MUSCLE (3.8) multiple sequence alignment

KLLA0D16324g             ---MTKTDDELKLLHEKI-----LLNLASNLEEEVDMVLAWLNPT-----FQPQIPTLRI
KNAG0G02430              --------MSGHRMSSRHHLK--RYLATEQEQDDLERVMGWIHPQA----HACHPPSLRM
KAFR0H02280              -------MSDEQILH--------MMLPNAKFAEDLDRLLLWLSPAE----HQCKPPSLRI
NDAI0G02600              MTPLLDTDVDLSRITESI-----FVSIDPQYHPQLQTMLLWLNPNE-TTTQSATTMTIDL
NCAS0C03280              ----MSLDADLPTIITSLREQ-----VERQFHPQLESLLLWLDPNSSKGTRQNKPPTLEL
CAGL0M04235g             ----MILTGDTKTFKRAVLEYG-VNGNKNSNAEEWNVLLQWLDPAG-KKNHQLKPPNLLV
AGL193W                  ----MMYSQEAVGCQQQVVDA--VCTWDPSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRI
Ecym_4252                ----MTYAEELENYHLQLISA--LPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRI
TBLA0A03920              --MSLINELTLTDIKQQLKESSKLLSPYKDISDELETLLIWLDPNDPNSNHHLHPPTLQL
TPHA0C00830              -----MQYTEVDSIVGNIYEL--VDSKSCGSSDDIDSLLDWLNPNDPKSNHQLKPPTIRL
Smik_12.190              MSYQIAPTRDLKVITDELQTLS-SYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRI
YLR127C                  MSFQITPTRDLKVITDELQTLS-SYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRI
Suva_10.220              MTYQITPTRDLKIITDELQTLS-SYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRI
Skud_12.196              MSYQITPTRDLKVITDQLQTLS-SYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRI
SAKL0H15598g             ----MGSNAEIQELNAQLREF--VTTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRL
KLTH0G12342g             ----MTLSDEGRELSEQLHSL--LHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRV
Kwal_56.23909            ----MIQRDEGHVLSEQLHEL--LRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRL
Kpol_YGOB_Anc_8.321      ------------------------------------------------------------
TDEL0F04470              --MSECHSSELPVIIDSIKEV--ALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRL
ZYRO0F10340g             MNAVMRAGEDLKRLLVQIQEV--ALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRL
                                                                                     

KLLA0D16324g             KQCLKVVLE----------------------------QSDERTRFLIEQYYLTLIRTHFF
KNAG0G02430              KKAIRSVL-----------------------------GKASELDRQFKIYYIDVIKQEYL
KAFR0H02280              KKSIQRIRE--------------------------CFQLSSDFTNCLVKLYIDLIRFEFI
NDAI0G02600              KNCINIIVS--------------------------TYGKDDQIRLLFKKYYSFVIKLHFM
NCAS0C03280              KDCINLLRA--------------------------GYSQDEKFKMWLREYYLYVVKFHFM
CAGL0M04235g             KTMIEKLLL---------------------------GSNDYQLLSNIQDYYCWQCRVYFY
AGL193W                  KNSIRLLRL--------------------------GEQAPGTTVGLLRQCAVSQMRQHFF
Ecym_4252                KNSIKLLKL--------------------------DDAEQVFLLQLLRQWTLSQLRYHFF
TBLA0A03920              KTIIKQITPSSDIYK------------------DPSNSIKNNIQNWLKLFYVYQVRTYFF
TPHA0C00830              KKVIKKILLDVNTLG--------------------DYDSIETLNSLLRYYYIFQVRLNFF
Smik_12.190              KNIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFF
YLR127C                  KNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFF
Suva_10.220              KNIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFF
Skud_12.196              KNIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFF
SAKL0H15598g             KNGIKLVVN--------------------------NEDVPPGFVHLLRQFVLLQTRIHFF
KLTH0G12342g             KSAIKSLLN--------------------------GVVTSESFIDLLGKYMIFQTRKHFF
Kwal_56.23909            KSAIKILIN--------------------------ENGNGPALTDILRQYLIFQTRKHFF
Kpol_YGOB_Anc_8.321      ------------------------------------------------------------
TDEL0F04470              KDAIKLFVNQYYNSGYISG-----------SDGEINKGPEFELGNQLRQFYIYQVRIHFF
ZYRO0F10340g             KNSIKMLVNQYYNMELRED----------------ERDTGYLFIQLVRQFYVYQVRLHFF
                                                                                     

KLLA0D16324g             LQFD---DIVNWKDMIKLEKLYISKVEFM---FGTSVYWIKEEMISFKRLLMKKNNEFRK
KNAG0G02430              CD-Q---VKREFKHIQVLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDNLRN
KAFR0H02280              SYMKENANCLKFNDVLKLENRIEHPRLFI-PEL---EFEYFKNLHMLRHYLLDSDKSFKT
NDAI0G02600              KDNRPK-NMTSIREFHKLENLYLTPLRFTYDLI--DTNEMQSLINIFKRYLINNNFTFRK
NCAS0C03280              KNVD---EISVLKDFKLLEMIYIYPLQFM-DLV--DSTDISNLVKSFKHYLIDKNVTFRK
CAGL0M04235g             NEYK---RIETLNELKRIERHVLFPLKYI-PIFE-GNNRVENEVRLFGNYLLKTNKKVMS
AGL193W                  RHWE---RLEQYTDMVKLERYYEFPLRYV-AVF--TEDEVAAELVGLRKYLLNGNPGFRA
Ecym_4252                HNWE---SLMQYKDMLRLERYYEFPLKYV-GLF--TAEELSNELIGLRKYLLNRNSTFRN
TBLA0A03920              KKID---NIRQYKDMIKLEKYYQFPLQFI-PLF--TFQEWCFELLSLRHYILHQNKEFTQ
TPHA0C00830              SNLQ---SITYFKDIIKLEKYYEFPILHV-PIFLNNNYIWETELNKIRHYLLRTNLTFRS
Smik_12.190              SHFE---NINYLKDIQRWENYYEFPLRYV-PIFDLDINGWSLELNSLRHYLLNRNMKFKN
YLR127C                  LHFN---NINYLKDIQRWENYYEFPLRYV-PIFDVNVNDWALELNSLRHYLLNRNIKFKN
Suva_10.220              LHFS---SINYLKDIQRWENYYEFPLRYV-SIFDLNVNGWTLELNSLRHYLLNRNTKFKN
Skud_12.196              LRFN---DIIYLKDIQRWENYYEFPLRYV-PIFDLSVNDWSLELNSLRHYMLNRNIKFKN
SAKL0H15598g             SNFN---SITSFKDIQRLEKYYEFPLKYI-NIF--TPDEWFIEMNGFRHYLMSKNRIFGD
KLTH0G12342g             LNYQ---SLLYFKDVQKLERYYEFPTRYV-NIF--SSEEWCDEMSGLRNYLIRQNSGLKN
Kwal_56.23909            AHYY---SLCHFKDVQKLERYYEFPLRFV-RLF--NREEWAEEINGLRNYLISKNLVFNR
Kpol_YGOB_Anc_8.321      ------------------------------------------------------------
TDEL0F04470              TSFN---LIQTFKDIQRLEKYYVSPLAYI-HLFESSGYEWIIERDGLRHYLLNRNMEFHN
ZYRO0F10340g             ASLS---NLHTFKDVQRLVKYYEFPLKYV-YIFENCPEEWIGERDGLMHYLLNRHKKLRI
                                                                                     

KLLA0D16324g             QLHAKLESHIL-DNDLVRF------DQMYQWLAPAFDGQEI--EFNVRIINLKVDQMSQK
KNAG0G02430              SLVAEFETLMQ-DDDFESG------YQIIEWLYTANAKLLRPWNLALDTIVSKISTLCDN
KAFR0H02280              ALCTSIENLIM-EDDFYSA------TIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSG
NDAI0G02600              NVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDAN-GNVSPIDLLLDLLLRKIEKFCQR
NCAS0C03280              NLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSE-GVLSATDLILDASLTKIEIFARE
CAGL0M04235g             RAVERLRNRML-EDDFELA------TEIVDYFDYCQ---TDSTSIVLDIILDKIEQFCQL
AGL193W                  NMEARIRALILQDDDFETA------ARLYKWIVQGL-GHPMV-KFVIEVLTQKIALFCRN
Ecym_4252                NMESRIRVLILEEDDFEMS------SKLYKWMVQGL-GHPMV-KFVIDLLTNKIELFCKS
TBLA0A03920              KIILELRQLIK-EEDFETS------LDIVTWIREVD-SNLLSENFILDILLEKITLYCEQ
TPHA0C00830              NLINRLKKLVK-EDDFDLA------QEIIKWSNEANFSLLSSKQIILNALLDKITMYADK
Smik_12.190              NLRTRLDKLIM-DDDFDLA------DNLIQWLNSAD-GSLSSMELIVNALFNKINKFCED
YLR127C                  NLRTRLDKLIM-DDDFDLA------DNLIQWLKSAN-GSLSSTELIVNALYSKINKFCED
Suva_10.220              NLRTRLNKLII-DDDFDLA------SNLIRWLNSAN-GSLSSMDLIVNALFDKISMFCEI
Skud_12.196              NLRVRLNKLIM-DDDFDLA------GNLIRWLNFAN-GSLSSMELIVNALFNKIEKFCEA
SAKL0H15598g             NIKHRVRQLIM-EDDFDMA------WKIYTWLTETM-GHQLV-SLLLEILMDKIADFSKQ
KLTH0G12342g             NIQLRLEQLVH-EDDFDMA------CKIYEWLCQAE-GRLLP-EILVDVLLSKVKLFASK
Kwal_56.23909            NARLRLRQLVL-EDDFEMA------CKLYEWLCRAE-GRLLT-HLLVDAVLSKVKAFALK
Kpol_YGOB_Anc_8.321      ------------------------------------------------------------
TDEL0F04470              NMKQRMESLFM-QDDFEYV------AEMLDWVEKAH-TSLSSKDILLDLIIAKVKQFCDD
ZYRO0F10340g             NVVSRLKDLVM-EDDFDLA------MDVVKWLNESN-SNVSSMDLMLDLIVEKISRFCQD
                                                                                     

