKGRNQ
Ecym_4253          LREQN---DANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIKERY-
KLTH0G12320g       LTRNV---SR--IHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLIDEYYEYLEEEGE
Kwal_56.23914      LSGEV---AK--VHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYLVARGD
SAKL0H15576g       YTKKS---GRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALG
TPHA0C00820        LTISG---KKT-ITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEENGK
KNAG0G02440        LGEQS---ENMSVTEDIWKMVYQFFNRFRSLGDVKQGYDEMAAWPILIDEFIEYLQDTVP
ZYRO0F10362g       VQQEQ-----S-ISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYIIDEFYEYLADKGE
KAFR0H02270        LADER---KKQ-VSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQDTGK
Smik_12.191        LHDEG---KMM-INKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYEYLQDQQ-
Suva_10.221        LHDEG---KRT-ITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLRD---
Skud_12.197        LRDEG---KTL-ISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQDH--
YLR128W            LRDEG---KTT-ISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ-
CAGL0M04257g       LQDEH---KKL-IHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNV
Kpol_1036.68       INVNE---IES-ITRDVWERLLEYFKKYPTLEILSKNYNELDPWPYIMDEYYEFLEDTKR
TDEL0F04480        LDSEQ---KTV-VTRDTWKMLLEFFKQFPSLSAVKTSYNEADAWPYIIDEYYEYLEDSRL
NDAI0G02590        LNEER---KKE-ITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGR
NCAS0C03270        LDEEN---KKF-ITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQDTNH
                               :  * *  .  :   :     .   *.   .**  :**:   :     

TBLA0A03930        I-
KLLA0D16346g       L-
AGL194C            L-
Ecym_4253          --
KLTH0G12320g       L-
Kwal_56.23914      V-
SAKL0H15576g       IL
TPHA0C00820        LN
KNAG0G02440        NF
ZYRO0F10362g       I-
KAFR0H02270        L-
Smik_12.191        --
Suva_10.221        --
Skud_12.197        --
YLR128W            --
CAGL0M04257g       L-
Kpol_1036.68       I-
TDEL0F04480        I-
NDAI0G02590        I-
NCAS0C03270        I-
                     

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A03930
----------------------MMASDQTL-----------------KEFMSLANS-DLS
TAQKYLKRNKWRLEYALNDFYDN--EIGSFLIQDLARDNKILG----IEYVRPLTELYNH
YAID-----------SGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSN
FIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLE-------------
-----------------EGKKTIDSETAQEYWDLFFACQN--YP--IKVQSDQYQQWFKY
LSNAN---IKE-ITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLEDNNK
I-
>KLLA0D16346g
MFYFIFVSSFRVKKKAIYSRQNARASDHLLVDNNPSEISSYCVFIMEKEFMNLTGC-TYS
VAQEYLRKNGGRVEYALNDYYDNVDTIGGMR----------------QSYNPSLVAIFEK
YSNG---------VSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQ
FLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTD-------------
-----------------EGSRHLPKDVAIEYWNIFFKDNK--YA--LKISKERLNSWLEF
INSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDK
L-
>AGL194C
-------------------MQSNARQRELI-----------------REFLAVTSA-TSA
AAETYLERNHWSLDHALDDFYTQ--SGGGGRA---------------EQYSAELVATFER
YAAG------------GAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQ
FLSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLD-------------
-----------------AGGRRLSVETAIAYWSLFFLDHT--YA--VTVPAPRLRSWFEF
LRAGD---HS--VSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVKGRNQ
L-
>Ecym_4253
-------------------MQSNARQRKQI-----------------KQFMSITSM-NRA
TAEKFLNDNRWSLDYALDDLYTR--GTSYLNTE--------------RTYDAELYSTFQN
YASE-----------NGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQ
FLSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVD-------------
-----------------GKRRQLSIDTAISYWTLLFLDHS--FA--TKIPRTRLESWFRF
LREQN---DANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIKERY-
--
>KLTH0G12320g
------------------------MRNQDI-----------------EEFIALTKA-SRS
TARAYLSNNNWALEYALNDFYDT--VQGGFTS---------------RPPPPQLLTLFNE
YKKG----------EEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEM
FVQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALE-------------
-----------------PNEKQLDLETAIAYWHLLFPTDG-AYA--IQIPQKRLCSWTAF
LTRNV---SR--IHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLIDEYYEYLEEEGE
L-
>Kwal_56.23914
---------------MANAQLFMLQRDRDV-----------------EEFVALTKC-SKK
IAQQFLSNNNWALDYALNDYYDT--VHGGFTTDD-------------RPYSPELLKVFQK
YKSE----------DKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDT
FIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALE-------------
-----------------PQQKQLGLETSIAYWELLFSPAK-PYA--IKVPQERLQSWIQY
LSGEV---AK--VHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYLVARGD
V-
>SAKL0H15576g
MVCQRIWLLDTTAELSYTNNLSMAQPKETI-----------------NEFMSLTNC-TKD
TATKYLSRNSWALSYALNEYYDK--KQGGFVNKKP------------VKYSHELVETFDK
YADS-----------KRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQ
FLSSWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVE-------------
-----------------ESERHLNIDTAAEYWELFFHNSH--YA--VTISDSRLKTWIEF
YTKKS---GRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALG
IL
>TPHA0C00820
-------------------------MDSIV-----------------REFQQLTSS-SNK
