MUSCLE (3.8) multiple sequence alignment

CAGL0L12320g       ----------------MSGRVLEVFRGLP-LLPLSHEIVARCWDRM----------VRQR
KNAG0G02060        -------------MNTVRTGLLRELRSLP-LHSLTLARLSRHVAAT----KSIPRLKHVA
TPHA0J00760        MLKLNRNILKNHESLDFKQIILDGLNRLP-LHPNTLDLLQKQVHTK------LTKNSELI
KLLA0F19228g       ----------------MKASLLRTSKLYKGLHSITKDAISKVDTFP---------KNKQH
Kpol_392.4         ------MTSVKDLGKRLKPILLESLERLP-LHKPTLDILERRIHVA-----DLPFMEEYV
Suva_10.175        ------------MISQANSLLLPFIDSLP-LHQITKTALTTRLTDIHSDFKFKEIAVPLT
Skud_12.159        ------------MTSRIKGVLLPFIESLP-LHRITKTALTTTLVGIQSDYKFKEIAVPLT
YLR091W            ------------MASQVNALLLPVIESTP-LHQITKVALTTTLTSKQSDYKFKEIAVPLT
Smik_12.150        ------------MASRVNDLLLPVIQSIP-LHQITKNALVTTLTDTQSDYKFKEIAVPLT
AGR082C            ----------------MNEHIQRIVSRLP-LHRATSEVILAYLSKQ-----QAQYPTERI
Ecym_4304          -------------MGGMNRKVLEIVSRLP-LHAHTKKVIADNVGSV------GKGEFKRV
KAFR0B02740        -MSGRAPCIRTLVTKEVRDKITNAIEGLP-LHQKTLLQLQDTLKRN---------DALAI
NDAI0B02010        ---------MELLNSKLTKTLLSSLQNLP-LHSNTLAQLERKCLTR-NIKATKSFKIPLL
NCAS0B05040        ------------MEKSVTTTLLRSLPNVP-LHRKTLDLLERKIQTANDKSTRHSFKVPLL
ZYRO0C01562g       --------MVSSNLQELIPALSRSIRQLP-LHIETQKVLEFYCRNS---------SYKSL
TDEL0F03930        ------------MTQQLVQPLLKALEKLP-LHSKTLDLLACKLKGD----ELKTVIIPLA
SAKL0H16940g       --------------MNRVKTLLNFLECLP-LDTRTLDLLEGTVKLC--------SSALLD
KLTH0G13596g       -----------------MNMAVRALEKLP-LDIRTLELLERKLLKK-----------SLP
Kwal_56.23777      -----------------MNRGIQVLEKLP-LDVRTLKLIEKRLERA-----------ESL
                                                 *   :   :                     

CAGL0L12320g       DVYYQFAVHVSHCHERLSTRNLLRLVTHVHHVLAPMNE------LPA--HLRQYQSEYHA
KNAG0G02060        ETLQNFHDVPSTKKH-TQYKILTTLLLQLYCQWD--NSFSRLSHLPP--HLAPFEQDFPG
TPHA0J00760        ELLFDYNNAFINKQKPGQLKCLQRIIFKTHLIFN--NS------YKNYDHLKAFKLKYNY
KLLA0F19228g       ETLHRLNSFNENPTR----KTLEKLVYSVHFHLL--ND------PPK--HVDILRQYPNE
Kpol_392.4         GILNEYEISKINSKVENESRALEKIVKKTHIVWN--ND-----KFPN--HLEKFKNHYME
Suva_10.175        ESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWN--NP------RPR--HAHLFQKHYHF
Skud_12.159        ESLQVYEKAQRRQDLRTSLKALESIIFQTHFQWN--NP------RPR--HALLFQKHHYF
YLR091W            KSLQLYEKAQRRQDLRASLKALESIIYQTHFQWN--NP------LPR--HAHLFQKHYHF
Smik_12.150        KLLQVHEKAQRRQDLRTALKALESIIYQTHFKWN--NP------RPR--HALLFQKHYHF
AGR082C            ELVEPLNDFLRKGGH----QGLQRLVFHVHFQLM--LR------APE--HLRLLRRHREE
Ecym_4304          DVIEPINRYLLSGEV----SYLRRVIFDVYFRIL--NP------KAE--HVRQFERYLKE
KAFR0B02740        PLLRDVVSYETTGKS----KFLESIIYRLYFQWL--NE------VPS--HLKPLLNQYEH
NDAI0B02010        TLINSYEKAQASGQSKLSNKTLESIIYHTYFEWT--ND------LAS--HLKPFQRQYST
NCAS0B05040        QLLCKYERYNIQEDKRGIEKVLESIAYNTYFIWN--NP------VPS--HLQVFQKNNEM