KLLA0D16324g             LMKNKIDDRYLVMNTYNHFIKDFWSKFSKLLII--------EDDHELTAIIYQSFEKNYI
KNAG0G02430              EMRRNWEAKFLVMNTFNKFINLYWSHLAKFLHLS-------EDNHDFTKVLYKCFEKEFV
KAFR0H02280              SIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCP-------ENDHELTKTVFKCFEREFI
NDAI0G02600              EMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFI
NCAS0C03280              QMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNI-------EDDHDLTNLIYQFFERQFI
CAGL0M04235g             HYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQ-------EDNHTITNTLYKYFEKQFI
AGL193W                  RMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPT------ADDPELNNLIYRCFEKKFI
Ecym_4252                RMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPN------EDDQELNNLIYRCFENKFI
TBLA0A03920              TMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCK-------EDNHKITNILFKYFEKQFI
TPHA0C00830              QFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCA-------EDDHEITKVLYKYFEKQFL
Smik_12.190              TMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCP-------EDDHELTTTVFNCFESNFL
YLR127C                  NMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCP-------EDDHELTTTVFNCFESNFL
Suva_10.220              NMSGVWNKRFMIMETFNKFINQYWSQFSELIGCP-------EDDHELTTTVFNCFESNFL
Skud_12.196              NMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-------EDDHELTTTVFNCFESNFL
SAKL0H15598g             NMMGKWTQRFLVMETFNTFITKYWSTFAQALRCP-------EDDHEITTEIFHCFEKEFV
KLTH0G12342g             NMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCM-------EDDHEITNEIYRCFEEEFI
Kwal_56.23909            HMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCP-------EDDHDVTNEIYRCFEEEFI
Kpol_YGOB_Anc_8.321      ------------------------------------------------------------
TDEL0F04470              HMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP-------QDDHGLTNVVYTCFEKQFI
ZYRO0F10340g             QMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP-------EDNHELTTVVYHLFERQFV
                                                                                     

KLLA0D16324g             KYKCDEFYTDIVPKFPASRKCLLELRSIL--------------NKDIKT------VGTKV
KNAG0G02430              RIRTEEIFEIVVESYQAAKTTILELRTFM--------------S-GYER------L-SKL
KAFR0H02280              NIRINEIFEIFTSAYPESKPTILELRKVM--------------K-APKD------L-QRL
NDAI0G02600              KIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLF
NCAS0C03280              KIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGR-RKDE------WSKKL
CAGL0M04235g             SIRTNEIFDICISNPASVQPTLLELRKEI--------------S-TVND------F-NCV
AGL193W                  ELKTQELFHQIIPKFPMSKPALLEMKSVI--------------KGDTAE------L-DRL
Ecym_4252                EMKTKELFDEIIPKFPLSKPSLLEMKSVI--------------KGATEE------L-DRL
TBLA0A03920              KIRIQEIFKICILSYPDTKPTLLELRNLL--------------V-TYNF------F-QKL
TPHA0C00830              RIRSEEIFDICVISYPDSKPTIMELRGLL--------------T-QSKI------S-TNI
Smik_12.190              RIRTKEIFDICVLAYPNSKVTLLELKKIM--------------K-DFKD------Y-ANI
YLR127C                  RIRTNEIFDICVLAYPDSKVTLLELRKIM--------------K-DFKD------Y-TNI
Suva_10.220              RIRTKEIFDICVLAYPGSKITLLELKKIM--------------K-DFKD------Y-TNI
Skud_12.196              RIRTREIFDICVLAYPDSKVALLELKKIM--------------K-DFKD------Y-TNI
SAKL0H15598g             KIRTSEIYEICVLEYPHSKPALLELRNVM--------------K-TSAD------Y-SKL
KLTH0G12342g             RIRTSQVFDIFVTGFPTTKPTLLELRSVL--------------K-TSVK------Y-TEL
Kwal_56.23909            RIRTQQAFKIFVTGYPESEPTLLELRSVL--------------K-TPAK------Y-TQL
Kpol_YGOB_Anc_8.321      ------------------------------------------------------------
TDEL0F04470              RIRTQEVFDIFVNEFPNSKPTIIEMRKLI--------------T-HSTD------F-KTI
ZYRO0F10340g             KLRTKEIFDIVVGVYPDSKPTLLELRRVL--------------V-KSKD------F-TQI
                                                                                     

KLLA0D16324g             LETLYHGFVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRP-D
KNAG0G02430              VNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRG-D
KAFR0H02280              TYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVKPYFQDKS-D
NDAI0G02600              VKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQLLTTIILTLKPLIQRRTTD
NCAS0C03280              LKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVE
CAGL0M04235g             VVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRK-D
AGL193W                  VAQIYNDFHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERS-D
Ecym_4252                VAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERS-D
TBLA0A03920              VVNFLSAFERIVLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERK-M
TPHA0C00830              LIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKS-D
Smik_12.190              VTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-H
YLR127C                  VTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-H
Suva_10.220              VTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-H
Skud_12.196              VTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERK-H
SAKL0H15598g             MIEFLSKFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERR-D
KLTH0G12342g             ITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERH-D
Kwal_56.23909            VTELLSQFEARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERR-D
Kpol_YGOB_Anc_8.321      ------------MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERN-D
TDEL0F04470              VIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERS-D
ZYRO0F10340g             VVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERN-D
                                     :   : *   :   :.  : :  :*     :  .    .  :  .   

KLLA0D16324g             IIKTLLLGIFPFQNNERFKIASSTDGSSV--HLEKLEQFSREV-----------G-DFSM
KNAG0G02430              AVQIILYAILDLRDVD---FEKMG-VSPV----KGLSELSHEL-----------REDPYV
KAFR0H02280              LINILLYAILDLKPKD---FEDLN-ISYI----PGLNKLSLDM-----------REDPEF
NDAI0G02600              IVNILLYAMLNLNEME---LHKLGCNIDF--DIESFNILVSELYPTIIKSMNQNQNNPSV
NCAS0C03280              MVDILLYALLNLKSKD---LIELN-CEKTTYDMRSIELLSKEL-----------S-NDHS
CAGL0M04235g             LVHLLLFSMLGLDETD---QLNTM-PSQV--SEEKLTALTNEL-----------K-DTEI
AGL193W                  LIISVLCAILELDSDE---IHEVISKNTLTENPQLLSQLSKEL-----------K-NSTA
Ecym_4252                LITTVLCAILELTKDE---IHEVISKNTLTENPQLLDQLSKEL-----------K-NSTA
TBLA0A03920              LAPILLHAILALPKID---LENAIYPIKV--SSISLKLIINEL-----------E-DPEL
TPHA0C00830              IIYILLFAILDLRTDD---IKTNP-IVKV--DQNLLKLLSEEL-----------R-ESHF
Smik_12.190              LVDLLLYAMLDLPEEE---LKEKI-TFKV--DIKALISLVDTL-----------H-DSDI
YLR127C                  LVNVLLYAMLDLPEEE---LKEKI-NFNV--DMKALLSLVDTL-----------H-DSDI
Suva_10.220              LVNVLLYAILDLPEEE---LKEKI-SFKV--DMKALLLLVETL-----------H-DSDI
Skud_12.196              LVNVLLYAMLDLPEEE---LKEKI-TFKV--DMKALLSLVDIL-----------H-DYDI
SAKL0H15598g             TVVHLLYAMLELDESE---IDDA--NVSL--NMPILTELSKEL-----------K-DPDF
KLTH0G12342g             TVATFLYAMLGLDASD---LSSKN-STST--HMSIASQLSAEL-----------R-GSHQ
Kwal_56.23909            TVVTFLYAMLGLDASE---TRGPK-PTGA--HASIASQLSAEL-----------K-DSHQ
Kpol_YGOB_Anc_8.321      LVSVLLYAILDLQSEN---FQEEA-QNIL--DADSLVILSDEL-----------R-DPEF
TDEL0F04470              LVVILLYAILDLQ------LDGLV-GSHIQVDPVCLKALASEL-----------R-DPEL
ZYRO0F10340g             LVTVLLYAILELQSEE---FEGPA-RAYL--DTNSLNQLSQEL-----------K-DPEF
                             .* .:: :                          :   :                 

