MUSCLE (3.8) multiple sequence alignment

KNAG0G02050        ------------------------------------------------------------
CAGL0L12276g       ------------------------------------------------------------
Suva_10.174        ------------------------------------------------------------
Skud_12.158        ------------------------------------------------------------
Smik_12.149        ------------------------------------------------------------
YLR090W            ------------------------------------------------------------
NDAI0B02000        ------------------------------------------------------------
NCAS0B05030        ------------------------------------------------------------
ZYRO0C01606g       ------------------------------------------------------------
TDEL0F03910        ------------------------------------------------------------
KLLA0F19184g       MTYSVFNVKYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRL
AGR084C            ------------------------------------------------------------
Ecym_4306          ------------------------------------------------------------
SAKL0H16984g       ------------------------------------------------------------
KLTH0G13640g       ------------------------------------------------------------
Kwal_56.23782      ------------------------------------------------------------
TPHA0A01790        ------------------------------------------------------------
Kpol_543.40        ------------------------------------------------------------
                                                                               

KNAG0G02050        -------MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVI-----DPEEKASNEM
CAGL0L12276g       ----------MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDV
Suva_10.174        ---MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSV-----DQDSKELNET
Skud_12.158        ---MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-----DQDSKDVNEI
Smik_12.149        ---MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-----DQNSKEVNEI
YLR090W            ---MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-----DQDSKEVNEI
NDAI0B02000        ---------MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVL-----DPNDREENEI
NCAS0B05030        ---------MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS---NSDDREASEI
ZYRO0C01606g       ----------MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVT-----DDSVREESEV
TDEL0F03910        ---------MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVA-----DESLREESEV
KLLA0F19184g       TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKII-----DEAERETSEA
AGR084C            --------MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS-----DESEREASEA
Ecym_4306          --------MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS-----DESQRAESEA
SAKL0H16984g       ---------MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVA-----DEVLREESEM
KLTH0G13640g       ----------MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLRDESEI
Kwal_56.23782      ----------MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLREESEI
TPHA0A01790        -MSNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYEL
Kpol_543.40        MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI-----DEGQKLINEI
                                *  * :       ::.  **. ** .****       :       : 

KNAG0G02050        KFKEITTAYEILSNGEYVEEMEEEYEGQGYGFNFG----------DDFMNFFNEGRNAHP
CAGL0L12276g       DFKEVTAAYQVLSDASLRAEYDQKLAFE---------AQPY--GDDDFMNFF----SGFN
Suva_10.174        KFKEITAAYEILSDPEKKSHYDLYGDDNGT---GG--GDEF--GDDDFMNFF---NNFFN
Skud_12.158        KFKEITAAYEILSDPEKKSHYDLYGDDNGTANGGG--TDGF--GNDDFMNFF---NNFFN
Smik_12.149        KFKEITAAYEILSDPEKKSHYDLYGDDYGTAGSTG--ADGF--GDDDFMNFF---NNFFN
YLR090W            KFKEITAAYEILSDPEKKSHYDLYGDDNGAASSGG--ANGF--GDEDFMNFF---NNFFN
NDAI0B02000        KFKEITSAYEILSDEEKRAHYDLYGDAN---------ENEY--NNQNANDFF-----NFE
NCAS0B05030        KFKEISAAYEILSDEDKRAHYDLYGSEEEQQRQQR--------QYDPFESFF-----NFE
ZYRO0C01606g       RFKEITAAYEVLSDEEKRSKYDTYGDTA-----DG--P-DF--EDESFMNFFTQFNSGFG
TDEL0F03910        RFKEIAAAYEVLGDEEKRARYDKYGDADGSDFFNG--PNEF--EDAAFMNFF----HSFG
KLLA0F19184g       MFKEVTAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDH--EFDDFMNFF----QQYQ
AGR084C            KFKEISAAYAVLSDEQKRAEYDQFGTVDGG---YG--HDEFGHGDDDFMNFF-----RYG
Ecym_4306          KFKEISAAYDILSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF-----RYG