ZYRO0C01562g       LVAQDISEFEKHNDH----KYLEALIQKTHFLWD--NP------LPP--FLKRFQLYHKE
TDEL0F03930        KLVSNLESSRAETQR---IKALESIIYHTHFVWG--SP------LPV--HLKMFQSHYTD
SAKL0H16940g       TLEQKLFDYQANENS----KSLEWIVYNTYFHWN--NT------TPL--HIQKFRQNYHD
KLTH0G13596g       GFQELAQQYTADGSS----KSLESIVHLTYFHWC--NE------DAP--HIKKFREHYAE
Kwal_56.23777      RFLELARQYEAKKDY----KTLENIIHHTYFSWE--NE------IPQ--HIKAFREHYNE
                                        *  :    :                   .          

CAGL0L12320g       LVASWPTVTERQILDAME--LGKGMAVRIPHNKT---------LRQMFE--QHEWLVQQR
KNAG0G02060        LVRIWPRESHLSLKQSTK---GHATLKHAWVTNN------KHALQMSFDA-AAANPTSG-
TPHA0J00760        LTHNWPYERHDILFAANKNVPETKALEYLWNNCN------SDNLAFM----GSKFMKEIT
KLLA0F19228g       LAKFWPYEMQHSILEMDD--PNLTSQTILWSRNN------KDALDFLSFN-RHKWLRPKN
Kpol_392.4         LLHHWPYEFHSDVLNMAR--PGTGSLIYLCLNND------DRFFNFYKSQINNKWFNSVD
Suva_10.175        LLSHWPFENHRSLVDSIP--AQNGKLISLTSKGN----WLKADWTTLFQV-KNPWVRTPP
Skud_12.159        LLSHWPFENHRSLVDSIC--AHNGKLNSMASKGT----WLKADWTTLFQV-KNTWVQTPP
YLR091W            LLTHWPFENHRDLVDSIA--VNNGKLNSTSSRSV----WLKADWITLFNV-KNPWVQTPP
Smik_12.150        LLTHWPFENHRLLVDSIA--AHKGKLNSIPSKTT----WLKADWATLFQV-KNPWVQTPP
AGR082C            LQRFWPYERHHSLLALSD--VRSQSLRRLWEDGQ------EEVLQQMQYC-RHHWLREGD
Ecym_4304          LQLFWPYERHSCLLSGER--PYKDSARYLWSRNN------AKVLDIMRYD-RHLWLRDRE
KAFR0B02740        LKSNWPIERHIKFKNA-E--PEAISLRNAWMRNK------ATAVDLSTSD-G--------
NDAI0B02010        LLTFWPHIYHSKI----D--SKKNSIILTWNKSSNSKNMLRELLSHLNYT-QSLVPQKK-
NCAS0B05040        LRRYWPCVYHRGM----D--TKRDSIIVQWAKSNNGDALLKGTMNHIQPG----------
ZYRO0C01562g       LTNHWPYEYQRSLLSMSN--PRKESQGYLWRDGK------ELALSNLRFE-KHRWADENI
TDEL0F03930        MLMHWPYERHRSILNMEK--PRSTSLRYRWEDSS------KTVLSMAEYS-KNPWIEDNI
SAKL0H16940g       LREHWPYERHRDLLSMSA--PERVSIRHMWNDNN------KKVLSSMRFE-RNPWCRNDP
KLTH0G13596g       LRDHWPYEFHRSILSMDT--PKTQSIRFLWSSNS------PKVLSKMSYE-KYAHDTEER
Kwal_56.23777      LRDFWPYECHRTILGMQS--PKSQSIRFLWSAGN------PRVLAAMRYG-SYGWNREGG
                   :   **      .                                               

CAGL0L12320g       LL------------------------------DDKRLKRRRLLRCEVQMATPTTNGSTNG
KNAG0G02060        -----------------------------------NIELRGSLRQILSHYQLLYNNM-RM
TPHA0J00760        RQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFKQLHYINTIN---
KLLA0F19228g       WQTPNEELIKDITGIDGLQSTQITEVL-----RLPAEKIKETLRQIFEHYYFLKTNP-KL
Kpol_392.4         QY------------------------------KLTDEQRVSIYNDIFKQIFFLKRHT-TI
Suva_10.175        PPPSPSLSLAQNSIAEL---------------DAFTAERTFLVKSLGNHYKFLVTNS-HL
Skud_12.159        ASTSPAY----HGGANL---------------DAFTPERTFLVNSLGNHYKFLVANS-HL
YLR091W            SLMR-------LSGTDL---------------DTFTPERIFLINSLGNHYKFLIANS-HL