KLLA0D16324g             GPELPTALPW-----------------FNQPHLPRCTYDGD----------------DQL
KNAG0G02430              NINAKCQTPT------PSPSKISSPHLNDSSSMDVDDKLDD---------GTTDLVYKQV
KAFR0H02280              SIENVEPNDN-----------NYKRTVPNLESIGANSLHDK-----------GTLIQDHI
NDAI0G02600              VPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLAR--------RKPETKPFFDL
NCAS0C03280              KHAGDVDYKK-------------------FSPEGTNEFENS------------TLPYEQV
CAGL0M04235g             CSYTEESDDV------------------VDPMIGSFSKEED------------SMVLEQV
AGL193W                  LTFHSMSTSK------------------GKAAIYSVAFERQ----------------DQL
Ecym_4252                LNFHSVTTIK------------------SKAAIYSVAQERQ----------------NPL
TBLA0A03920              GIENTSTKKN------SIKKFNEILSPKRFNNHNSSEYLPDLLQNTSSEDSNSTLLVQKV
TPHA0C00830              GINLNFSDVD------ISDNLENGNNNKNISQLDYAGQESS------------QLLYSQI
Smik_12.190              SQFTNVMKRN----KNKKGPFLWNLKVKGK---NGPSPTSQ------------TMIYQHI
YLR127C                  NQDTNITKRD----KNKKSPFLWNLKVKGKRELNKDLPIRH------------AMLYEHI
Suva_10.220              DQITNTPKSK---DKNKGGSFPWNLHVKGKKEKNGSSSITQ------------SMLYEHI
Skud_12.196              GQNTDAHKSK---DKNKRSPFLWNLKVKGKKETNEDPLARQ------------TMLYEHV
SAKL0H15598g             GIEDADSKSR---------------KNKLMVTDSSPVFKVE------------KPLCEQV
KLTH0G12342g             PISSSTAERG--------------NLPHGKHALSMNPYEPA---------------YQQI
Kwal_56.23909            PIFRSALDKS-----------------AQSPVDDMASVNPK------------EPVYQQV
Kpol_YGOB_Anc_8.321      GIEGELNIDL------------------DKNELTGQPSNKS---------GDSSLLYRQV
TDEL0F04470              GIENDIYPDD-----------NLANVATGMAKLNYEG----------------CLPYEEV
ZYRO0F10340g             GIESSFETIP-----------QADLLSRPASTATTAAMLDP------------RLPYKSV
                                                                                    :

KLLA0D16324g             LKQYLNWVPEPPRIKLDVEDFAD----------ND--GKYVPPVDLIHVLLDVLESKRTL
KNAG0G02430              LNQFXXRGHHET--NQGTRDYVG---------VNVKFSQRSNRTNLLDPLFELFDKKDEL
KAFR0H02280              MKQFMMWVPE-PNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIF
NDAI0G02600              FKQYLEWVP--P------MNKIY-DSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDLL
NCAS0C03280              YTDFLNWKPSIT----PISESSN----------DDEFASLGKNITPIDYVFNALESKDKL
CAGL0M04235g             IKRYMEWIPEVP------TSFGK-------------GILSDHKLDLFDILLELLESKETL
AGL193W                  VKQFLEWTPE-P------GPFTADDAKALNSD-DDGAETLELPKDVLEVVFQVFDSPEVL
Ecym_4252                VKQFLEWTPE-P------GPFNEDISKLGNNDTDDTTETLELPKDVLEVVFQVFDSPEIL
TBLA0A03920              VKQFLTWVPI-P------NDIAT----------ND-TKKLYSSTNLLDILLNIFESKEFL
TPHA0C00830              LNRALTWLPE--------SKLVS----------PNKSIKMMRKKNLLDILFAIFDDHELF
Smik_12.190              LNYYLTWVPE-P------NDMIP----------GS-VKSSCIKTNLFEVLLDLFESREFF
YLR127C                  LNYYIAWVPE-P------NDMIP----------GN-IKSSYIKTNLFEVLLDLFESREFF
Suva_10.220              LNYYLTWVPE-P------NDMIP----------GN-IKSSSIKTNLFEVLLDLFESREFF
Skud_12.196              LNHYLTWVPE-P------NDIIP----------GS-VKSSYIKTNLFEILLDLFESREFF
SAKL0H15598g             LNYFLQWTPE-P------SDVAH----------RK-PNNTFVNKSLLDILLDIFDSKDVF
KLTH0G12342g             IDYYLHWNPE-P------ADSIQ----------AN-NDQALISKELFDIIVELFDSKDVI
Kwal_56.23909            INFYLHWTPE-P------SDSIQ----------AN-NSDTLMNKGLFDIIVELFDSKDII
Kpol_YGOB_Anc_8.321      ITQMLNWVPE--------SSKID----------SKRQKMIGLRKNLLDILLEIFENNEVF
TDEL0F04470              MQRFLSWNPD-P------RDMAP----------RAISKQSPSHMSLLDILMELFESKDFF
ZYRO0F10340g             IKNFLQWTPE-P------MDTIS----------KNYSKSLSASRNLLDILMDMFESKDFF
                               .                                       :  :.  ::.   :

KLLA0D16324g             VDDLLGVVSGKFIESE-EYSLDPEWQRIMDIILNHLEGTR----------------KGTV
KNAG0G02430              LSCFLKLLTLKLFKLS-GYTLEPNWNECYQLIKRKVTKGD------VGDGGPLSRDTADA
KAFR0H02280              IGKFVNLLTIKFFKLQ-NYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTN
NDAI0G02600              LSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEKSNSSN--------------------
NCAS0C03280              ISEFLKLLTIKLLHMK-GYEVEDRWQKCLKILQDKVTSDK------------------NI
CAGL0M04235g             VIEFKNLLTKKLLDLR-GYTLDKKWSKFLSLLKKRFDNRS------------------TE
AGL193W                  INEFIQLVTNHMLQMD-GYVLNAKWSQLLKTVMKKYFKNN-----------------KQV
Ecym_4252                INEFIKLITNHMLQME-GYILSAKWSQLLKTLMKKYFKNN-----------------KQV
TBLA0A03920              LTEFSKLLSKRLLITK-NYKLEGKWGACLQLLRKRFSSGS--------DNYTNTNLADTD
TPHA0C00830              LKRFVELLKQKLFVIK-GYNLEESWVQCLRLFKTKFSPNS--------LDDAPTSTNLET
Smik_12.190              ISEFRNLLTDRLFTLK-FYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTA
YLR127C                  ISEFRNLLTDRLFTLK-FYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTA
Suva_10.220              ISEFRNLLTDRLFTLK-FYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTA
Skud_12.196              ISEFRNLLTDRLSSLK-FYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTA
SAKL0H15598g             ISEFLSLFTKKLLGLK-YYKLETKWIKILRLLKKKFGHTS------------------FP
KLTH0G12342g             VREFLGLFTRKLLGLR-GYKLESNWVQSLKVVKKKLDFKT--------------------
Kwal_56.23909            IGEFLTLFTDKLLDLK-GYRLEQNWVKSLKILKNRFDFKN--------------------
Kpol_YGOB_Anc_8.321      IAEFLKLLTKKLLKLK-YYKLDSRWSKCLKLLKEKFKGNS---------AGTTSISTNIG
TDEL0F04470              VSEFLKLLTKRLLSLK-FYNLDRNWSKCLQLLKKKLARGA-------PNISLAPTGQQNN
ZYRO0F10340g             VSEFLSLLTRKLLTLK-LYTLDRKWSHCLRLLKTKFGPAG--AAAVVATGIGGGDGGSID
                         :     :.. .:      * :.  *      .  .                         

KLLA0D16324g             TSEEAD-------------LTHLNDVDIMLEDLRLSSQFRNQVA-HKN--NS---HFENF
KNAG0G02430              PVSSNN----------EQVLLSLNKIDVMLHDLRENAKITRRLH-RTS--ML---NGNVF
KAFR0H02280              ENYVDEKRKTNASNDMEEIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIK
NDAI0G02600              VPDENV-------------KSTINTIDIMLNDMKRSASYGKDKK-HTKENNMVQGDIGFY
NCAS0C03280              VNDESI-------------TSDINTILIMLHDISISKESSNEKISEFQ--NS--SEMQLF
CAGL0M04235g             TMDEED-------------LNNINTIDIMLRDIYKSRQIATDMQLDLH--NT---NVKVY
AGL193W                  LKSMCE-------------ESNLVNVFVMWSDLEKSATFQTWST-KLQ--LV---PPNVY
Ecym_4252                LKSICE-------------ESNLVNVFVMWSDLEKSASFQNWST-KLQ--LI---PSNVY
TBLA0A03920              NLVNGE-------------NLKITNMNVMLSDLNYSSELCKIFH-HAN--GV---NTRVY
TPHA0C00830              LTGNND-------------SMYMTNIDVMLWDMRGSKKLTEQMH-LID--EL---DNRIN
Smik_12.190              PSADAD-------------QSNLNSIDVMLWDIKCSEELCRKMH-EVA--GL---DPAIF
YLR127C                  PAADAD-------------QSNLNSIDVMLWDIKCSEELCRKMH-EVA--GL---DPIIF
Suva_10.220              PAADAD-------------LSNINSIDVMLWDIKCSEELCLKMH-EVA--GL---DPAIY
Skud_12.196              PAADAD-------------QSNLNSIDVMLWDIKCSEELCRKMH-EVA--GL---DPTVF
SAKL0H15598g             QHQFQD-------------TSNINNIDIMLRDVKTSYELISKMH-EVA--GL---DDRVF
KLTH0G12342g             YSSAQE-------------FSNINNIDVMLRDVKHSEELCSLMH-EKL--GL---SDRII
Kwal_56.23909            YSNAQG-------------VSNINNIDVMLRDVKHSEELCAQMH-SVP--EI---SREVI
Kpol_YGOB_Anc_8.321      NVTGSD-------------LVYINNIDVMLWDLKTSGDLTSRMH-QIE--GL---DRRIQ
TDEL0F04470              SERGDD-------------YSNINSNDVMLWDVKLSYELCKQMH-QVS--GL---DQRIY
ZYRO0F10340g             GVRGGD-------------PSNINNIDVMLRDVRGSSELCKRMH-QVA--GL---DQRIY
                                               :    :*  *:  .                        