SAKL0H16984g       KFKEITAAYEILSDEDSRKKYDVYGDDAPGASGGG--GDPF--GDDDFMNFF----RTYA
KLTH0G13640g       KFKEVAAAYELLSNEEKRQNYDTYGDTNGFSGDYS----GF--QDGDFASFF----GNFA
Kwal_56.23782      KFKEVAAAYELLSNEEKRRNYDTYGDTNGYSDSYG----GF--QDGDFASFF----GNFA
TPHA0A01790        KFKEIISAYEILSDEEKRKQYDL--------------QKNF--RDANQ-------GSDYG
Kpol_543.40        KFKDITAAYQTLSDEDKRNEYD---------------------NKKNFEPYF---ESDFA
                    **:: :**  *.: .     :                                    . 

KNAG0G02050        MGGHPQR-----------EDESTNEATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGN
CAGL0L12276g       GGSHPGH--RSGFDSGRGARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGT
Suva_10.174        NGAHEANDFPNEHEMYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGS
Skud_12.158        DGGHEGNGFSNEYKMYEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGS
Smik_12.149        SGDHEGNDFPREYDTYEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGS
YLR090W            NGSHDGNNFPGEYDAYEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGS
NDAI0B02000        TDQPD--------YDSYAFDNDKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGL
NCAS0B05030        QDEEPSR-------HYEDPK--RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGL
ZYRO0C01606g       FNGGGGG-----GFPGAQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGS
TDEL0F03910        SNPQNAY------DHYGEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGS
KLLA0F19184g       RQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGT
AGR084C            AGRHGYQ-----HEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGS
Ecym_4306          AGRYGQY------EDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGL
SAKL0H16984g       GGGFYDE--PRQPYPEEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGS
KLTH0G13640g       SNRYQDE------YEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGT
Kwal_56.23782      SGRYEDE------EDFRAHARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGA
TPHA0A01790        DGINTAF------------GNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGL
Kpol_543.40        NN-HDGN--------YNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGL
                                          .    :   ..  : * ** . :   *   *  * * 

KNAG0G02050        CWRRRKNGDLYSPPVL---SCTKCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAK
CAGL0L12276g       GWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNL
Suva_10.174        GWKAKKKVH--VTHEM---ECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKR
Skud_12.158        GWKTKKRVH--VTHEV---ECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKS
Smik_12.149        GWKLKKKIH--VTHEV---ECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKR
YLR090W            GWKPKRKIH--VTHDV---ECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKR
NDAI0B02000        GWRRRKNGNVTIPHEI---ECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAK
NCAS0B05030        GWRRRKNGQVTVPPEV---ECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAK
ZYRO0C01606g       GWRRRSGG---PPPQT---NCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSK
TDEL0F03910        GWRRRND-HVVPPPQV---ECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASK
KLLA0F19184g       GLRKKHF----QKPEI---SCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKK
AGR084C            GLRKRAA----ARPMI---RCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGK--RI
Ecym_4306          GLRKRAA----HCMPM---KCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSR
SAKL0H16984g       GLRKKFQQH--PRKPV---VCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGR--TT
KLTH0G13640g       GVRRR------ARHAS---ACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLR-
Kwal_56.23782      GIRKR------ARHAS---ACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR-
TPHA0A01790        GWRSRKNGKQYVPPLT---ECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKK
Kpol_543.40        GWRTKKDGKPYVPPEI---ECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKK
                     . .               *  * * *  :            :   *  * * *     

KNAG0G02050        PTSDKNKCKLC---HGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVF
CAGL0L12276g       PKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVI
Suva_10.174        PKNRKNFCPDC---ESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIF
Skud_12.158        PKNPKNFCPDC---AGVGLQSKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRF
Smik_12.149        PKNPKNFCPDC---AGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKF
YLR090W            PKNPKNFCPDC---AGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF
NDAI0B02000        PNSEKNKCKNC---HGKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIIL
NCAS0B05030        ANSEKNKCKKC---HGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIF
ZYRO0C01606g       PTSEKNQCKKC---RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIF
TDEL0F03910        PNNDKNKCKKC---VGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVF
KLLA0F19184g       --SASDTCKHC---SGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGK-ETGDVII
AGR084C            PTTAADNCKKC---TGKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGK-ETGDLVF
Ecym_4306          --DPSDNCKKC---HGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGK-ETGDLVF
SAKL0H16984g       PTKPEDHCKKC---HGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDK-VTGDLLF
KLTH0G13640g       ---SEDMCKKC---HGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGK-IPGDLVF
Kwal_56.23782      ---SEDLCKKC---HGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGK-LTGDLVF
TPHA0A01790        PASSKNFCLKC---NGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIF
Kpol_543.40        PNSPKNFCKDC---NGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIF
                        : *  *       :    .   : :  *    : .     .* :  .   *:: :

KNAG0G02050        RLKLHDEPNGGDPDILV---TKEGT-DLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLT
CAGL0L12276g       KIQEVKEPQY--DI------VRNGY-DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWS
Suva_10.174        HLVEKPEDLQQKQVLMKKFGGGNLQ-DLYVSITVSLSEALTGF-EKFLTRTFDDRLLTLS
Skud_12.158        HLNERQEDWFAKQVFLKNFGDGNME-DSYVSVTISLSEALTGF-EKFLTKTFDDRLLTLS
Smik_12.149        HLVEKQENLEQKQIFLKNFDEGSAE-DLYTSATISLSEALTGF-EKFLTRTFDDRLLTLS
YLR090W            HLTEKQENLEQKQIFLKNFDDGAGE-DLYTSITISLSEALTGF-EKFLTKTFDDRLLTLS
NDAI0B02000        VIEEDTTMPSDVHF------IRKGT-DFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLS
NCAS0B05030        SIEEDQRCPKDVQL------ERKGS-NFMTELNISLAEALTGFKDKFVTKTFDGRILNLS
ZYRO0C01606g       IVDEGTEPPEGVRL------ERRGY-DLITNISISLAEAITGL-DRTLTKTLDGRVLKLS