Smik_12.150        TPKN-------LSETDL---------------DAFTPERAFLVNSLGNQYKFLIANS-HL
AGR082C            VPERY---------------------------ALTQAQREEVLHRVFAQYMFLKQRP-AL
Ecym_4304          PKFSLDSIFGEPFTQQLQYLRHEKDKN-----TLGETERIALLKLIFSHYLFVKSRP-TL
KAFR0B02740        -----------------------------------------VIKPILNHFRYLRVNEDRL
NDAI0B02010        -------------------------------------DFQVIFKKIYQHYIFLSLNP-SL
NCAS0B05040        ----------------------------------ASAEELLMFKKIFQHYIFLTLNA-RI
ZYRO0C01562g       IE------------------------------RLSPEQGTQLLHSIFHQYFFLKSHA-RL
TDEL0F03930        LSK-----------------------------KLTIIQRDLLFHSVFSHYLFLKANP-RL
SAKL0H16940g       LEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNP-KL
KLTH0G13596g       PS------------------------------RLTELQRTVQFHEVFQHFLFLKSRP-HL
Kwal_56.23777      GE------------------------------RLTELERTLRFHEIFQHFLFLQRRP-QL
                                                                               

CAGL0L12320g       NTNGSEISFRQCPLTIRELT-PLGALESEAKFKNRVRSDVHSLWRLLAVQHPPL-SRPHA
KNAG0G02060        FGK-IKL---QVPVAEIPLN-VFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECI
TPHA0J00760        -----KL---QIPIVILPLN-ALGLKIPKSRLYNKFKKKLQ-------------------
KLLA0F19228g       CAT-KKL---QAPIVEIGMK-PDGFDIADIRIDNLFKKKVKLISDLLYSQNPVL-TSDAE
Kpol_392.4         SEVNKNM----VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAI-SLSHE
Suva_10.175        SYNHKKY---PSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPL-STANE
Skud_12.159        SYNHKKY---PPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPL-SADNE
YLR091W            SYNHKKY---PSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPL-SPENE
Smik_12.150        SYNHKKY---PSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPL-SPAND
AGR082C            WSV-RRL---PIPVVEIGMT-PLGFDIPDVRVDGLFKDKTKSVLRLLYREHPAL-TPAAE
Ecym_4304          CGH-KNL---PIPIVEVGMS-PLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL-SREVE
KAFR0B02740        CK--KKV---GLPILEVPLN-VFGTEIPECRVNNLLKKRIAHVKKSLLEDNPML-SPKLE
NDAI0B02010        CSNGKRL---PSPIVEIPMN-AMGYDIPKKRINNLLRSKIARTWNYLAITNPIL-NLENE
NCAS0B05040        TSNAKRL---QPPLVGVPMN-SMGETIPQVRVKNLFRKKVSWTANALCALNPVL-NVENH
ZYRO0C01562g       CYNNRKI---PVPIVEIPLR-PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPL-STRNE
TDEL0F03930        CNNGRNL---PIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRILAIENPVL-SRGSE
SAKL0H16940g       CKYGKKL---PIPIVEIPMK-PLGQDIPLVRIRNLFKRKAAATWKLLAEENPVL-SLENE
KLTH0G13596g       CKTRKGL---AVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALDSPAL-SRQNE
Kwal_56.23777      CKNRKHL---SVPIVEIPMK-PLGQNIADVRIKNLFKRKVAYVWRILAVDNPAL-SAENE
                               *     :    *      .    .                        