KLLA0D16324g             PHIKILSKLYW---RHYQNLNG-RLVTTKY-----KW---------DSEMEPLIQKLTKV
KNAG0G02430              P--KFISSQYW---SYRDDTFTKAGNRDQI-----KI---------DPVLETDILQYGGR
KAFR0H02280              P--KFISPLYW---DYEDNELGVNNFLKEN-----VF---------DEECTKAILQYASE
NDAI0G02600              P--KEVSKLYW-KINSTNIAKWRMNMKGDFF----HLLKYSKTAEPNHTMDIKLNRFFNE
NCAS0C03280              P--KFISKLYW---KFKRQSEY------QF-----PL---------DSKLRKKLSKYMKS
CAGL0M04235g             P--KIVSALYW---SNNSDTQS---KAGDF-----EM---------DGELEHLLELYSRF
AGL193W                  P--KIISYLYW---KIGRRSPY-----GDY-----AV---------APGLAAIFDQMEKA
Ecym_4252                P--KIISYLYW---KISRKSLY-----GDY-----RI---------SSALAIIFQQMEKA
TBLA0A03920              P--KFISSHYWVDLDDENVSNGPNEETNHF-----QI---------PPSLLGYFEEYAKL
TPHA0C00830              L--KIISSLYW---QYDMKNEK----RKTYYGLLNKM---------DQTLFNQLDKYSKL
Smik_12.190              P--KFISLLYW---KYNCDMQS--SNELTF-----HL---------PIHLKKELQKYSDV
YLR127C                  P--KFISLLYW---KYNCDTQG--SNDLAF-----HL---------PIDLERELQKYSDI
Suva_10.220              P--KFISLLYW---KHNGDTNN--ANELTF-----HL---------PGNLENELQKYSDI
Skud_12.196              P--KFISLLYW---KHNGDTQN--PKDSKF-----RI---------PADLERELQKYSDI
SAKL0H15598g             P--KFISYLFW---NSALEAET-----SDF-----QL---------PGWLETEIEKYSEV
KLTH0G12342g             P--KFVSYLFW---NAHSDFSA---LPKDH-----PL---------PKELEADINNYKKA
Kwal_56.23909            P--MFISYLFW---NAGSKFST---LPKDC-----RL---------PSQLESEIRKYKDM
Kpol_YGOB_Anc_8.321      P--KFISSLYW---DQAKESKSKGNNAKQT-----QI---------DPLLSTQLEKYIRV
TDEL0F04470              P--KFISYLYW---NCQLESKN------DF-----EI---------PEPLNSEFEKYSRV
ZYRO0F10340g             P--KFISPLYW---NRDNSSNG-----WTF-----QL---------DPQMALELDKYCQV
                              :*  :*                                          :      

KLLA0D16324g             YERLNTGRTLKFDTGSSSRVSINIVTKSGER-RFFKV-TMEQYLVISHFQNETNGRNAPG
KNAG0G02430              FCELKYGRMVRLCKEKTI-FEIELTVNDGEVPQVFKV-DAMKYSVIEKYATGGP---RAG
KAFR0H02280              YCSINKGFALHYCKGKEM-IEVEISFNDGAI-KGFLV-NASQYYVLTLFDTGNE------
NDAI0G02600              LG--RKGKKMELYKDKSL-MEMKISFDDGRE-LFFDNITIEQYDVLSLFTVEKG---AAF
NCAS0C03280              YHHSHPGMKLKLVNGTGI-CSLNLTFKDGRK-LSVDA-TFEQYTVLSAFHNDKD---DSS
CAGL0M04235g             YSQKQIGQKLELRRDNGS-VSLNLSFLDGRT-VHCKA-SLRQYSVLTLFKSPKHDSNFPT
AGL193W                  FETRSPGRKLRFQKDQGS-VDLQLVFEDGRH-WSSRV-SLPKYTVIDLFQRQAC------
Ecym_4252                FEMKSPGRKLRFQNDQGT-VEIALTFDDGRH-WSNKV-SLPKYTVIELFQK------VPR
TBLA0A03920              YEDLNEGRKVDIWPNEGV-IEIKLSFEDGRV-LEIDA-TLPQYALLQYIQEKNAIMQNNQ
TPHA0C00830              YSRLKPGRVLNLLTDQST-IEIDFNFEDNRT-VTCEC-TFENYMSICPFLENEG---TSS
Smik_12.190              YSQLKPGRKLQLCKDQGK-VEIELNFKDGRK-LVLDV-SLEQCSVINQFDSTDN---KSI
YLR127C                  YSQLKPGRKLQLCKDKGK-VEIQLAFKDGRK-LVLDV-SLEQCSVINQFDSPND---EPI
Suva_10.220              YSQLKPGRKLQLCKDQGK-IEMELDFNDGRK-LVLDV-SLEQCSVINQFNSTDG---EPI
Skud_12.196              YSQMKPGRRLQLCKDQGK-VEMELSFRDGRK-LVLDV-SLEQYSVMNQFNSTND---EPI
SAKL0H15598g             YSQLKPGRRLHLYKDQGT-VELDLEFKDGRK-ISCEV-PLNKAAVISCFDQDTA---LKG
KLTH0G12342g             YTNVKKGRKLRLHPEQSI-VELQLRLADGRD-LNYEV-TLDEALVLSYLSSNGD------
Kwal_56.23909            YAQIKPGRKLRLHQEQST-VVLQLHFADKRV-MDFEV-SMDKSSVLACVAETTG------
Kpol_YGOB_Anc_8.321      YSELKPGRTLHLLKDHGT-VELEFTFEDGRT-ISCDA-TLEQSNIINYFSEAVS---ENG
TDEL0F04470              YSEVKAGRALKLLKDQGV-IELDLEFKDGRV-LQCDV-TLEQYAVIQQFDEDSY---ANR
ZYRO0F10340g             YSEIKPGRALHLYKDQGI-VVLTLSFQDGRK-KRCEA-TLEQCSVIQQFDASTA---TTT
                               *  :           : :   .             :   :              

KLLA0D16324g             MMADCNYVIPERRYTLKDLHKMTSMPRQK--ILDILSFWQQKEIVTKHSD-DSYSVQEGI
KNAG0G02430              -------------YTPTELCELCGMDIAD--VQTSLTYWVNAGLLRLSSS-GYYESTSET
KAFR0H02280              ------------KLTIESILTAGEAKRSKNEIIDALKFWVEKNVLVYEG--GYYYSRDLH
NDAI0G02600              -----------TLEKAYDFFSGLKRGKQK--LEECIQFWVDKKVLYLDDDDGCYKVLERL
NCAS0C03280              -----------QVLSINQLSTMLKMDPER--VRAHLQFWINKKVLCHQN--DYYTIQEYL
CAGL0M04235g             -----------EGLTISELCARSGMQSKQ--MADILRYWVSKDVLYFSD--GKYRTLEFL
AGL193W                  ------------PLSVTDIAAHTNMSPRL--VEDIIQFWCHEHVLHLNKN-DLYEILENH
Ecym_4252                ------------GLRTADIVQQTDMAQHH--VEAIVQYWCQEHVLYSTGD-DCYRILERA
TBLA0A03920              ------------GFTVNELSVPLNLSLQN--VTELVDFWLKKNVLKKVD--DKYSILEYK
TPHA0C00830              -------------YTLEELSIITSFGLED--LKISLKFWLDQKILYFDG--KTYRPLEYL
Smik_12.190              ------------SLTLEQLSDSLNITPPR--LVHLLDFWIQKGVISKEN--GVYSVIENC
YLR127C                  ------------CLSLEQLSESLNIAPPR--LTHLLDFWIQKGVLLKEN--GTYSVIEHS
Suva_10.220              ------------YLSLEQLSEPLNIAPAR--LLDLLNFWIQRGVLSEEN--GVYSVIEYS
Skud_12.196              ------------NLSLKQLSESLNITTSK--LLQLLNFWIQKGVLSEEG--EVYSVIEYS
SAKL0H15598g             -------------LAVEQIVDNVKMEKAL--VTSILQFWCKKNAIYYDDRYNTYRVLEYY
KLTH0G12342g             -------------GTVEEIVKQTNLDISQ--VEKSLKFWVKSSILRYSTETSRYSVEERQ
Kwal_56.23909            -------------ISRDKIVEATGLEKAQ--VDQNLRFWLDASVLRFDSKTSLYSSLERQ
Kpol_YGOB_Anc_8.321      -------------LSLEQLHILSGIESTG--LKKILQFWVDEKVLYFDG--QLYRILEYL
TDEL0F04470              -------------LMAETISLYLNMEISR--VKSALQFWVEKGVLYQVD--AFYATQESR
ZYRO0F10340g             ------------GLTEQMIGARLQMDPAR--ARAALQHWVQEGVLYYDG--NAYKTREYL
                                           :                : .*     :        *   .  

KLLA0D16324g             ------------------------------------------------------------
KNAG0G02430              -------GPPPNRGTPLEASTR-----------------------------------EFL
KAFR0H02280              -------SIENSKGNTTTRTDD------------------------------------LL
NDAI0G02600              TFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNI
NCAS0C03280              -------NNQELSSGPTVITSSILPLSQERMPFKRSVPT------------NVLNDPKEI
CAGL0M04235g             -------RWKGDSTYAAIPDVL------EESVVERSSQH--------------EDKQENH
AGL193W                  ------------------------------------------------------------
Ecym_4252                ------------------------------------------------------------
TBLA0A03920              ------------------------------------------------------------
TPHA0C00830              -------DRS-EIIIESPESNN------VNSVMSITNNPLNGFAILGKGNDTIDRPSQEN
Smik_12.190              -------ETDFDKVHKDIPMET------ENNNRGLRNES------------EAERKCELT
YLR127C                  -------EMDFDQAQKTAPMEI------ENSNYELHNDS------------EIERKYELT
Suva_10.220              -------RTDFNQTQIEFPMKN------ENNNNELRDET------------EVERKCELI
Skud_12.196              -------DTGFSQTQKDVLMKN------VNNNNELRDES------------EVEKKCELT
SAKL0H15598g             -------EPNSALSASTVISSKGNTNGGINPMDDQDNAG-----------DKQQQEFIQS
KLTH0G12342g             -------NVDVKHAVERQSSSE---------IVNATDSV-----------DLQQQQFIDS
Kwal_56.23909            -------DTDNASEREAQMRAE----------DQARSAF-----------DSQQQQFVES
Kpol_YGOB_Anc_8.321      -------DQPEIIVQSLTHTGEVLKEEQKLNPLSSSSIT---------SDIDQMNKIHET
TDEL0F04470              -------QDSNIKTAKSDSVGS---------FFEKNETI-----------IEEETTLSKT
ZYRO0F10340g             -------DDQPAENLPASKDSS--------ASSQARTMS-----------PDRDSRLTSI
                                                                                     

