MUSCLE (3.8) multiple sequence alignment

TPHA0A01820        MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLI-LCLPLDGQYRRTYISENALL
KNAG0H03250        MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMI-LIIPMNGQYRNTYISENALM
Kpol_543.37        MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLM-LYLPMDGQFRRTYISENALM
NDAI0J01390        MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMI-AILPMDGQYRNTYISENALM
NCAS0B03860        MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVII-GILPFEGQYRNTYISENALM
TBLA0F03080        MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLF-LMLPMDGQYRHTYISENALM
CAGL0L12232g       MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLL-AILPLDGQYRRTYISENALM
KAFR0B05550        MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISI-AILPIDGQYRNTYISENALM
TDEL0F03880        MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWL-ALLPLEGRYRRTYISENALL
ZYRO0C01672g       MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWL-ATLPIEGQFRRTYISENALM
Suva_10.172        MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISI-AILPMDGQYRRTYISENALM
Skud_12.156        MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISI-AILPMDGQYRRTYISENALM
Smik_12.147        MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISI-AILPMDGQYRRTYISENALM
YLR088W            MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISI-AILPMDGQYRRTYISENALM
KLTH0G13706g       MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM
Kwal_56.23804      MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM
AGR087C            MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM
Ecym_4309          MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM
KLLA0F19118g       MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL
SAKL0H17050g       MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM
                   *.:.  : *     * :...   *. .* .   ..   .   :* :*.:*.********:

TPHA0A01820        PSQAYSYFRESEWNILRGYRTAIEALID--KPARVRNEVISSWLTDFGMKHAVYDNAADG
KNAG0H03250        PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG
Kpol_543.37        PSQAYSYFRETEWNILRGYRKEIEVLSS--HSSIERNAIMSSWLEEFGLKTSVYKNQEYG
NDAI0J01390        PSQAYSYFRETEWNIVRGYRNELVHMEN--STSRERNQIMESWLNEFGVKTQIYENRD-N
NCAS0B03860        PSQAYSYFRESEWNIVRGYRSQIVELRN--ASAVERNAIMSEWLQQFGTKTDIYQNHETG
TBLA0F03080        PSQAYSYFRESEWNILRGYRTEIDIFPS--MPSRDRNLVMTQWLEEFGTKTSVYHNDEYG
CAGL0L12232g       PSQAYSYFRETEWNILRGYRSQIETLEH--SSVDQRNEVVAEWLQEQGLKTALYEHEKWG
KAFR0B05550        PSQAYSYFRETEWNILRGYRTQVENMVD--LPLTERNDIMETWLNDIGAKTDTHNN----
TDEL0F03880        PSQAYSYFRETEWNTLRGYRTQIERLAN--STSRERNEEVAGWLREFGVKTAIYQDEKHG
ZYRO0C01672g       PSQAYSYFRESEWNILRGYRSQIEHFGE--ISNNERNEQMAEWLQEFGAKTSIYNNEEYG
Suva_10.172        PSQAYSYFRETEWNILRGYRSQIEETVN--MTSTERNNLMGSWLQEFGTKTAIYENEQYG
Skud_12.156        PSQAYSYFRESEWNVLRGYRSQIEEMEN--MTSSERNNQMGSWLQEFGTKTAIYESQQYG
Smik_12.147        PSQAYSYFRESEWNILRGYRSQIEEMVN--MTSMERNNIMGSWLQEFGTKTAIYENEQYG
YLR088W            PSQAYSYFRESEWNILRGYRSQIKEMVN--MTSMERNNLMGSWLQEFGTKTAIYENEQYG
KLTH0G13706g       PSQAYSYFRETEWNILRGYRTQIQVLEE--KSSKERNEVVASWFQEFGAKTAFYEDDLHG
Kwal_56.23804      PSQAYSYFRETEWNILRGYRTQIQTLEN--KSSLERNEILGSWLQEFGVKTALYEDESCG
AGR087C            PSQAYSYFRESEWNILRGYRSEIDGMRT--LTADERNRIVASWMEEYGAKAAVYNDDRHG
Ecym_4309          PSQAYSYFRESEWNILRGYRRELENLKD--LDIHERNTIVASWMEEYGAKTSINTNNQYG
KLLA0F19118g       PSQAYSYFRESEWNILRGYRTQLDLFQYV-STTHDSNAEVSKWLQEFGVKTAIYDDEQYG
SAKL0H17050g       PSQAYSYFRETEWNVLRGYRTQIELFKK--SSTHERNEEVSSWLQQFGAKTAIYTNEEYG
                   **********:*** :****  :                :  *: : * *          

TPHA0A01820        DTLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVI
KNAG0H03250        DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF
Kpol_543.37        DSLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVF
NDAI0J01390        EVLYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVF
NCAS0B03860        DTLYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVF
TBLA0F03080        DTLYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVF
CAGL0L12232g       KTLYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVF
KAFR0B05550        STIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVF
TDEL0F03880        DTLYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVL
ZYRO0C01672g       DSLYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVF
Suva_10.172        ETLYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVF
Skud_12.156        ETLYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVF
Smik_12.147        ETLYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVF
YLR088W            ETLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVF
KLTH0G13706g       NTMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVF
Kwal_56.23804      NTLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVF
AGR087C            ETLYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVL
Ecym_4309          ETLYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVL
KLLA0F19118g       ETLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVL
SAKL0H17050g       ETLYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVL
                   . :*.: :: ******::::. ** . :   * .* ::  :: .:: ***:******:*:

TPHA0A01820        SENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDI
KNAG0H03250        SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL
Kpol_543.37        SENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDL
NDAI0J01390        SENPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDL
NCAS0B03860        TENPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDM
TBLA0F03080        SENPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDL
CAGL0L12232g       SEDSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDL
KAFR0B05550        SEDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDL
TDEL0F03880        SENPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDL
ZYRO0C01672g       SENPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDL
Suva_10.172        SENPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDL
Skud_12.156        SENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDL
Smik_12.147        SENPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDL
YLR088W            SENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDL
KLTH0G13706g       SDDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDL
Kwal_56.23804      SDDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDL
AGR087C            SEDPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDL
Ecym_4309          SADPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDL
KLLA0F19118g       SEDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDL
SAKL0H17050g       SEDPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDL
                   : :.  ::.:** **: .****.**:*:*:::* ..  : *.. *: : * **  ****:

TPHA0A01820        VNVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSG
KNAG0H03250        VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG
Kpol_543.37        VNIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSG
NDAI0J01390        VNIGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSG
NCAS0B03860        VNIGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSG
TBLA0F03080        LNIAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSG
CAGL0L12232g       VNIAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSG
KAFR0B05550        VNIAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSG
TDEL0F03880        VNIAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSG
ZYRO0C01672g       VNIAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSG
Suva_10.172        VNVAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSG
Skud_12.156        VNIAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSG
Smik_12.147        VNVAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSG
YLR088W            VNIAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSG
KLTH0G13706g       VNVAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSG
Kwal_56.23804      VNVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSG
AGR087C            LNVAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSG
Ecym_4309          INTAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNG
KLLA0F19118g       VNVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSG
SAKL0H17050g       VNVAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSG
                   :* .:   :***:.*:*:*    .:       .:  :  .     ::*     *:*.*.*

TPHA0A01820        RRIQALTLKAC-G-TEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSI
KNAG0H03250        WRIQAVTLKAR-G--EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSI
Kpol_543.37        WRIQALTLKAR-G--DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSI
NDAI0J01390        WRIQSITLKTK-G-NSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
NCAS0B03860        WRIQSVTLRAR-G-QNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSI
TBLA0F03080        FRIQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSI
CAGL0L12232g       WRIQSVTLRAH-G-NEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSI
KAFR0B05550        WRIQALTLKAC-G--EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSI
TDEL0F03880        WRIQAVTLKAH-G-TEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSI
ZYRO0C01672g       WRIQSVTIKAH-GKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSI
Suva_10.172        WRIQSVTLKAH-G-HGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
Skud_12.156        WRIQSVTLKAH-G-HGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
Smik_12.147        WRIQSVTLKAH-G-NSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
YLR088W            WRIQSVTLKAH-G-NSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
KLTH0G13706g       WRIQAIVLRAR-G-TDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSI
Kwal_56.23804      WRIQAVVLRAR-G-DHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSI
AGR087C            WRIQSVTLKAR-G-TNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSI
Ecym_4309          WRIQSVTLKAH-G-QDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSI
KLLA0F19118g       WRIQSLTLKAK-G-IDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISI
SAKL0H17050g       WRIHSVTLKAC-G-TDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSI
                    **:::.:.:         *:* ***:.**  **:**********:*:*::::*. *:**

TPHA0A01820        GSYLPSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINET
KNAG0H03250        SSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLY
Kpol_543.37        GSYLPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTY
NDAI0J01390        SSYLPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLI
NCAS0B03860        SSYLPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIY
TBLA0F03080        SSYLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLL
CAGL0L12232g       SNYLPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIM
KAFR0B05550        SSYLPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLK
TDEL0F03880        SSYLPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLR
ZYRO0C01672g       SSYLPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLY
Suva_10.172        SSYLPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLS
Skud_12.156        SSYLPSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLL
Smik_12.147        SSYLPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLL
YLR088W            SSYLPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLL
KLTH0G13706g       ASYLPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSH
Kwal_56.23804      ASYLPAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFAR
AGR087C            GSYLPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFY
Ecym_4309          GSYLPAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAY
KLLA0F19118g       GTYLATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVY
SAKL0H17050g       GSYLPAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLY
                   ..**. :: .:  *        . .           .: .      ::            

TPHA0A01820        -FLQPHLMILAFLLISFLPLTNIPQPLITIQP---CLSYRLKSFAFIYISLVLTSLLVMN
KNAG0H03250        STTSPLYLILGSVVLAVSPLV-MSRSNNALRE---PVCYRMRTLGYIYYSLILTSLLMLN
Kpol_543.37        -YPQPLLLLLGNVVISTIPL--AAPKNLSISE---PLAYRLKTISFMYLSLVMTSLLVVN
NDAI0J01390        -LPIPSLLLLINIVISISSI--IIQNKKLFKP---AVSNRLRSFAFLHLSLILTSLLMVN
NCAS0B03860        -SPFPTILLAVNIIICLYPA--ILKGNAFMKD---LLSYRLRSTAFLFMSLLLTSLLMVN
TBLA0F03080        -FTEPRLLVLGSVFLSVLPH--LLGNRFTIPE---PLSYRLKSIAFLYISLVLTSLLVLN
CAGL0L12232g       -LPIVESLLFGSVALTFLPL--VM-SKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVN
KAFR0B05550        -YTFPVMLMFICILFSFIPL--IS-RGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMIN
TDEL0F03880        -FDAPTILISFSALISFLPL--LL--KKKIAE---PLAYRLKSVAFLFFSLVLTSLLMVN
ZYRO0C01672g       -VPSTILLVAFIVVMLLLPL--AAGRLWTITE---PLSHRLQMYAFLYMSLVVTSLMMVN
Suva_10.172        -VLPAGLLMTISLAICFLPI--ALSGKVHISE---PLSYRLKNVAFLYFSLVSTSLLMIN
Skud_12.156        -VPSVGLLMTISLATCFLPL--VLSEKVHISE---PLSYRLKNVAFLYFSLVSTSLLMIN
Smik_12.147        -LPSAGLLMAISMISCFLPL--ILSKKVHISE---PLSYRLKNVAFLYFSLVLTSLLMIN
YLR088W            -IPSSGLLMTISMASCFLPL--ILSRKIHISE---PLSYRLKNVAFLYFSLVSTSLLMIN
KLTH0G13706g       -WQYSSLLISCNAVIAVLPA--IF-GRQGIEA---SHSYQFKSVAFLYLSVVLTSLLVIN
Kwal_56.23804      -FHHPVILISWSVMTALAPI--LL-NRVRIQS---SYAHRLKAVAYLYLSVVLTSLLVVN
AGR087C            -LPAPALLLAFNVVVSFMPF--AL-VKYKIQK---PFSHRFKAAAYLYFSTVLSSLLVMN
Ecym_4309          -MPLPSLLLAFNVALSFISF--TV-IKYKIQK---PFSYRFKAFAHLYFSIVLTSLLVVN
KLLA0F19118g       -FPLPRVLLGLSGIFSVLPL--LSRTRLRIQE---PFSYRFKAFAYIYMAIVLTSLLVLN
SAKL0H17050g       -APQPELLLSLNVLLLLMPI--IF-TRVKIRT---PFSYRLKSFAYLYFSVVLTSLLVVN
                          ::         .          :       . .:.  .  . : : :**:::*

TPHA0A01820        FALAFGMGLLAFPLTFTKSCSEMI------------------------------------
KNAG0H03250        FPLAFSIGLFGYPMTLVKPLNIYSKS----------------------------------
Kpol_543.37        FPLAFGMGLFAYPMTLVMLNNTD-------------------------------------
NDAI0J01390        FPLSFMIGLMAFPMTKVRSITANT------------------------------------
NCAS0B03860        FPLAFGMGLLSFPMTQVKTITSDTPT----------------------------------
TBLA0F03080        FSLAFGIGILGFAMTAVKTITIHS------------------------------------
CAGL0L12232g       FALTFMIGLLAFPLTKLAVISTKTIADE--------------------------------
KAFR0B05550        FPLALTIGVLAFPMTLVKISNTLP------------------------------------
TDEL0F03880        FFLAFAMGLTAFPMTLVRTSSLNNY-----------------------------------
ZYRO0C01672g       FTLAFVVGILAFPMTAVGT-----------------------------------------
Suva_10.172        FAMALLIGTLAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKN
Skud_12.156        FAMALLIGSLAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRD--DLFEHHGDTVLEKA