CAGL0L12320g       DELVRTLKRTLGTSR----TDRSIARAYLQLLQRAYTYTYTYTDTEAEAQLQYSRVSQLV
KNAG0G02060        AELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLA-STAQEGQNGGVHSFALRMLC
TPHA0J00760        --VFGVF-----------------------------------------------------
KLLA0F19228g       SILTSIV--NDPD------LNRRTKRLYKNVASRSYLFKDGKFEISELARGGFVLSKENL
Kpol_392.4         KIIMNIL--EDTK------DNRRINRLYRRSLKNSYVFD-DTNPIEIT-----YRYASFL
Suva_10.175        LALMTVF--DDGT------LERRHTRLYMRACARAYTIANADSDNEPLT----FRCTHWV
Skud_12.159        LALMAVF--HDDS------LDRRHKRLYMRACARAYTTVNSDSTIEPLT----FRCTQWN
YLR091W            LALTAVF--YDET------VERRLRRLYMRACARAYTTTNADSTTEPLM----FHCTRWE
Smik_12.150        IALMAIF--NDKT------MDRRFKRLYMRACARAYTITNADSTIEPLT----FRCTQWD
AGR082C            EDMLRII--AEC-------PTRAMRRIYLRACRRAYVLD-ADAQL--------FRVSRLR
Ecym_4304          SLLHSII--KEC--------DRSMGRLYKWSCNGAYTMD-PKTNQ--------FEVSSLC
KAFR0B02740        DTLHSII--NDSK------NTRALKRVYLRSCSRAYTGESNPKDSSNIT----FHIIDW-
NDAI0B02010        AQLDEII--NGSSAI----KSRQLRKLYRRACSNSYVIK-NEDDNNIE-----FQKSKKL
NCAS0B05040        GFLDEII--NADYEN----TSRSLRRLYQRASKNAHVIA-GESPESIQ-----FAIAKDL
ZYRO0C01562g       QLLGEII--TKS-------ETRSMRRLYQRASRRAYVVT-NEGKDPNGLQVPEFRPGEIL
TDEL0F03930        NILSEII--SDA-------SSRKQRRLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLL
SAKL0H16940g       ALLLDII--ASPHHSTSV-SNRKIKRLYQRACKHSYVIC-EDRSIGLD-----FQISKLS
KLTH0G13596g       LSLAKII--DSPQLPEDVSSKRELKRLYQRACRGAYTIE-QHPVLGLE-----IKESKLL
Kwal_56.23777      SLLMDII--ESPQLPQGQTSSRMLKRLYQRACRGAYVIK-PHPTLGLE-----IEESKIL
                     :   .                                                     

CAGL0L12320g       SH-----------
KNAG0G02060        PT-----------
TPHA0J00760        -------------
KLLA0F19228g       SENLAAALEEEHN
Kpol_392.4         Q------------
Suva_10.175        D------------
Skud_12.159        -------------
YLR091W            VD-----------
Smik_12.150        H------------
AGR082C            HFI----------
Ecym_4304          RML----------
KAFR0B02740        -------------
NDAI0B02010        NWLNF--------
NCAS0B05040        HRML---------
ZYRO0C01562g       QMSI---------
TDEL0F03930        LNI----------
SAKL0H16940g       KNIS---------
KLTH0G13596g       KRL----------
Kwal_56.23777      KIQ----------
                                

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L12320g
----------------MSGRVLEVFRGLP-LLPLSHEIVARCWDRM----------VRQR
DVYYQFAVHVSHCHERLSTRNLLRLVTHVHHVLAPMNE------LPA--HLRQYQSEYHA