TDEL0F03910        TIKEGTECPEGVDL------QRHGF-DLITHLTLSLAEAITGF-SKTLTKTLDGRILQLQ
KLLA0F19184g       VIDEDSSKS---HL------ERKSN-DLHTTLNISLVDALTGF-STIVCETYDNRRLRVN
AGR084C            VIDEQTDVSS--SL------ERKGT-DLYCTMKISLAEALTGF-TRIVTRTFDERVLRIN
Ecym_4306          EIDEITDPDA--EL------ERKGT-DLHCSITISLAEALTGF-TRLVARTFDDRLLRIT
SAKL0H16984g       VIEENPETST--NL------ERRGD-DLHTRLKISLSEAITGF-EKVVTTTLDDRILKLK
KLTH0G13640g       DIAENSASS---SL------ERRGS-DLYAKITISLSDALTGF-EKEVCTTLDGRLLKLK
Kwal_56.23782      DISEDSTTS---NL------ERRGS-DLHTKIIISLSDALTGF-EKEVCTTLDGRDLRLK
TPHA0A01790        VLEEIDDEQT--AL------KRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLS
Kpol_543.40        EINEIIDSNN--DL------ERYGN-HLINHTHISLAEAITGFENKFIVKTFDDRDLYLS
                    :                               : * :*: *     :  : * * *   

KNAG0G02050        MPQGKVLRPGDTIVIKGEGWP-KTPNGT-----EFGDMFVHVNVEFPPDNWISERNDITT
CAGL0L12276g       SKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRA
Suva_10.174        IKPGKVIRPGDIIKITNEGWPILDHPRG-----QCGDLYVFVDIEFPPDNWFNEKSELLA
Skud_12.158        IKPGRVIRPGDVLKITNEGWPILDDARG-----RCGDLYVFIHIEFPPDNWFNEKSELLG
Smik_12.149        IKPGRVIRPGDVIKITNEGWPIMDDPRG-----QRGDLYVFIHIEFPPDNWFNEKSELLA
YLR090W            VKPGRVVRPGDTIKIANEGWPILDNPHG-----RCGDLYVFVHIEFPPDNWFNEKSELLA
NDAI0B02000        VPSGKVIRPGNIIKIKQEGWP-VNPQAS-----KFGDLYVIIKIEFPPDNWFSEKSDIQL
NCAS0B05030        IPPGKVIRPGNIIKIEQEGWP-LNGEAT-----KFGDLYISVNIEFPPDNWFTEKSDLTQ
ZYRO0C01606g       TPAGKVISPGKIIKVEQEGWP-LNSHAT-----KFGDLYVLVDIVFPRDNWFAEKSDLLK
TDEL0F03910        IPPGKVIRPGNIIQIPHEGWP-IDTTTS-------GDLYVVVHIEFPPDNWFSERSDLTQ
KLLA0F19184g       VPAGKVIRPGNYFKFKGEGWP-LSN-GD-----SFGDMYVQINIEFPKDNWFNEKSEITA
AGR084C            IPRGKVLRPGNYLKFTNEGWP-IED-GA-----RFGDMYVQVLIEFPKDNWFNEKAELDA
Ecym_4306          IPSGKVLRPGNYLKFTNEGWP-INN-GS-----RFGDLYVKVNIEFPKDNWLNEKSELEA
SAKL0H16984g       IPQGKVIRPGNYIRLENEGWP-LDDSGN-----KFGDMYVQVHIEFPPDNWFSEKSDVEV
KLTH0G13640g       VPLGQVVRPGNFVRIDNEGWP-LDDQGS-----KFGDMYVQIDIEFPPDHWFSERSDVKS
Kwal_56.23782      IPTGQVIRPGNYICLKNEGWP-LDDEGK-----KFGNMYVQINIEFPPDHWYSERGEIEA
TPHA0A01790        IPVGKVIRFGDILKVEGEGWP-LNKNAT-----RSGDLYIKFNIEFPADNWNSEMNDIIK
Kpol_543.40        TPKGKVIRPGDILEVKNEGWP-MDKYGA-----SFGNLYVILEIEFPPDNWINEKNDIIK
                      *.*:  .. . .  ****              *:::: . : ** *:*  *  :   

KNAG0G02050        LTNVLPAGKSDDGHAQT------GDA----NNAEFVKDYEIL---KATD--EGTRSSNTK
CAGL0L12276g       VRNIIPSTINKRESSTSG-----ESI----LNVENINVSEIV---KEIPNCDELPKFQDT
Suva_10.174        IKTHLPSSTSRPSNTTVNTGSD-NSP----INSETVSNFQIIHS-DDLP--EGMKTFNPK
Skud_12.158        IKTNLPSSSSSSCASGDA-----NDL----INNETVSNFQIIHT-DDLP--EGVKTFKPK
Smik_12.149        IKTMLPSSSSCTFQTTANTGEDDRNP----INNETISNFQIINM-EELP--EGMKIFNSE
YLR090W            IKTNLPSSSSCASHATVNTEDD-SNL----TNNETISNFRIIHT-DDLP--EGIRPFKPE
NDAI0B02000        LRNVLPSGINGMMNSWKI-----DDP----LNTETVTTFDIL---EELP--DTLNESNNR
NCAS0B05030        IKNILPRSTSDKTKLS-------DDP----LNTELLLKFEVL---ETLP--DTLKEGQDQ
ZYRO0C01606g       IRNILPSEAANNDVK--------ADP----GNTEQVSDMKLV---DQLP--DYMGSNGDQ
TDEL0F03910        VKNVLPGETNNNAAVE-------DDP----GNTETVTNINIV---EEIP--DPSQDDRFR
KLLA0F19184g       LRNILPGLKSKDTKD--------PDP----LNTEDVLSYSVLHSHDELP--DYLAEEKEK
AGR084C            IRNILPGLADAPSTKT-------EDP----SNTEEVRAYSIIANHTGLP--DYLDRENQG
Ecym_4306          IKHILPGLKNSSNSHQGDG----DDP----ANTEDINSYYVIQDSSRLP--DYLAQEGQQ