Smik_12.147        FAMALLIGTLAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKS-
YLR088W            FAMALLIGTLAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQ
KLTH0G13706g       FALAFGIGLLAFPLILVKAPM---------------------------------------
Kwal_56.23804      FALAFGIGLLAFPLILVKNST---------------------------------------
AGR087C            FQLAFMVGLLAFPMTFVRTTVHA-------------------------------------
Ecym_4309          FALALAVGVLAFPMSLTKTTTNA-------------------------------------
KLLA0F19118g       FSLAIVMGLLAFPMTRTTTIIES-------------------------------------
SAKL0H17050g       FSLAFGLGCLAFPMTLVRTTSG--------------------------------------
                   * ::: :*  .:.:                                              

TPHA0A01820        TFKSKVINCFYLAISNPFIAIFIFVSIFEDD----ITN--FEVFSDLISSFKYMGNWTWA
KNAG0H03250        QMSLKLRNSVLLVISNPFVATWLICTVVENS---EFPN--LDVFAALFSAWKDLNCWTWF
Kpol_543.37        NLRLKTRNSILLAISNPFIAFWLFITIVESK----LDG--IEAIYGLVDAWNKLGSWTWF
NDAI0J01390        APQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQG--LRVINRLISAWKDMRCWTWF
NCAS0B03860        ISRTRVKNSVLLLVSNPFIATWLFSLLCDNE----FSG--LDVFERLVSASRELGCWTWL
TBLA0F03080        SMRVRVRNTMHLLLSNPFTSVLLFTYIFDKD----IYG--IKIFYEFIHSWNTLNCWTWF
CAGL0L12232g       SRKSILKNTFILFITNPFISLWLFTATMDTD----FNGSFSVIYNRMITSWDTLGCWTWF
KAFR0B05550        TSSQALKNSMLLLVSNPYISICAFSNIFDSE----LTG--LATLDRLIPAWNDMNCWTWF
TDEL0F03880        SLRIKLKNSILLLLSNPFIASYIFCQCFEPD----LPG--FTVFTEFATAWKELGCWTWF
ZYRO0C01672g       QRSLTFKKYALLIISNPLVSFFIVK-----------PH--PQLLQKLISAWQDLGCWTWF
Suva_10.172        QQRQKLKNLLLLILTNPFISITVFGLLFDDE----FQG--FDIINKLVSAWIDLKCWSWF
Skud_12.156        KKRQQLKNLLLLVLTNPFISITLFALVFDNE----FHG--FDIVNKLISAWLDLKCWNWF
Smik_12.147        QQRQELKNLLLLVLTNPFISITIFGSFFDDE----FQG--FDVINKLVSAWLDLKCWSWF
YLR088W            QQKQKLKNLVLLILTNPFISITLFGLFFDDE----FHG--FDIINKLVSAWLDLKCWSWF
KLTH0G13706g       TSRQRVKNTILLILSNPFISTLLFVNTFEPQ----LSG--LQLFHRLVQAWQKLGCWTWS
Kwal_56.23804      TPRLLFKNSLLLLLSNPFISTCLFAYFFEPL----LPG--LQILEQLVQAWNEFGCWTWC
AGR087C            SVRQKMKNSLLLLLSNPFISICVFVHLFEPE----LTG--FSVFYSLIDAWNDLGCWTWY
Ecym_4309          TMQQKLRNSLLLMSSNPFIASWILCQLFEAQ----LAG--TSLFHSLIDAWTQLGCWTWY
KLLA0F19118g       NLRLSIKNLVLLIISNPFIATWAVVNFVEPR----LSG--FKVFYALIEASQQLGCWTWY
SAKL0H17050g       NLRARLKNCVLLLISNPFIAIWLFAICVDRE----LQG--VQVFYGLTSAWKDLGCWTWF
                          :   *  :**  :                          :  :   :  *.* 

TPHA0A01820        ITCIGWFTTWQMVYIANL--DTPRSALD------GDTKKNL
KNAG0H03250        VLCLGWLPTWLLVTFSSF--TSIPAAET------TIEKKSN
Kpol_543.37        IFCIGWFPSWILVAISALKVEQVQTEPN--------SKKHL
NDAI0J01390        VLCLGWLPSWIMVAISVIENEREPTSHD--------VKKNE
NCAS0B03860        VLCVGWWTPWLLVAISAL--DTVKLSND-----SEDFKKQQ
TBLA0F03080        IICVGWLPPWILVSISSI--QTNTVMQS-----PDYGKKQL
CAGL0L12232g       IICLGWLPYWLISVISSI--PSQPIVER---TSILDDKKEN
KAFR0B05550        FSHLAGYHAGL------------------------------
TDEL0F03880        VICIGWLPSWLMVALSTL--NTQPAQLD------DRKKKFQ
ZYRO0C01672g       VLCLGWLPSWTLIALSACSSTNLDPVAT--------SKKEQ
Suva_10.172        ILCLGWLPCWLLILASSF--ESKSVVVK-------SKEKQS
Skud_12.156        VLCIGWLPCWLLILASSF--ESRSVVVK-------SKEKQS
Smik_12.147        VLCIGWLPCWLLVLASSF--ESKRVMLK-------SKEKQS
YLR088W            VLCIGWLPCWLLILASSF--ESKSVVVR-------SKEKQS
KLTH0G13706g       VVCIGWLPSWLLVACSGIPMPYQPVGGP-SQRLGSSTKKTQ
Kwal_56.23804      VVCIGWLPSWLLIAYSSMITDVSTLLNS-------AEKKSS
AGR087C            VLCLGWYPAWIMVAYSSI--DSVPIAAP--------AKKSS
Ecym_4309          VLCIGWYPSWILVAYSSI--DSIPIVTT--------SKKSY
KLLA0F19118g       IICLGWYPSWLLVTYASI--DAIEVQTP---------IKKE
SAKL0H17050g       VICIGWLPSWLLVAYSGI--DSVSIVVPQDEKTESRNIKSE
                   .  :.                                    