LVASWPTVTERQILDAME--LGKGMAVRIPHNKT---------LRQMFE--QHEWLVQQR
LL------------------------------DDKRLKRRRLLRCEVQMATPTTNGSTNG
NTNGSEISFRQCPLTIRELT-PLGALESEAKFKNRVRSDVHSLWRLLAVQHPPL-SRPHA
DELVRTLKRTLGTSR----TDRSIARAYLQLLQRAYTYTYTYTDTEAEAQLQYSRVSQLV
SH-----------
>KNAG0G02060
-------------MNTVRTGLLRELRSLP-LHSLTLARLSRHVAAT----KSIPRLKHVA
ETLQNFHDVPSTKKH-TQYKILTTLLLQLYCQWD--NSFSRLSHLPP--HLAPFEQDFPG
LVRIWPRESHLSLKQSTK---GHATLKHAWVTNN------KHALQMSFDA-AAANPTSG-
-----------------------------------NIELRGSLRQILSHYQLLYNNM-RM
FGK-IKL---QVPVAEIPLN-VFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECI
AELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLA-STAQEGQNGGVHSFALRMLC
PT-----------
>TPHA0J00760
MLKLNRNILKNHESLDFKQIILDGLNRLP-LHPNTLDLLQKQVHTK------LTKNSELI
ELLFDYNNAFINKQKPGQLKCLQRIIFKTHLIFN--NS------YKNYDHLKAFKLKYNY
LTHNWPYERHDILFAANKNVPETKALEYLWNNCN------SDNLAFM----GSKFMKEIT
RQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFKQLHYINTIN---
-----KL---QIPIVILPLN-ALGLKIPKSRLYNKFKKKLQ-------------------
--VFGVF-----------------------------------------------------
-------------
>KLLA0F19228g
----------------MKASLLRTSKLYKGLHSITKDAISKVDTFP---------KNKQH
ETLHRLNSFNENPTR----KTLEKLVYSVHFHLL--ND------PPK--HVDILRQYPNE
LAKFWPYEMQHSILEMDD--PNLTSQTILWSRNN------KDALDFLSFN-RHKWLRPKN
WQTPNEELIKDITGIDGLQSTQITEVL-----RLPAEKIKETLRQIFEHYYFLKTNP-KL
CAT-KKL---QAPIVEIGMK-PDGFDIADIRIDNLFKKKVKLISDLLYSQNPVL-TSDAE
SILTSIV--NDPD------LNRRTKRLYKNVASRSYLFKDGKFEISELARGGFVLSKENL
SENLAAALEEEHN
>Kpol_392.4
------MTSVKDLGKRLKPILLESLERLP-LHKPTLDILERRIHVA-----DLPFMEEYV
GILNEYEISKINSKVENESRALEKIVKKTHIVWN--ND-----KFPN--HLEKFKNHYME
LLHHWPYEFHSDVLNMAR--PGTGSLIYLCLNND------DRFFNFYKSQINNKWFNSVD
QY------------------------------KLTDEQRVSIYNDIFKQIFFLKRHT-TI
SEVNKNM----VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAI-SLSHE
KIIMNIL--EDTK------DNRRINRLYRRSLKNSYVFD-DTNPIEIT-----YRYASFL
Q------------
>Suva_10.175
------------MISQANSLLLPFIDSLP-LHQITKTALTTRLTDIHSDFKFKEIAVPLT
ESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWN--NP------RPR--HAHLFQKHYHF
LLSHWPFENHRSLVDSIP--AQNGKLISLTSKGN----WLKADWTTLFQV-KNPWVRTPP
PPPSPSLSLAQNSIAEL---------------DAFTAERTFLVKSLGNHYKFLVTNS-HL
SYNHKKY---PSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPL-STANE
LALMTVF--DDGT------LERRHTRLYMRACARAYTIANADSDNEPLT----FRCTHWV
D------------
>Skud_12.159
------------MTSRIKGVLLPFIESLP-LHRITKTALTTTLVGIQSDYKFKEIAVPLT
ESLQVYEKAQRRQDLRTSLKALESIIFQTHFQWN--NP------RPR--HALLFQKHHYF
LLSHWPFENHRSLVDSIC--AHNGKLNSMASKGT----WLKADWTTLFQV-KNTWVQTPP