VARKYLSGNDWNLNYALNEFYDQ--ELGGFVHDVP------------REYPAELIELFER
YNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ
FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITE-------------
-----------------ENMKSIQIDTAKEYWKLFFGDGT---P--LHIEKEQLDNWNKF
LTISG---KKT-ITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEENGK
LN
>KNAG0G02440
------------------------MEEDAI-----------------HDFIELTQCRDRK
KAERYLRESHWNVNYALNDFYDK--EVGNFFSTYKDVPQDN------VVYPPELIHVFDQ
YSEA------------GVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQ
FLAQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVE-------------
-----------------PDQNKLDAASTIEYWKLFFDQEK-KYP--MIIDQELLDPWFVY
LGEQS---ENMSVTEDIWKMVYQFFNRFRSLGDVKQGYDEMAAWPILIDEFIEYLQDTVP
NF
>ZYRO0F10362g
-------------------------MENLV-----------------ATFKSLAQC-SDR
TARDYLNTHNWDVNQALNDYYDSEHDQD-------------------QSYSPELPQLFRK
YAVV--------TPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQ
FSYNWQQNGCTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALD-------------
-----------------PGAKTLETHTAVQYWTLFFATGQ--YP--VIVEQQFFQLWISF
VQQEQ-----S-ISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYIIDEFYEYLADKGE
I-
>KAFR0H02270
--------------------MVKSMEEEAI-----------------VHFIGFTQC-EPA
MARKYLSKNRWNINYALNDFYDS--ELGGFTKEHERSNRR-------AVYPKELVQLFRD
YCSE-----------DTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDD
FLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDD-----------
-----------------TRNQSIDMDIAIEYWKLFFLNES-IQS--VEISNELLSLWFQF
LADER---KKQ-VSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQDTGK
L-
>Smik_12.191
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLD-------------
-----------------SYRKDIDINECIQYWKLFFRPE---YP--VSIEQNLLEAWFRF
LHDEG---KMM-INKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYEYLQDQQ-
--
>Suva_10.221
------------------------------------------------------------
------------------------------------------------------------
--------------------MDSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRET
FLSAWFMQGCSTLPNMKKCVKGLDAKLHEDLQYFTEIYDYTFHLILD-------------
-----------------TNRKDIDTEEAIQYWTLLFQPE---YP--IHMEPGLLEAWFRF
LHDEG---KRT-ITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLRD---
--
>Skud_12.197
------------------------------------------------------------
------------------------------------------------------------
--------------------MDSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRET
FLSTWFMQGCSTLPDMQGCIKRLDVKLHEDLQYYTQVYDYAFRLILD-------------
-----------------SNRKNIDIDDAIQYWTLFFQPV---YP--VHIESNLLESWFHF
LRDEG---KTL-ISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQDH--
--
>YLR128W
------------MSNNKIKRKDASPEQEAI-----------------ESFTSLTKC-DPK
VSRKYLQRNHWNINYALNDYYDK--EIGTFTDEVSTVAHP-------PVYPKELTQVFEH
YINN------------NLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKRED
FLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILD-------------
-----------------PNRKDIDTDEGIQYWKLFFQPE---YP--VRMEPDLLEAWFRF
LRDEG---KTT-ISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ-
--
>CAGL0M04257g
--------------------MVSRHEKELM-----------------KTFQSLTSCTDEG
KAKRYLSANNWNINYALNEYYDK--EVGGFTEDHMIRHQ--------FKYPDELVSLFGH
YAAL------IEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQ
FLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLNA--------------
-----------------SKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKF
LQDEH---KKL-IHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNV
L-
>Kpol_1036.68
-------------------------MPDIT-----------------EEFIGLTNC-DKK
VATKYLKRNNWNLNYALNEYYDK--EVGSFLVEEEV-----------IEYPEELIQIFKK
YSND----------NGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQ
FLSTWYEQGCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRD-------------
-----------------SNEKCIEKDMAIEYWKLFFSSK---CP--ITINELQLNSWIEF
INVNE---IES-ITRDVWERLLEYFKKYPTLEILSKNYNELDPWPYIMDEYYEFLEDTKR
I-
>TDEL0F04480
----------------------MPQKDDLV-----------------SEFVSLTQC-ESK
TAKDFLRRNQWKLEYALNDYYDQ--MPGGFIEEPHTP----------VTYPEELLALYDK
YVLE----------DQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQ
FLHNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALD-------------
-----------------QNKRDLDTDTAAEYWRLFFQPGT---A--VHVNPALLNSWLAF
LDSEQ---KTV-VTRDTWKMLLEFFKQFPSLSAVKTSYNEADAWPYIIDEYYEYLEDSRL
I-
>NDAI0G02590
------------------------------------------------------------
MAKKYLSRNNWRLNYALNEYYDK--EIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKK
YSSK------NNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQ
FLSNWYLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNI
GDDTTNSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNE-QYP--VKVNKELLSLWFQF
LNEER---KKE-ITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGR
I-
>NCAS0C03270
------------------------------------------------------------
------------------------------------------------------------
--------------------MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQ
FLGNWFLQGCSDIAQMKQVLVDLNDKLHSDKQYFIDIYNYTFGLITD-------------
------------------PDKDLEVETAVAYWKLFLQPKEGEFP--VRVDPTLLNLWFQF
LDEEN---KKF-ITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQDTNH
I-