SAKL0H16984g       LRTLLPEVPNARVADT-------GDL----NNTETVIDYSVVKSADELP--DYLSYEKGE
KLTH0G13640g       LQNLLPQAVSSSATSDFNASA--SDP----ANTETPLKFSIVKSAEELP--QYLSEESEP
Kwal_56.23782      LRNIIPQSTSSSAASSSASAE--PDP----VNTE-MPTFDILKSAEELP--NYLPDDAEQ
TPHA0A01790        IRNLLPAISDAKADILGDMPK--DDIFNITMNSEDISNYDFV---KDLP--DIIDTSHNN
Kpol_543.40        IRNILPNEKTKRNNI--------VDP----INSEYISTFEIV---KSLP--QEEGEEQTE
                   :   :*                  .      * *      .:         :        

KNAG0G02050        T--ASRPPAQGLYK----------CSIQ
CAGL0L12276g       YDNTNDKGESPFWT----PN----CSQQ
Suva_10.174        P--QTSAHQKASS-----SY----CPMQ
Skud_12.158        P--QNPAHKKARS-----AY----CPMQ
Smik_12.149        S--QNSAHQKAKS-----SY----CPMQ
YLR090W            A--QDSAHQKARS-----SY----CCIQ
NDAI0B02000        SAYDTGDQSDANYDREGPPQ----CSQQ
NCAS0B05030        G--ENNAESHGEYRGEGSPQ----CAQQ
ZYRO0C01606g       Y--AHEGHASGAFPDDGTPQ----CAQQ
TDEL0F03910        S--RDDDKANDF------PG----CAQQ
KLLA0F19184g       YNRKQQEEPHASAFDNDYTQMPSECATQ
AGR084C            Y--SRQQHESTAGT----PE----CPMQ
Ecym_4306          R--SNQQYGERNTA----SE----CPVQ
SAKL0H16984g       Y--QGQEQEYGAFEE---PQ----CAQQ
KLTH0G13640g       G-----------------PQ----CAQQ
Kwal_56.23782      G--G--------------PQ----CSQQ
TPHA0A01790        GAEYGHNGDSANFTEM--PE----CSQQ
Kpol_543.40        H--DTN------------PS----CAQM
                                           *   

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0G02050
------------------------------------------------------------
-------MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVI-----DPEEKASNEM
KFKEITTAYEILSNGEYVEEMEEEYEGQGYGFNFG----------DDFMNFFNEGRNAHP
MGGHPQR-----------EDESTNEATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGN
CWRRRKNGDLYSPPVL---SCTKCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAK
PTSDKNKCKLC---HGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVF
RLKLHDEPNGGDPDILV---TKEGT-DLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLT
MPQGKVLRPGDTIVIKGEGWP-KTPNGT-----EFGDMFVHVNVEFPPDNWISERNDITT
LTNVLPAGKSDDGHAQT------GDA----NNAEFVKDYEIL---KATD--EGTRSSNTK
T--ASRPPAQGLYK----------CSIQ
>CAGL0L12276g
------------------------------------------------------------
----------MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDV
DFKEVTAAYQVLSDASLRAEYDQKLAFE---------AQPY--GDDDFMNFF----SGFN
GGSHPGH--RSGFDSGRGARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGT
GWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNL
PKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVI
KIQEVKEPQY--DI------VRNGY-DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWS
SKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRA
VRNIIPSTINKRESSTSG-----ESI----LNVENINVSEIV---KEIPNCDELPKFQDT
YDNTNDKGESPFWT----PN----CSQQ
>Suva_10.174
------------------------------------------------------------
---MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSV-----DQDSKELNET
KFKEITAAYEILSDPEKKSHYDLYGDDNGT---GG--GDEF--GDDDFMNFF---NNFFN
NGAHEANDFPNEHEMYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGS
GWKAKKKVH--VTHEM---ECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKR
PKNRKNFCPDC---ESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIF
HLVEKPEDLQQKQVLMKKFGGGNLQ-DLYVSITVSLSEALTGF-EKFLTRTFDDRLLTLS
IKPGKVIRPGDIIKITNEGWPILDHPRG-----QCGDLYVFVDIEFPPDNWFNEKSELLA