ASTSPAY----HGGANL---------------DAFTPERTFLVNSLGNHYKFLVANS-HL
SYNHKKY---PPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPL-SADNE
LALMAVF--HDDS------LDRRHKRLYMRACARAYTTVNSDSTIEPLT----FRCTQWN
-------------
>YLR091W
------------MASQVNALLLPVIESTP-LHQITKVALTTTLTSKQSDYKFKEIAVPLT
KSLQLYEKAQRRQDLRASLKALESIIYQTHFQWN--NP------LPR--HAHLFQKHYHF
LLTHWPFENHRDLVDSIA--VNNGKLNSTSSRSV----WLKADWITLFNV-KNPWVQTPP
SLMR-------LSGTDL---------------DTFTPERIFLINSLGNHYKFLIANS-HL
SYNHKKY---PSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPL-SPENE
LALTAVF--YDET------VERRLRRLYMRACARAYTTTNADSTTEPLM----FHCTRWE
VD-----------
>Smik_12.150
------------MASRVNDLLLPVIQSIP-LHQITKNALVTTLTDTQSDYKFKEIAVPLT
KLLQVHEKAQRRQDLRTALKALESIIYQTHFKWN--NP------RPR--HALLFQKHYHF
LLTHWPFENHRLLVDSIA--AHKGKLNSIPSKTT----WLKADWATLFQV-KNPWVQTPP
TPKN-------LSETDL---------------DAFTPERAFLVNSLGNQYKFLIANS-HL
SYNHKKY---PSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPL-SPAND
IALMAIF--NDKT------MDRRFKRLYMRACARAYTITNADSTIEPLT----FRCTQWD
H------------
>AGR082C
----------------MNEHIQRIVSRLP-LHRATSEVILAYLSKQ-----QAQYPTERI
ELVEPLNDFLRKGGH----QGLQRLVFHVHFQLM--LR------APE--HLRLLRRHREE
LQRFWPYERHHSLLALSD--VRSQSLRRLWEDGQ------EEVLQQMQYC-RHHWLREGD
VPERY---------------------------ALTQAQREEVLHRVFAQYMFLKQRP-AL
WSV-RRL---PIPVVEIGMT-PLGFDIPDVRVDGLFKDKTKSVLRLLYREHPAL-TPAAE
EDMLRII--AEC-------PTRAMRRIYLRACRRAYVLD-ADAQL--------FRVSRLR
HFI----------
>Ecym_4304
-------------MGGMNRKVLEIVSRLP-LHAHTKKVIADNVGSV------GKGEFKRV
DVIEPINRYLLSGEV----SYLRRVIFDVYFRIL--NP------KAE--HVRQFERYLKE
LQLFWPYERHSCLLSGER--PYKDSARYLWSRNN------AKVLDIMRYD-RHLWLRDRE
PKFSLDSIFGEPFTQQLQYLRHEKDKN-----TLGETERIALLKLIFSHYLFVKSRP-TL
CGH-KNL---PIPIVEVGMS-PLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL-SREVE
SLLHSII--KEC--------DRSMGRLYKWSCNGAYTMD-PKTNQ--------FEVSSLC
RML----------
>KAFR0B02740
-MSGRAPCIRTLVTKEVRDKITNAIEGLP-LHQKTLLQLQDTLKRN---------DALAI
PLLRDVVSYETTGKS----KFLESIIYRLYFQWL--NE------VPS--HLKPLLNQYEH
LKSNWPIERHIKFKNA-E--PEAISLRNAWMRNK------ATAVDLSTSD-G--------
-----------------------------------------VIKPILNHFRYLRVNEDRL
CK--KKV---GLPILEVPLN-VFGTEIPECRVNNLLKKRIAHVKKSLLEDNPML-SPKLE
DTLHSII--NDSK------NTRALKRVYLRSCSRAYTGESNPKDSSNIT----FHIIDW-
-------------
>NDAI0B02010
---------MELLNSKLTKTLLSSLQNLP-LHSNTLAQLERKCLTR-NIKATKSFKIPLL
TLINSYEKAQASGQSKLSNKTLESIIYHTYFEWT--ND------LAS--HLKPFQRQYST
LLTFWPHIYHSKI----D--SKKNSIILTWNKSSNSKNMLRELLSHLNYT-QSLVPQKK-
-------------------------------------DFQVIFKKIYQHYIFLSLNP-SL
CSNGKRL---PSPIVEIPMN-AMGYDIPKKRINNLLRSKIARTWNYLAITNPIL-NLENE