KLLA0D16324g             ------------------------------------------------------------
KNAG0G02430              DGVVWT------------------FIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVT
KAFR0H02280              VKEALP------------------YIKTMLESFGNLSASRIQNFLKATLPAAQDS-DHI-
NDAI0G02600              LDRIFP------------------FINGMLENLGSMKLEKIHSFLKMTVPRDFEY-NRIA
NCAS0C03280              LHRVYP------------------YINDMFTNLGSLKVDKIHSFLNMSVPRGLHY-SKVT
CAGL0M04235g             VERALP------------------YIKDILLNLGTLKIDKLHALLQSAMPKDSHY-STVN
AGL193W                  --------------------------------NSAIASRQSQASVPAFHPVSSAY-AT--
Ecym_4252                ---------------------------------------------------DVAF-----
TBLA0A03920              ------------------------------------------------------------
TPHA0C00830              ITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAI-KKVS
Smik_12.190              LQRSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKDWGY-NRVS
YLR127C                  LQRSLP------------------FIEGMLTNLGAMKLHKIHSFLKITVPKDWGY-NRIT
Suva_10.220              LERSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKNWGY-NRIT
Skud_12.196              LQRSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKDWGY-NRIT
SAKL0H15598g             MSKIWP------------------FIQGMLTNLGSMKPEKIHSFLKMAVPKDIGY-TA-T
KLTH0G12342g             MQKVLP------------------FIKGMLTNLGSLKADKIHSFLKMAVPKEIGY-SA-T
Kwal_56.23909            MEKVWP------------------FIRGMLTNLGTLKVEKIHSFLKVAVPKEIGF-NA-T
Kpol_YGOB_Anc_8.321      LNNVWP------------------YIKGMLTNLGSLKLEKIHSFLRATVPKDVNY-NSIT
TDEL0F04470              LNAIWP------------------FVQGMLTNLGSLKAAKIHSFLKVTVPKEVGY-IVVT
ZYRO0F10340g             LEQTWP------------------FIQGMLTNLGALKVKKIHSFLKVTTPKELGF-SMVT
                                                                                     

KLLA0D16324g             ------------------------------------
KNAG0G02430              MLQLQGYLDYNVQSTHLLQQTPEGEYKLS-------
KAFR0H02280              ITDIHSVLDTLVSDGILF-KNSSGSYKLADET----
NDAI0G02600              IHQLENYLNGLVEDEKLE-TTTDGAFKKPK------
NCAS0C03280              VTQLEAYLDQLVEEEQLI-VLPDGSFKKL-------
CAGL0M04235g             QKQLQDYLDTLVEEGVLS-SASNDSYKLPQIR----
AGL193W                  ------------------------------------
Ecym_4252                ------------------------------------
TBLA0A03920              ------------------------------------
TPHA0C00830              SVTLENIVTELVENGQIL-CLPNGLYQLPE------
Smik_12.190              LQQLEQYLSALADEGRLK-YIANGSYEIVKNEHKTL
YLR127C                  LQQLEGYLNTLADEGRLK-YIANGSYEIVKNGHKNS
Suva_10.220              LLQLEKYLNVLADEGKLK-YITNGSYELEKNGHKNS
Skud_12.196              LLQLEKYLNTLTDEGKLK-YIANGSYEIAKNGHKNA
SAKL0H15598g             VNQLESYLNVLVDEDKLA-AVPNGSYKLVK------
KLTH0G12342g             PSQLQLYLNALVEESKLV-KTPNGAFRLAK------
Kwal_56.23909            TAQLEAYLRLLVDENKLV-CSANNAFKLVKEPR---
Kpol_YGOB_Anc_8.321      VSSLEVYLNSLVEDDVLE-LLASGSYRLPSTYKP--
TDEL0F04470              QSQLESYLNSLVEEERLA-CTTSGSYKLPSI-----
ZYRO0F10340g             PSQLESYLHSLVEEERLI-CTTNDTYKLPK------
                                                             