IKTHLPSSTSRPSNTTVNTGSD-NSP----INSETVSNFQIIHS-DDLP--EGMKTFNPK
P--QTSAHQKASS-----SY----CPMQ
>Skud_12.158
------------------------------------------------------------
---MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-----DQDSKDVNEI
KFKEITAAYEILSDPEKKSHYDLYGDDNGTANGGG--TDGF--GNDDFMNFF---NNFFN
DGGHEGNGFSNEYKMYEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGS
GWKTKKRVH--VTHEV---ECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKS
PKNPKNFCPDC---AGVGLQSKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRF
HLNERQEDWFAKQVFLKNFGDGNME-DSYVSVTISLSEALTGF-EKFLTKTFDDRLLTLS
IKPGRVIRPGDVLKITNEGWPILDDARG-----RCGDLYVFIHIEFPPDNWFNEKSELLG
IKTNLPSSSSSSCASGDA-----NDL----INNETVSNFQIIHT-DDLP--EGVKTFKPK
P--QNPAHKKARS-----AY----CPMQ
>Smik_12.149
------------------------------------------------------------
---MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-----DQNSKEVNEI
KFKEITAAYEILSDPEKKSHYDLYGDDYGTAGSTG--ADGF--GDDDFMNFF---NNFFN
SGDHEGNDFPREYDTYEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGS
GWKLKKKIH--VTHEV---ECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKR
PKNPKNFCPDC---AGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKF
HLVEKQENLEQKQIFLKNFDEGSAE-DLYTSATISLSEALTGF-EKFLTRTFDDRLLTLS
IKPGRVIRPGDVIKITNEGWPIMDDPRG-----QRGDLYVFIHIEFPPDNWFNEKSELLA
IKTMLPSSSSCTFQTTANTGEDDRNP----INNETISNFQIINM-EELP--EGMKIFNSE
S--QNSAHQKAKS-----SY----CPMQ
>YLR090W
------------------------------------------------------------
---MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-----DQDSKEVNEI
KFKEITAAYEILSDPEKKSHYDLYGDDNGAASSGG--ANGF--GDEDFMNFF---NNFFN
NGSHDGNNFPGEYDAYEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGS
GWKPKRKIH--VTHDV---ECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKR
PKNPKNFCPDC---AGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF
HLTEKQENLEQKQIFLKNFDDGAGE-DLYTSITISLSEALTGF-EKFLTKTFDDRLLTLS
VKPGRVVRPGDTIKIANEGWPILDNPHG-----RCGDLYVFVHIEFPPDNWFNEKSELLA
IKTNLPSSSSCASHATVNTEDD-SNL----TNNETISNFRIIHT-DDLP--EGIRPFKPE
A--QDSAHQKARS-----SY----CCIQ
>NDAI0B02000
------------------------------------------------------------
---------MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVL-----DPNDREENEI
KFKEITSAYEILSDEEKRAHYDLYGDAN---------ENEY--NNQNANDFF-----NFE
TDQPD--------YDSYAFDNDKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGL
GWRRRKNGNVTIPHEI---ECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAK
PNSEKNKCKNC---HGKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIIL
VIEEDTTMPSDVHF------IRKGT-DFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLS
VPSGKVIRPGNIIKIKQEGWP-VNPQAS-----KFGDLYVIIKIEFPPDNWFSEKSDIQL
LRNVLPSGINGMMNSWKI-----DDP----LNTETVTTFDIL---EELP--DTLNESNNR
SAYDTGDQSDANYDREGPPQ----CSQQ
>NCAS0B05030
------------------------------------------------------------
---------MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS---NSDDREASEI
KFKEISAAYEILSDEDKRAHYDLYGSEEEQQRQQR--------QYDPFESFF-----NFE
QDEEPSR-------HYEDPK--RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGL
GWRRRKNGQVTVPPEV---ECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAK
ANSEKNKCKKC---HGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIF
SIEEDQRCPKDVQL------ERKGS-NFMTELNISLAEALTGFKDKFVTKTFDGRILNLS
IPPGKVIRPGNIIKIEQEGWP-LNGEAT-----KFGDLYISVNIEFPPDNWFTEKSDLTQ