AQLDEII--NGSSAI----KSRQLRKLYRRACSNSYVIK-NEDDNNIE-----FQKSKKL
NWLNF--------
>NCAS0B05040
------------MEKSVTTTLLRSLPNVP-LHRKTLDLLERKIQTANDKSTRHSFKVPLL
QLLCKYERYNIQEDKRGIEKVLESIAYNTYFIWN--NP------VPS--HLQVFQKNNEM
LRRYWPCVYHRGM----D--TKRDSIIVQWAKSNNGDALLKGTMNHIQPG----------
----------------------------------ASAEELLMFKKIFQHYIFLTLNA-RI
TSNAKRL---QPPLVGVPMN-SMGETIPQVRVKNLFRKKVSWTANALCALNPVL-NVENH
GFLDEII--NADYEN----TSRSLRRLYQRASKNAHVIA-GESPESIQ-----FAIAKDL
HRML---------
>ZYRO0C01562g
--------MVSSNLQELIPALSRSIRQLP-LHIETQKVLEFYCRNS---------SYKSL
LVAQDISEFEKHNDH----KYLEALIQKTHFLWD--NP------LPP--FLKRFQLYHKE
LTNHWPYEYQRSLLSMSN--PRKESQGYLWRDGK------ELALSNLRFE-KHRWADENI
IE------------------------------RLSPEQGTQLLHSIFHQYFFLKSHA-RL
CYNNRKI---PVPIVEIPLR-PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPL-STRNE
QLLGEII--TKS-------ETRSMRRLYQRASRRAYVVT-NEGKDPNGLQVPEFRPGEIL
QMSI---------
>TDEL0F03930
------------MTQQLVQPLLKALEKLP-LHSKTLDLLACKLKGD----ELKTVIIPLA
KLVSNLESSRAETQR---IKALESIIYHTHFVWG--SP------LPV--HLKMFQSHYTD
MLMHWPYERHRSILNMEK--PRSTSLRYRWEDSS------KTVLSMAEYS-KNPWIEDNI
LSK-----------------------------KLTIIQRDLLFHSVFSHYLFLKANP-RL
CNNGRNL---PIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRILAIENPVL-SRGSE
NILSEII--SDA-------SSRKQRRLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLL
LNI----------
>SAKL0H16940g
--------------MNRVKTLLNFLECLP-LDTRTLDLLEGTVKLC--------SSALLD
TLEQKLFDYQANENS----KSLEWIVYNTYFHWN--NT------TPL--HIQKFRQNYHD
LREHWPYERHRDLLSMSA--PERVSIRHMWNDNN------KKVLSSMRFE-RNPWCRNDP
LEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNP-KL
CKYGKKL---PIPIVEIPMK-PLGQDIPLVRIRNLFKRKAAATWKLLAEENPVL-SLENE
ALLLDII--ASPHHSTSV-SNRKIKRLYQRACKHSYVIC-EDRSIGLD-----FQISKLS
KNIS---------
>KLTH0G13596g
-----------------MNMAVRALEKLP-LDIRTLELLERKLLKK-----------SLP
GFQELAQQYTADGSS----KSLESIVHLTYFHWC--NE------DAP--HIKKFREHYAE
LRDHWPYEFHRSILSMDT--PKTQSIRFLWSSNS------PKVLSKMSYE-KYAHDTEER
PS------------------------------RLTELQRTVQFHEVFQHFLFLKSRP-HL
CKTRKGL---AVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALDSPAL-SRQNE
LSLAKII--DSPQLPEDVSSKRELKRLYQRACRGAYTIE-QHPVLGLE-----IKESKLL
KRL----------
>Kwal_56.23777
-----------------MNRGIQVLEKLP-LDVRTLKLIEKRLERA-----------ESL
RFLELARQYEAKKDY----KTLENIIHHTYFSWE--NE------IPQ--HIKAFREHYNE
LRDFWPYECHRTILGMQS--PKSQSIRFLWSAGN------PRVLAAMRYG-SYGWNREGG
GE------------------------------RLTELERTLRFHEIFQHFLFLQRRP-QL
CKNRKHL---SVPIVEIPMK-PLGQNIADVRIKNLFKRKVAYVWRILAVDNPAL-SAENE
SLLMDII--ESPQLPQGQTSSRMLKRLYQRACRGAYVIK-PHPTLGLE-----IEESKIL
KIQ----------