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0D16324g
---MTKTDDELKLLHEKI-----LLNLASNLEEEVDMVLAWLNPT-----FQPQIPTLRI
KQCLKVVLE----------------------------QSDERTRFLIEQYYLTLIRTHFF
LQFD---DIVNWKDMIKLEKLYISKVEFM---FGTSVYWIKEEMISFKRLLMKKNNEFRK
QLHAKLESHIL-DNDLVRF------DQMYQWLAPAFDGQEI--EFNVRIINLKVDQMSQK
LMKNKIDDRYLVMNTYNHFIKDFWSKFSKLLII--------EDDHELTAIIYQSFEKNYI
KYKCDEFYTDIVPKFPASRKCLLELRSIL--------------NKDIKT------VGTKV
LETLYHGFVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRP-D
IIKTLLLGIFPFQNNERFKIASSTDGSSV--HLEKLEQFSREV-----------G-DFSM
GPELPTALPW-----------------FNQPHLPRCTYDGD----------------DQL
LKQYLNWVPEPPRIKLDVEDFAD----------ND--GKYVPPVDLIHVLLDVLESKRTL
VDDLLGVVSGKFIESE-EYSLDPEWQRIMDIILNHLEGTR----------------KGTV
TSEEAD-------------LTHLNDVDIMLEDLRLSSQFRNQVA-HKN--NS---HFENF
PHIKILSKLYW---RHYQNLNG-RLVTTKY-----KW---------DSEMEPLIQKLTKV
YERLNTGRTLKFDTGSSSRVSINIVTKSGER-RFFKV-TMEQYLVISHFQNETNGRNAPG
MMADCNYVIPERRYTLKDLHKMTSMPRQK--ILDILSFWQQKEIVTKHSD-DSYSVQEGI
------------------------------------------------------------
------------------------------------------------------------
------------------------------------
>KNAG0G02430
--------MSGHRMSSRHHLK--RYLATEQEQDDLERVMGWIHPQA----HACHPPSLRM
KKAIRSVL-----------------------------GKASELDRQFKIYYIDVIKQEYL
CD-Q---VKREFKHIQVLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDNLRN
SLVAEFETLMQ-DDDFESG------YQIIEWLYTANAKLLRPWNLALDTIVSKISTLCDN
EMRRNWEAKFLVMNTFNKFINLYWSHLAKFLHLS-------EDNHDFTKVLYKCFEKEFV
RIRTEEIFEIVVESYQAAKTTILELRTFM--------------S-GYER------L-SKL
VNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRG-D
AVQIILYAILDLRDVD---FEKMG-VSPV----KGLSELSHEL-----------REDPYV
NINAKCQTPT------PSPSKISSPHLNDSSSMDVDDKLDD---------GTTDLVYKQV
LNQFXXRGHHET--NQGTRDYVG---------VNVKFSQRSNRTNLLDPLFELFDKKDEL
LSCFLKLLTLKLFKLS-GYTLEPNWNECYQLIKRKVTKGD------VGDGGPLSRDTADA
PVSSNN----------EQVLLSLNKIDVMLHDLRENAKITRRLH-RTS--ML---NGNVF
P--KFISSQYW---SYRDDTFTKAGNRDQI-----KI---------DPVLETDILQYGGR
FCELKYGRMVRLCKEKTI-FEIELTVNDGEVPQVFKV-DAMKYSVIEKYATGGP---RAG
-------------YTPTELCELCGMDIAD--VQTSLTYWVNAGLLRLSSS-GYYESTSET
-------GPPPNRGTPLEASTR-----------------------------------EFL
DGVVWT------------------FIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVT
MLQLQGYLDYNVQSTHLLQQTPEGEYKLS-------
>KAFR0H02280
-------MSDEQILH--------MMLPNAKFAEDLDRLLLWLSPAE----HQCKPPSLRI
KKSIQRIRE--------------------------CFQLSSDFTNCLVKLYIDLIRFEFI
SYMKENANCLKFNDVLKLENRIEHPRLFI-PEL---EFEYFKNLHMLRHYLLDSDKSFKT
ALCTSIENLIM-EDDFYSA------TIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSG
SIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCP-------ENDHELTKTVFKCFEREFI
NIRINEIFEIFTSAYPESKPTILELRKVM--------------K-APKD------L-QRL
TYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVKPYFQDKS-D
LINILLYAILDLKPKD---FEDLN-ISYI----PGLNKLSLDM-----------REDPEF
SIENVEPNDN-----------NYKRTVPNLESIGANSLHDK-----------GTLIQDHI
MKQFMMWVPE-PNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIF
IGKFVNLLTIKFFKLQ-NYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTN
ENYVDEKRKTNASNDMEEIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIK
P--KFISPLYW---DYEDNELGVNNFLKEN-----VF---------DEECTKAILQYASE
YCSINKGFALHYCKGKEM-IEVEISFNDGAI-KGFLV-NASQYYVLTLFDTGNE------
------------KLTIESILTAGEAKRSKNEIIDALKFWVEKNVLVYEG--GYYYSRDLH
-------SIENSKGNTTTRTDD------------------------------------LL
VKEALP------------------YIKTMLESFGNLSASRIQNFLKATLPAAQDS-DHI-
ITDIHSVLDTLVSDGILF-KNSSGSYKLADET----
>NDAI0G02600
MTPLLDTDVDLSRITESI-----FVSIDPQYHPQLQTMLLWLNPNE-TTTQSATTMTIDL
KNCINIIVS--------------------------TYGKDDQIRLLFKKYYSFVIKLHFM
KDNRPK-NMTSIREFHKLENLYLTPLRFTYDLI--DTNEMQSLINIFKRYLINNNFTFRK
NVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDAN-GNVSPIDLLLDLLLRKIEKFCQR
EMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFI
KIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLF
VKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQLLTTIILTLKPLIQRRTTD
IVNILLYAMLNLNEME---LHKLGCNIDF--DIESFNILVSELYPTIIKSMNQNQNNPSV
VPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLAR--------RKPETKPFFDL
FKQYLEWVP--P------MNKIY-DSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDLL
LSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEKSNSSN--------------------
VPDENV-------------KSTINTIDIMLNDMKRSASYGKDKK-HTKENNMVQGDIGFY
P--KEVSKLYW-KINSTNIAKWRMNMKGDFF----HLLKYSKTAEPNHTMDIKLNRFFNE
LG--RKGKKMELYKDKSL-MEMKISFDDGRE-LFFDNITIEQYDVLSLFTVEKG---AAF
-----------TLEKAYDFFSGLKRGKQK--LEECIQFWVDKKVLYLDDDDGCYKVLERL
TFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNI
LDRIFP------------------FINGMLENLGSMKLEKIHSFLKMTVPRDFEY-NRIA
IHQLENYLNGLVEDEKLE-TTTDGAFKKPK------
>NCAS0C03280
----MSLDADLPTIITSLREQ-----VERQFHPQLESLLLWLDPNSSKGTRQNKPPTLEL
KDCINLLRA--------------------------GYSQDEKFKMWLREYYLYVVKFHFM
KNVD---EISVLKDFKLLEMIYIYPLQFM-DLV--DSTDISNLVKSFKHYLIDKNVTFRK
NLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSE-GVLSATDLILDASLTKIEIFARE
QMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNI-------EDDHDLTNLIYQFFERQFI
KIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGR-RKDE------WSKKL
LKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVE
MVDILLYALLNLKSKD---LIELN-CEKTTYDMRSIELLSKEL-----------S-NDHS
KHAGDVDYKK-------------------FSPEGTNEFENS------------TLPYEQV
YTDFLNWKPSIT----PISESSN----------DDEFASLGKNITPIDYVFNALESKDKL
ISEFLKLLTIKLLHMK-GYEVEDRWQKCLKILQDKVTSDK------------------NI
VNDESI-------------TSDINTILIMLHDISISKESSNEKISEFQ--NS--SEMQLF
P--KFISKLYW---KFKRQSEY------QF-----PL---------DSKLRKKLSKYMKS
YHHSHPGMKLKLVNGTGI-CSLNLTFKDGRK-LSVDA-TFEQYTVLSAFHNDKD---DSS
-----------QVLSINQLSTMLKMDPER--VRAHLQFWINKKVLCHQN--DYYTIQEYL
-------NNQELSSGPTVITSSILPLSQERMPFKRSVPT------------NVLNDPKEI
LHRVYP------------------YINDMFTNLGSLKVDKIHSFLNMSVPRGLHY-SKVT
VTQLEAYLDQLVEEEQLI-VLPDGSFKKL-------
>CAGL0M04235g
----MILTGDTKTFKRAVLEYG-VNGNKNSNAEEWNVLLQWLDPAG-KKNHQLKPPNLLV
KTMIEKLLL---------------------------GSNDYQLLSNIQDYYCWQCRVYFY
NEYK---RIETLNELKRIERHVLFPLKYI-PIFE-GNNRVENEVRLFGNYLLKTNKKVMS
RAVERLRNRML-EDDFELA------TEIVDYFDYCQ---TDSTSIVLDIILDKIEQFCQL
HYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQ-------EDNHTITNTLYKYFEKQFI
SIRTNEIFDICISNPASVQPTLLELRKEI--------------S-TVND------F-NCV
VVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRK-D
LVHLLLFSMLGLDETD---QLNTM-PSQV--SEEKLTALTNEL-----------K-DTEI
CSYTEESDDV------------------VDPMIGSFSKEED------------SMVLEQV
IKRYMEWIPEVP------TSFGK-------------GILSDHKLDLFDILLELLESKETL
VIEFKNLLTKKLLDLR-GYTLDKKWSKFLSLLKKRFDNRS------------------TE
TMDEED-------------LNNINTIDIMLRDIYKSRQIATDMQLDLH--NT---NVKVY
P--KIVSALYW---SNNSDTQS---KAGDF-----EM---------DGELEHLLELYSRF
YSQKQIGQKLELRRDNGS-VSLNLSFLDGRT-VHCKA-SLRQYSVLTLFKSPKHDSNFPT
-----------EGLTISELCARSGMQSKQ--MADILRYWVSKDVLYFSD--GKYRTLEFL
-------RWKGDSTYAAIPDVL------EESVVERSSQH--------------EDKQENH
VERALP------------------YIKDILLNLGTLKIDKLHALLQSAMPKDSHY-STVN
QKQLQDYLDTLVEEGVLS-SASNDSYKLPQIR----
>AGL193W
----MMYSQEAVGCQQQVVDA--VCTWDPSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRI
KNSIRLLRL--------------------------GEQAPGTTVGLLRQCAVSQMRQHFF
RHWE---RLEQYTDMVKLERYYEFPLRYV-AVF--TEDEVAAELVGLRKYLLNGNPGFRA
NMEARIRALILQDDDFETA------ARLYKWIVQGL-GHPMV-KFVIEVLTQKIALFCRN
RMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPT------ADDPELNNLIYRCFEKKFI
ELKTQELFHQIIPKFPMSKPALLEMKSVI--------------KGDTAE------L-DRL
VAQIYNDFHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERS-D
LIISVLCAILELDSDE---IHEVISKNTLTENPQLLSQLSKEL-----------K-NSTA