IKNILPRSTSDKTKLS-------DDP----LNTELLLKFEVL---ETLP--DTLKEGQDQ
G--ENNAESHGEYRGEGSPQ----CAQQ
>ZYRO0C01606g
------------------------------------------------------------
----------MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVT-----DDSVREESEV
RFKEITAAYEVLSDEEKRSKYDTYGDTA-----DG--P-DF--EDESFMNFFTQFNSGFG
FNGGGGG-----GFPGAQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGS
GWRRRSGG---PPPQT---NCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSK
PTSEKNQCKKC---RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIF
IVDEGTEPPEGVRL------ERRGY-DLITNISISLAEAITGL-DRTLTKTLDGRVLKLS
TPAGKVISPGKIIKVEQEGWP-LNSHAT-----KFGDLYVLVDIVFPRDNWFAEKSDLLK
IRNILPSEAANNDVK--------ADP----GNTEQVSDMKLV---DQLP--DYMGSNGDQ
Y--AHEGHASGAFPDDGTPQ----CAQQ
>TDEL0F03910
------------------------------------------------------------
---------MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVA-----DESLREESEV
RFKEIAAAYEVLGDEEKRARYDKYGDADGSDFFNG--PNEF--EDAAFMNFF----HSFG
SNPQNAY------DHYGEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGS
GWRRRND-HVVPPPQV---ECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASK
PNNDKNKCKKC---VGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVF
TIKEGTECPEGVDL------QRHGF-DLITHLTLSLAEAITGF-SKTLTKTLDGRILQLQ
IPPGKVIRPGNIIQIPHEGWP-IDTTTS-------GDLYVVVHIEFPPDNWFSERSDLTQ
VKNVLPGETNNNAAVE-------DDP----GNTETVTNINIV---EEIP--DPSQDDRFR
S--RDDDKANDF------PG----CAQQ
>KLLA0F19184g
MTYSVFNVKYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRL
TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKII-----DEAERETSEA
MFKEVTAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDH--EFDDFMNFF----QQYQ
RQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGT
GLRKKHF----QKPEI---SCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKK
--SASDTCKHC---SGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGK-ETGDVII
VIDEDSSKS---HL------ERKSN-DLHTTLNISLVDALTGF-STIVCETYDNRRLRVN
VPAGKVIRPGNYFKFKGEGWP-LSN-GD-----SFGDMYVQINIEFPKDNWFNEKSEITA
LRNILPGLKSKDTKD--------PDP----LNTEDVLSYSVLHSHDELP--DYLAEEKEK
YNRKQQEEPHASAFDNDYTQMPSECATQ
>AGR084C
------------------------------------------------------------
--------MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS-----DESEREASEA
KFKEISAAYAVLSDEQKRAEYDQFGTVDGG---YG--HDEFGHGDDDFMNFF-----RYG
AGRHGYQ-----HEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGS
GLRKRAA----ARPMI---RCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGK--RI
PTTAADNCKKC---TGKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGK-ETGDLVF
VIDEQTDVSS--SL------ERKGT-DLYCTMKISLAEALTGF-TRIVTRTFDERVLRIN
IPRGKVLRPGNYLKFTNEGWP-IED-GA-----RFGDMYVQVLIEFPKDNWFNEKAELDA
IRNILPGLADAPSTKT-------EDP----SNTEEVRAYSIIANHTGLP--DYLDRENQG
Y--SRQQHESTAGT----PE----CPMQ
>Ecym_4306
------------------------------------------------------------
--------MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS-----DESQRAESEA
KFKEISAAYDILSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF-----RYG
AGRYGQY------EDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGL
GLRKRAA----HCMPM---KCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSR
--DPSDNCKKC---HGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGK-ETGDLVF
EIDEITDPDA--EL------ERKGT-DLHCSITISLAEALTGF-TRLVARTFDDRLLRIT
IPSGKVLRPGNYLKFTNEGWP-INN-GS-----RFGDLYVKVNIEFPKDNWLNEKSELEA
IKHILPGLKNSSNSHQGDG----DDP----ANTEDINSYYVIQDSSRLP--DYLAQEGQQ
R--SNQQYGERNTA----SE----CPVQ
>SAKL0H16984g
------------------------------------------------------------
---------MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVA-----DEVLREESEM
KFKEITAAYEILSDEDSRKKYDVYGDDAPGASGGG--GDPF--GDDDFMNFF----RTYA
GGGFYDE--PRQPYPEEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGS
GLRKKFQQH--PRKPV---VCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGR--TT
PTKPEDHCKKC---HGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDK-VTGDLLF
VIEENPETST--NL------ERRGD-DLHTRLKISLSEAITGF-EKVVTTTLDDRILKLK
IPQGKVIRPGNYIRLENEGWP-LDDSGN-----KFGDMYVQVHIEFPPDNWFSEKSDVEV
LRTLLPEVPNARVADT-------GDL----NNTETVIDYSVVKSADELP--DYLSYEKGE
Y--QGQEQEYGAFEE---PQ----CAQQ
>KLTH0G13640g
------------------------------------------------------------
----------MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLRDESEI
KFKEVAAAYELLSNEEKRQNYDTYGDTNGFSGDYS----GF--QDGDFASFF----GNFA
SNRYQDE------YEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGT
GVRRR------ARHAS---ACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLR-
---SEDMCKKC---HGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGK-IPGDLVF
DIAENSASS---SL------ERRGS-DLYAKITISLSDALTGF-EKEVCTTLDGRLLKLK
VPLGQVVRPGNFVRIDNEGWP-LDDQGS-----KFGDMYVQIDIEFPPDHWFSERSDVKS
LQNLLPQAVSSSATSDFNASA--SDP----ANTETPLKFSIVKSAEELP--QYLSEESEP
G-----------------PQ----CAQQ
>Kwal_56.23782
------------------------------------------------------------
----------MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLREESEI
KFKEVAAAYELLSNEEKRRNYDTYGDTNGYSDSYG----GF--QDGDFASFF----GNFA
SGRYEDE------EDFRAHARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGA
GIRKR------ARHAS---ACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR-
---SEDLCKKC---HGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGK-LTGDLVF
DISEDSTTS---NL------ERRGS-DLHTKIIISLSDALTGF-EKEVCTTLDGRDLRLK
IPTGQVIRPGNYICLKNEGWP-LDDEGK-----KFGNMYVQINIEFPPDHWYSERGEIEA
LRNIIPQSTSSSAASSSASAE--PDP----VNTE-MPTFDILKSAEELP--NYLPDDAEQ
G--G--------------PQ----CSQQ
>TPHA0A01790
------------------------------------------------------------
-MSNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYEL
KFKEIISAYEILSDEEKRKQYDL--------------QKNF--RDANQ-------GSDYG
DGINTAF------------GNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGL
GWRSRKNGKQYVPPLT---ECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKK
PASSKNFCLKC---NGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIF
VLEEIDDEQT--AL------KRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLS
IPVGKVIRFGDILKVEGEGWP-LNKNAT-----RSGDLYIKFNIEFPADNWNSEMNDIIK
IRNLLPAISDAKADILGDMPK--DDIFNITMNSEDISNYDFV---KDLP--DIIDTSHNN
GAEYGHNGDSANFTEM--PE----CSQQ
>Kpol_543.40
------------------------------------------------------------
MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI-----DEGQKLINEI
KFKDITAAYQTLSDEDKRNEYD---------------------NKKNFEPYF---ESDFA
NN-HDGN--------YNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGL
GWRTKKDGKPYVPPEI---ECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKK
PNSPKNFCKDC---NGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIF
EINEIIDSNN--DL------ERYGN-HLINHTHISLAEAITGFENKFIVKTFDDRDLYLS
TPKGKVIRPGDILEVKNEGWP-MDKYGA-----SFGNLYVILEIEFPPDNWINEKNDIIK
IRNILPNEKTKRNNI--------VDP----INSEYISTFEIV---KSLP--QEEGEEQTE
H--DTN------------PS----CAQM