LTFHSMSTSK------------------GKAAIYSVAFERQ----------------DQL
VKQFLEWTPE-P------GPFTADDAKALNSD-DDGAETLELPKDVLEVVFQVFDSPEVL
INEFIQLVTNHMLQMD-GYVLNAKWSQLLKTVMKKYFKNN-----------------KQV
LKSMCE-------------ESNLVNVFVMWSDLEKSATFQTWST-KLQ--LV---PPNVY
P--KIISYLYW---KIGRRSPY-----GDY-----AV---------APGLAAIFDQMEKA
FETRSPGRKLRFQKDQGS-VDLQLVFEDGRH-WSSRV-SLPKYTVIDLFQRQAC------
------------PLSVTDIAAHTNMSPRL--VEDIIQFWCHEHVLHLNKN-DLYEILENH
------------------------------------------------------------
--------------------------------NSAIASRQSQASVPAFHPVSSAY-AT--
------------------------------------
>Ecym_4252
----MTYAEELENYHLQLISA--LPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRI
KNSIKLLKL--------------------------DDAEQVFLLQLLRQWTLSQLRYHFF
HNWE---SLMQYKDMLRLERYYEFPLKYV-GLF--TAEELSNELIGLRKYLLNRNSTFRN
NMESRIRVLILEEDDFEMS------SKLYKWMVQGL-GHPMV-KFVIDLLTNKIELFCKS
RMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPN------EDDQELNNLIYRCFENKFI
EMKTKELFDEIIPKFPLSKPSLLEMKSVI--------------KGATEE------L-DRL
VAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERS-D
LITTVLCAILELTKDE---IHEVISKNTLTENPQLLDQLSKEL-----------K-NSTA
LNFHSVTTIK------------------SKAAIYSVAQERQ----------------NPL
VKQFLEWTPE-P------GPFNEDISKLGNNDTDDTTETLELPKDVLEVVFQVFDSPEIL
INEFIKLITNHMLQME-GYILSAKWSQLLKTLMKKYFKNN-----------------KQV
LKSICE-------------ESNLVNVFVMWSDLEKSASFQNWST-KLQ--LI---PSNVY
P--KIISYLYW---KISRKSLY-----GDY-----RI---------SSALAIIFQQMEKA
FEMKSPGRKLRFQNDQGT-VEIALTFDDGRH-WSNKV-SLPKYTVIELFQK------VPR
------------GLRTADIVQQTDMAQHH--VEAIVQYWCQEHVLYSTGD-DCYRILERA
------------------------------------------------------------
---------------------------------------------------DVAF-----
------------------------------------
>TBLA0A03920
--MSLINELTLTDIKQQLKESSKLLSPYKDISDELETLLIWLDPNDPNSNHHLHPPTLQL
KTIIKQITPSSDIYK------------------DPSNSIKNNIQNWLKLFYVYQVRTYFF
KKID---NIRQYKDMIKLEKYYQFPLQFI-PLF--TFQEWCFELLSLRHYILHQNKEFTQ
KIILELRQLIK-EEDFETS------LDIVTWIREVD-SNLLSENFILDILLEKITLYCEQ
TMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCK-------EDNHKITNILFKYFEKQFI
KIRIQEIFKICILSYPDTKPTLLELRNLL--------------V-TYNF------F-QKL
VVNFLSAFERIVLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERK-M
LAPILLHAILALPKID---LENAIYPIKV--SSISLKLIINEL-----------E-DPEL
GIENTSTKKN------SIKKFNEILSPKRFNNHNSSEYLPDLLQNTSSEDSNSTLLVQKV
VKQFLTWVPI-P------NDIAT----------ND-TKKLYSSTNLLDILLNIFESKEFL
LTEFSKLLSKRLLITK-NYKLEGKWGACLQLLRKRFSSGS--------DNYTNTNLADTD
NLVNGE-------------NLKITNMNVMLSDLNYSSELCKIFH-HAN--GV---NTRVY
P--KFISSHYWVDLDDENVSNGPNEETNHF-----QI---------PPSLLGYFEEYAKL
YEDLNEGRKVDIWPNEGV-IEIKLSFEDGRV-LEIDA-TLPQYALLQYIQEKNAIMQNNQ
------------GFTVNELSVPLNLSLQN--VTELVDFWLKKNVLKKVD--DKYSILEYK
------------------------------------------------------------
------------------------------------------------------------
------------------------------------
>TPHA0C00830
-----MQYTEVDSIVGNIYEL--VDSKSCGSSDDIDSLLDWLNPNDPKSNHQLKPPTIRL
KKVIKKILLDVNTLG--------------------DYDSIETLNSLLRYYYIFQVRLNFF
SNLQ---SITYFKDIIKLEKYYEFPILHV-PIFLNNNYIWETELNKIRHYLLRTNLTFRS
NLINRLKKLVK-EDDFDLA------QEIIKWSNEANFSLLSSKQIILNALLDKITMYADK
QFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCA-------EDDHEITKVLYKYFEKQFL
RIRSEEIFDICVISYPDSKPTIMELRGLL--------------T-QSKI------S-TNI
LIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKS-D
IIYILLFAILDLRTDD---IKTNP-IVKV--DQNLLKLLSEEL-----------R-ESHF
GINLNFSDVD------ISDNLENGNNNKNISQLDYAGQESS------------QLLYSQI
LNRALTWLPE--------SKLVS----------PNKSIKMMRKKNLLDILFAIFDDHELF
LKRFVELLKQKLFVIK-GYNLEESWVQCLRLFKTKFSPNS--------LDDAPTSTNLET
LTGNND-------------SMYMTNIDVMLWDMRGSKKLTEQMH-LID--EL---DNRIN
L--KIISSLYW---QYDMKNEK----RKTYYGLLNKM---------DQTLFNQLDKYSKL
YSRLKPGRVLNLLTDQST-IEIDFNFEDNRT-VTCEC-TFENYMSICPFLENEG---TSS
-------------YTLEELSIITSFGLED--LKISLKFWLDQKILYFDG--KTYRPLEYL
-------DRS-EIIIESPESNN------VNSVMSITNNPLNGFAILGKGNDTIDRPSQEN
ITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAI-KKVS
SVTLENIVTELVENGQIL-CLPNGLYQLPE------
>Smik_12.190
MSYQIAPTRDLKVITDELQTLS-SYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRI
KNIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFF
SHFE---NINYLKDIQRWENYYEFPLRYV-PIFDLDINGWSLELNSLRHYLLNRNMKFKN
NLRTRLDKLIM-DDDFDLA------DNLIQWLNSAD-GSLSSMELIVNALFNKINKFCED
TMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCP-------EDDHELTTTVFNCFESNFL
RIRTKEIFDICVLAYPNSKVTLLELKKIM--------------K-DFKD------Y-ANI
VTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-H
LVDLLLYAMLDLPEEE---LKEKI-TFKV--DIKALISLVDTL-----------H-DSDI
SQFTNVMKRN----KNKKGPFLWNLKVKGK---NGPSPTSQ------------TMIYQHI
LNYYLTWVPE-P------NDMIP----------GS-VKSSCIKTNLFEVLLDLFESREFF
ISEFRNLLTDRLFTLK-FYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTA
PSADAD-------------QSNLNSIDVMLWDIKCSEELCRKMH-EVA--GL---DPAIF
P--KFISLLYW---KYNCDMQS--SNELTF-----HL---------PIHLKKELQKYSDV
YSQLKPGRKLQLCKDQGK-VEIELNFKDGRK-LVLDV-SLEQCSVINQFDSTDN---KSI
------------SLTLEQLSDSLNITPPR--LVHLLDFWIQKGVISKEN--GVYSVIENC
-------ETDFDKVHKDIPMET------ENNNRGLRNES------------EAERKCELT
LQRSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKDWGY-NRVS
LQQLEQYLSALADEGRLK-YIANGSYEIVKNEHKTL
>YLR127C
MSFQITPTRDLKVITDELQTLS-SYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRI
KNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFF
LHFN---NINYLKDIQRWENYYEFPLRYV-PIFDVNVNDWALELNSLRHYLLNRNIKFKN
NLRTRLDKLIM-DDDFDLA------DNLIQWLKSAN-GSLSSTELIVNALYSKINKFCED
NMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCP-------EDDHELTTTVFNCFESNFL
RIRTNEIFDICVLAYPDSKVTLLELRKIM--------------K-DFKD------Y-TNI
VTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-H
LVNVLLYAMLDLPEEE---LKEKI-NFNV--DMKALLSLVDTL-----------H-DSDI
NQDTNITKRD----KNKKSPFLWNLKVKGKRELNKDLPIRH------------AMLYEHI
LNYYIAWVPE-P------NDMIP----------GN-IKSSYIKTNLFEVLLDLFESREFF
ISEFRNLLTDRLFTLK-FYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTA
PAADAD-------------QSNLNSIDVMLWDIKCSEELCRKMH-EVA--GL---DPIIF
P--KFISLLYW---KYNCDTQG--SNDLAF-----HL---------PIDLERELQKYSDI
YSQLKPGRKLQLCKDKGK-VEIQLAFKDGRK-LVLDV-SLEQCSVINQFDSPND---EPI
------------CLSLEQLSESLNIAPPR--LTHLLDFWIQKGVLLKEN--GTYSVIEHS
-------EMDFDQAQKTAPMEI------ENSNYELHNDS------------EIERKYELT
LQRSLP------------------FIEGMLTNLGAMKLHKIHSFLKITVPKDWGY-NRIT
LQQLEGYLNTLADEGRLK-YIANGSYEIVKNGHKNS
>Suva_10.220
MTYQITPTRDLKIITDELQTLS-SYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRI
KNIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFF
LHFS---SINYLKDIQRWENYYEFPLRYV-SIFDLNVNGWTLELNSLRHYLLNRNTKFKN
NLRTRLNKLII-DDDFDLA------SNLIRWLNSAN-GSLSSMDLIVNALFDKISMFCEI
NMSGVWNKRFMIMETFNKFINQYWSQFSELIGCP-------EDDHELTTTVFNCFESNFL
RIRTKEIFDICVLAYPGSKITLLELKKIM--------------K-DFKD------Y-TNI
VTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-H
LVNVLLYAILDLPEEE---LKEKI-SFKV--DMKALLLLVETL-----------H-DSDI
DQITNTPKSK---DKNKGGSFPWNLHVKGKKEKNGSSSITQ------------SMLYEHI
LNYYLTWVPE-P------NDMIP----------GN-IKSSSIKTNLFEVLLDLFESREFF
ISEFRNLLTDRLFTLK-FYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTA
PAADAD-------------LSNINSIDVMLWDIKCSEELCLKMH-EVA--GL---DPAIY
P--KFISLLYW---KHNGDTNN--ANELTF-----HL---------PGNLENELQKYSDI
YSQLKPGRKLQLCKDQGK-IEMELDFNDGRK-LVLDV-SLEQCSVINQFNSTDG---EPI
------------YLSLEQLSEPLNIAPAR--LLDLLNFWIQRGVLSEEN--GVYSVIEYS
-------RTDFNQTQIEFPMKN------ENNNNELRDET------------EVERKCELI
LERSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKNWGY-NRIT
LLQLEKYLNVLADEGKLK-YITNGSYELEKNGHKNS
>Skud_12.196
MSYQITPTRDLKVITDQLQTLS-SYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRI
KNIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFF
LRFN---DIIYLKDIQRWENYYEFPLRYV-PIFDLSVNDWSLELNSLRHYMLNRNIKFKN
NLRVRLNKLIM-DDDFDLA------GNLIRWLNFAN-GSLSSMELIVNALFNKIEKFCEA
NMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-------EDDHELTTTVFNCFESNFL
RIRTREIFDICVLAYPDSKVALLELKKIM--------------K-DFKD------Y-TNI
VTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERK-H
LVNVLLYAMLDLPEEE---LKEKI-TFKV--DMKALLSLVDIL-----------H-DYDI
GQNTDAHKSK---DKNKRSPFLWNLKVKGKKETNEDPLARQ------------TMLYEHV
LNHYLTWVPE-P------NDIIP----------GS-VKSSYIKTNLFEILLDLFESREFF
ISEFRNLLTDRLSSLK-FYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTA
PAADAD-------------QSNLNSIDVMLWDIKCSEELCRKMH-EVA--GL---DPTVF
P--KFISLLYW---KHNGDTQN--PKDSKF-----RI---------PADLERELQKYSDI
YSQMKPGRRLQLCKDQGK-VEMELSFRDGRK-LVLDV-SLEQYSVMNQFNSTND---EPI
------------NLSLKQLSESLNITTSK--LLQLLNFWIQKGVLSEEG--EVYSVIEYS
-------DTGFSQTQKDVLMKN------VNNNNELRDES------------EVEKKCELT
LQRSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKDWGY-NRIT
LLQLEKYLNTLTDEGKLK-YIANGSYEIAKNGHKNA
>SAKL0H15598g
----MGSNAEIQELNAQLREF--VTTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRL
KNGIKLVVN--------------------------NEDVPPGFVHLLRQFVLLQTRIHFF
SNFN---SITSFKDIQRLEKYYEFPLKYI-NIF--TPDEWFIEMNGFRHYLMSKNRIFGD
NIKHRVRQLIM-EDDFDMA------WKIYTWLTETM-GHQLV-SLLLEILMDKIADFSKQ
NMMGKWTQRFLVMETFNTFITKYWSTFAQALRCP-------EDDHEITTEIFHCFEKEFV
KIRTSEIYEICVLEYPHSKPALLELRNVM--------------K-TSAD------Y-SKL
MIEFLSKFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERR-D
TVVHLLYAMLELDESE---IDDA--NVSL--NMPILTELSKEL-----------K-DPDF
GIEDADSKSR---------------KNKLMVTDSSPVFKVE------------KPLCEQV
LNYFLQWTPE-P------SDVAH----------RK-PNNTFVNKSLLDILLDIFDSKDVF
ISEFLSLFTKKLLGLK-YYKLETKWIKILRLLKKKFGHTS------------------FP
QHQFQD-------------TSNINNIDIMLRDVKTSYELISKMH-EVA--GL---DDRVF
P--KFISYLFW---NSALEAET-----SDF-----QL---------PGWLETEIEKYSEV
YSQLKPGRRLHLYKDQGT-VELDLEFKDGRK-ISCEV-PLNKAAVISCFDQDTA---LKG
-------------LAVEQIVDNVKMEKAL--VTSILQFWCKKNAIYYDDRYNTYRVLEYY
-------EPNSALSASTVISSKGNTNGGINPMDDQDNAG-----------DKQQQEFIQS
MSKIWP------------------FIQGMLTNLGSMKPEKIHSFLKMAVPKDIGY-TA-T
VNQLESYLNVLVDEDKLA-AVPNGSYKLVK------
>KLTH0G12342g
----MTLSDEGRELSEQLHSL--LHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRV
KSAIKSLLN--------------------------GVVTSESFIDLLGKYMIFQTRKHFF
LNYQ---SLLYFKDVQKLERYYEFPTRYV-NIF--SSEEWCDEMSGLRNYLIRQNSGLKN
NIQLRLEQLVH-EDDFDMA------CKIYEWLCQAE-GRLLP-EILVDVLLSKVKLFASK
NMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCM-------EDDHEITNEIYRCFEEEFI
RIRTSQVFDIFVTGFPTTKPTLLELRSVL--------------K-TSVK------Y-TEL
ITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERH-D
TVATFLYAMLGLDASD---LSSKN-STST--HMSIASQLSAEL-----------R-GSHQ
PISSSTAERG--------------NLPHGKHALSMNPYEPA---------------YQQI
IDYYLHWNPE-P------ADSIQ----------AN-NDQALISKELFDIIVELFDSKDVI
VREFLGLFTRKLLGLR-GYKLESNWVQSLKVVKKKLDFKT--------------------
YSSAQE-------------FSNINNIDVMLRDVKHSEELCSLMH-EKL--GL---SDRII
P--KFVSYLFW---NAHSDFSA---LPKDH-----PL---------PKELEADINNYKKA
YTNVKKGRKLRLHPEQSI-VELQLRLADGRD-LNYEV-TLDEALVLSYLSSNGD------
-------------GTVEEIVKQTNLDISQ--VEKSLKFWVKSSILRYSTETSRYSVEERQ
-------NVDVKHAVERQSSSE---------IVNATDSV-----------DLQQQQFIDS
MQKVLP------------------FIKGMLTNLGSLKADKIHSFLKMAVPKEIGY-SA-T
PSQLQLYLNALVEESKLV-KTPNGAFRLAK------
>Kwal_56.23909
----MIQRDEGHVLSEQLHEL--LRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRL
KSAIKILIN--------------------------ENGNGPALTDILRQYLIFQTRKHFF
AHYY---SLCHFKDVQKLERYYEFPLRFV-RLF--NREEWAEEINGLRNYLISKNLVFNR
NARLRLRQLVL-EDDFEMA------CKLYEWLCRAE-GRLLT-HLLVDAVLSKVKAFALK
HMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCP-------EDDHDVTNEIYRCFEEEFI
RIRTQQAFKIFVTGYPESEPTLLELRSVL--------------K-TPAK------Y-TQL
VTELLSQFEARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERR-D
TVVTFLYAMLGLDASE---TRGPK-PTGA--HASIASQLSAEL-----------K-DSHQ
PIFRSALDKS-----------------AQSPVDDMASVNPK------------EPVYQQV
INFYLHWTPE-P------SDSIQ----------AN-NSDTLMNKGLFDIIVELFDSKDII
IGEFLTLFTDKLLDLK-GYRLEQNWVKSLKILKNRFDFKN--------------------
YSNAQG-------------VSNINNIDVMLRDVKHSEELCAQMH-SVP--EI---SREVI
P--MFISYLFW---NAGSKFST---LPKDC-----RL---------PSQLESEIRKYKDM
YAQIKPGRKLRLHQEQST-VVLQLHFADKRV-MDFEV-SMDKSSVLACVAETTG------
-------------ISRDKIVEATGLEKAQ--VDQNLRFWLDASVLRFDSKTSLYSSLERQ
-------DTDNASEREAQMRAE----------DQARSAF-----------DSQQQQFVES
MEKVWP------------------FIRGMLTNLGTLKVEKIHSFLKVAVPKEIGF-NA-T
TAQLEAYLRLLVDENKLV-CSANNAFKLVKEPR---
>Kpol_YGOB_Anc_8.321
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERN-D
LVSVLLYAILDLQSEN---FQEEA-QNIL--DADSLVILSDEL-----------R-DPEF
GIEGELNIDL------------------DKNELTGQPSNKS---------GDSSLLYRQV
ITQMLNWVPE--------SSKID----------SKRQKMIGLRKNLLDILLEIFENNEVF
IAEFLKLLTKKLLKLK-YYKLDSRWSKCLKLLKEKFKGNS---------AGTTSISTNIG
NVTGSD-------------LVYINNIDVMLWDLKTSGDLTSRMH-QIE--GL---DRRIQ
P--KFISSLYW---DQAKESKSKGNNAKQT-----QI---------DPLLSTQLEKYIRV
YSELKPGRTLHLLKDHGT-VELEFTFEDGRT-ISCDA-TLEQSNIINYFSEAVS---ENG
-------------LSLEQLHILSGIESTG--LKKILQFWVDEKVLYFDG--QLYRILEYL
-------DQPEIIVQSLTHTGEVLKEEQKLNPLSSSSIT---------SDIDQMNKIHET
LNNVWP------------------YIKGMLTNLGSLKLEKIHSFLRATVPKDVNY-NSIT
VSSLEVYLNSLVEDDVLE-LLASGSYRLPSTYKP--
>TDEL0F04470
--MSECHSSELPVIIDSIKEV--ALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRL
KDAIKLFVNQYYNSGYISG-----------SDGEINKGPEFELGNQLRQFYIYQVRIHFF
TSFN---LIQTFKDIQRLEKYYVSPLAYI-HLFESSGYEWIIERDGLRHYLLNRNMEFHN
NMKQRMESLFM-QDDFEYV------AEMLDWVEKAH-TSLSSKDILLDLIIAKVKQFCDD
HMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP-------QDDHGLTNVVYTCFEKQFI
RIRTQEVFDIFVNEFPNSKPTIIEMRKLI--------------T-HSTD------F-KTI
VIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERS-D
LVVILLYAILDLQ------LDGLV-GSHIQVDPVCLKALASEL-----------R-DPEL
GIENDIYPDD-----------NLANVATGMAKLNYEG----------------CLPYEEV
MQRFLSWNPD-P------RDMAP----------RAISKQSPSHMSLLDILMELFESKDFF
VSEFLKLLTKRLLSLK-FYNLDRNWSKCLQLLKKKLARGA-------PNISLAPTGQQNN
SERGDD-------------YSNINSNDVMLWDVKLSYELCKQMH-QVS--GL---DQRIY
P--KFISYLYW---NCQLESKN------DF-----EI---------PEPLNSEFEKYSRV
YSEVKAGRALKLLKDQGV-IELDLEFKDGRV-LQCDV-TLEQYAVIQQFDEDSY---ANR
-------------LMAETISLYLNMEISR--VKSALQFWVEKGVLYQVD--AFYATQESR
-------QDSNIKTAKSDSVGS---------FFEKNETI-----------IEEETTLSKT
LNAIWP------------------FVQGMLTNLGSLKAAKIHSFLKVTVPKEVGY-IVVT
QSQLESYLNSLVEEERLA-CTTSGSYKLPSI-----
>ZYRO0F10340g
MNAVMRAGEDLKRLLVQIQEV--ALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRL
KNSIKMLVNQYYNMELRED----------------ERDTGYLFIQLVRQFYVYQVRLHFF
ASLS---NLHTFKDVQRLVKYYEFPLKYV-YIFENCPEEWIGERDGLMHYLLNRHKKLRI
NVVSRLKDLVM-EDDFDLA------MDVVKWLNESN-SNVSSMDLMLDLIVEKISRFCQD
QMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP-------EDNHELTTVVYHLFERQFV
KLRTKEIFDIVVGVYPDSKPTLLELRRVL--------------V-KSKD------F-TQI
VVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERN-D
LVTVLLYAILELQSEE---FEGPA-RAYL--DTNSLNQLSQEL-----------K-DPEF
GIESSFETIP-----------QADLLSRPASTATTAAMLDP------------RLPYKSV
IKNFLQWTPE-P------MDTIS----------KNYSKSLSASRNLLDILMDMFESKDFF
VSEFLSLLTRKLLTLK-LYTLDRKWSHCLRLLKTKFGPAG--AAAVVATGIGGGDGGSID
GVRGGD-------------PSNINNIDVMLRDVRGSSELCKRMH-QVA--GL---DQRIY
P--KFISPLYW---NRDNSSNG-----WTF-----QL---------DPQMALELDKYCQV
YSEIKPGRALHLYKDQGI-VVLTLSFQDGRK-KRCEA-TLEQCSVIQQFDASTA---TTT
------------GLTEQMIGARLQMDPAR--ARAALQHWVQEGVLYYDG--NAYKTREYL
-------DDQPAENLPASKDSS--------ASSQARTMS-----------PDRDSRLTSI
LEQTWP------------------FIQGMLTNLGALKVKKIHSFLKVTTPKELGF-SMVT
PSQLESYLHSLVEEERLI-CTTNDTYKLPK------