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0A01820
MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLI-LCLPLDGQYRRTYISENALL
PSQAYSYFRESEWNILRGYRTAIEALID--KPARVRNEVISSWLTDFGMKHAVYDNAADG
DTLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVI
SENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDI
VNVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSG
RRIQALTLKAC-G-TEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSI
GSYLPSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINET
-FLQPHLMILAFLLISFLPLTNIPQPLITIQP---CLSYRLKSFAFIYISLVLTSLLVMN
FALAFGMGLLAFPLTFTKSCSEMI------------------------------------
TFKSKVINCFYLAISNPFIAIFIFVSIFEDD----ITN--FEVFSDLISSFKYMGNWTWA
ITCIGWFTTWQMVYIANL--DTPRSALD------GDTKKNL
>KNAG0H03250
MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMI-LIIPMNGQYRNTYISENALM
PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG
DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF
SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL
VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG
WRIQAVTLKAR-G--EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSI
SSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLY
STTSPLYLILGSVVLAVSPLV-MSRSNNALRE---PVCYRMRTLGYIYYSLILTSLLMLN
FPLAFSIGLFGYPMTLVKPLNIYSKS----------------------------------
QMSLKLRNSVLLVISNPFVATWLICTVVENS---EFPN--LDVFAALFSAWKDLNCWTWF
VLCLGWLPTWLLVTFSSF--TSIPAAET------TIEKKSN
>Kpol_543.37
MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLM-LYLPMDGQFRRTYISENALM
PSQAYSYFRETEWNILRGYRKEIEVLSS--HSSIERNAIMSSWLEEFGLKTSVYKNQEYG
DSLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVF
SENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDL
VNIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSG
WRIQALTLKAR-G--DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSI
GSYLPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTY
-YPQPLLLLLGNVVISTIPL--AAPKNLSISE---PLAYRLKTISFMYLSLVMTSLLVVN
FPLAFGMGLFAYPMTLVMLNNTD-------------------------------------
NLRLKTRNSILLAISNPFIAFWLFITIVESK----LDG--IEAIYGLVDAWNKLGSWTWF
IFCIGWFPSWILVAISALKVEQVQTEPN--------SKKHL
>NDAI0J01390
MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMI-AILPMDGQYRNTYISENALM
PSQAYSYFRETEWNIVRGYRNELVHMEN--STSRERNQIMESWLNEFGVKTQIYENRD-N
EVLYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVF
SENPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDL
VNIGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSG
WRIQSITLKTK-G-NSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
SSYLPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLI
-LPIPSLLLLINIVISISSI--IIQNKKLFKP---AVSNRLRSFAFLHLSLILTSLLMVN
FPLSFMIGLMAFPMTKVRSITANT------------------------------------
APQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQG--LRVINRLISAWKDMRCWTWF
VLCLGWLPSWIMVAISVIENEREPTSHD--------VKKNE
>NCAS0B03860
MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVII-GILPFEGQYRNTYISENALM
PSQAYSYFRESEWNIVRGYRSQIVELRN--ASAVERNAIMSEWLQQFGTKTDIYQNHETG
DTLYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVF
TENPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDM
VNIGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSG
WRIQSVTLRAR-G-QNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSI
SSYLPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIY
-SPFPTILLAVNIIICLYPA--ILKGNAFMKD---LLSYRLRSTAFLFMSLLLTSLLMVN
FPLAFGMGLLSFPMTQVKTITSDTPT----------------------------------
ISRTRVKNSVLLLVSNPFIATWLFSLLCDNE----FSG--LDVFERLVSASRELGCWTWL
VLCVGWWTPWLLVAISAL--DTVKLSND-----SEDFKKQQ
>TBLA0F03080
MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLF-LMLPMDGQYRHTYISENALM
PSQAYSYFRESEWNILRGYRTEIDIFPS--MPSRDRNLVMTQWLEEFGTKTSVYHNDEYG
DTLYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVF
SENPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDL
LNIAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSG
FRIQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSI
SSYLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLL
-FTEPRLLVLGSVFLSVLPH--LLGNRFTIPE---PLSYRLKSIAFLYISLVLTSLLVLN
FSLAFGIGILGFAMTAVKTITIHS------------------------------------
SMRVRVRNTMHLLLSNPFTSVLLFTYIFDKD----IYG--IKIFYEFIHSWNTLNCWTWF
IICVGWLPPWILVSISSI--QTNTVMQS-----PDYGKKQL
>CAGL0L12232g
MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLL-AILPLDGQYRRTYISENALM
PSQAYSYFRETEWNILRGYRSQIETLEH--SSVDQRNEVVAEWLQEQGLKTALYEHEKWG
KTLYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVF
SEDSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDL
VNIAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSG
WRIQSVTLRAH-G-NEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSI
SNYLPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIM
-LPIVESLLFGSVALTFLPL--VM-SKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVN
FALTFMIGLLAFPLTKLAVISTKTIADE--------------------------------
SRKSILKNTFILFITNPFISLWLFTATMDTD----FNGSFSVIYNRMITSWDTLGCWTWF
IICLGWLPYWLISVISSI--PSQPIVER---TSILDDKKEN
>KAFR0B05550
MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISI-AILPIDGQYRNTYISENALM
PSQAYSYFRETEWNILRGYRTQVENMVD--LPLTERNDIMETWLNDIGAKTDTHNN----
STIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVF
SEDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDL
VNIAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSG
WRIQALTLKAC-G--EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSI
SSYLPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLK
-YTFPVMLMFICILFSFIPL--IS-RGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMIN
FPLALTIGVLAFPMTLVKISNTLP------------------------------------
TSSQALKNSMLLLVSNPYISICAFSNIFDSE----LTG--LATLDRLIPAWNDMNCWTWF
FSHLAGYHAGL------------------------------
>TDEL0F03880
MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWL-ALLPLEGRYRRTYISENALL
PSQAYSYFRETEWNTLRGYRTQIERLAN--STSRERNEEVAGWLREFGVKTAIYQDEKHG
DTLYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVL
SENPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDL
VNIAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSG
WRIQAVTLKAH-G-TEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSI
SSYLPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLR
-FDAPTILISFSALISFLPL--LL--KKKIAE---PLAYRLKSVAFLFFSLVLTSLLMVN
FFLAFAMGLTAFPMTLVRTSSLNNY-----------------------------------
SLRIKLKNSILLLLSNPFIASYIFCQCFEPD----LPG--FTVFTEFATAWKELGCWTWF
VICIGWLPSWLMVALSTL--NTQPAQLD------DRKKKFQ
>ZYRO0C01672g
MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWL-ATLPIEGQFRRTYISENALM
PSQAYSYFRESEWNILRGYRSQIEHFGE--ISNNERNEQMAEWLQEFGAKTSIYNNEEYG
DSLYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVF
SENPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDL
VNIAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSG
WRIQSVTIKAH-GKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSI
SSYLPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLY
-VPSTILLVAFIVVMLLLPL--AAGRLWTITE---PLSHRLQMYAFLYMSLVVTSLMMVN
FTLAFVVGILAFPMTAVGT-----------------------------------------
QRSLTFKKYALLIISNPLVSFFIVK-----------PH--PQLLQKLISAWQDLGCWTWF
VLCLGWLPSWTLIALSACSSTNLDPVAT--------SKKEQ
>Suva_10.172
MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISI-AILPMDGQYRRTYISENALM
PSQAYSYFRETEWNILRGYRSQIEETVN--MTSTERNNLMGSWLQEFGTKTAIYENEQYG
ETLYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVF
SENPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDL
VNVAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSG
WRIQSVTLKAH-G-HGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
SSYLPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLS
-VLPAGLLMTISLAICFLPI--ALSGKVHISE---PLSYRLKNVAFLYFSLVSTSLLMIN
FAMALLIGTLAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKN
QQRQKLKNLLLLILTNPFISITVFGLLFDDE----FQG--FDIINKLVSAWIDLKCWSWF
ILCLGWLPCWLLILASSF--ESKSVVVK-------SKEKQS
>Skud_12.156
MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISI-AILPMDGQYRRTYISENALM
PSQAYSYFRESEWNVLRGYRSQIEEMEN--MTSSERNNQMGSWLQEFGTKTAIYESQQYG
ETLYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVF
SENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDL
VNIAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSG
WRIQSVTLKAH-G-HGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
SSYLPSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLL
-VPSVGLLMTISLATCFLPL--VLSEKVHISE---PLSYRLKNVAFLYFSLVSTSLLMIN
FAMALLIGSLAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRD--DLFEHHGDTVLEKA
KKRQQLKNLLLLVLTNPFISITLFALVFDNE----FHG--FDIVNKLISAWLDLKCWNWF
VLCIGWLPCWLLILASSF--ESRSVVVK-------SKEKQS
>Smik_12.147
MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISI-AILPMDGQYRRTYISENALM
PSQAYSYFRESEWNILRGYRSQIEEMVN--MTSMERNNIMGSWLQEFGTKTAIYENEQYG
ETLYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVF
SENPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDL
VNVAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSG
WRIQSVTLKAH-G-NSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
SSYLPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLL
-LPSAGLLMAISMISCFLPL--ILSKKVHISE---PLSYRLKNVAFLYFSLVLTSLLMIN
FAMALLIGTLAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKS-
QQRQELKNLLLLVLTNPFISITIFGSFFDDE----FQG--FDVINKLVSAWLDLKCWSWF
VLCIGWLPCWLLVLASSF--ESKRVMLK-------SKEKQS
>YLR088W
MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISI-AILPMDGQYRRTYISENALM
PSQAYSYFRESEWNILRGYRSQIKEMVN--MTSMERNNLMGSWLQEFGTKTAIYENEQYG
ETLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVF
SENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDL
VNIAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSG
WRIQSVTLKAH-G-NSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSI
SSYLPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLL
-IPSSGLLMTISMASCFLPL--ILSRKIHISE---PLSYRLKNVAFLYFSLVSTSLLMIN
FAMALLIGTLAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQ
QQKQKLKNLVLLILTNPFISITLFGLFFDDE----FHG--FDIINKLVSAWLDLKCWSWF
VLCIGWLPCWLLILASSF--ESKSVVVR-------SKEKQS
>KLTH0G13706g
MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM
PSQAYSYFRETEWNILRGYRTQIQVLEE--KSSKERNEVVASWFQEFGAKTAFYEDDLHG
NTMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVF
SDDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDL
VNVAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSG
WRIQAIVLRAR-G-TDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSI
ASYLPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSH
-WQYSSLLISCNAVIAVLPA--IF-GRQGIEA---SHSYQFKSVAFLYLSVVLTSLLVIN
FALAFGIGLLAFPLILVKAPM---------------------------------------
TSRQRVKNTILLILSNPFISTLLFVNTFEPQ----LSG--LQLFHRLVQAWQKLGCWTWS
VVCIGWLPSWLLVACSGIPMPYQPVGGP-SQRLGSSTKKTQ
>Kwal_56.23804
MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM
PSQAYSYFRETEWNILRGYRTQIQTLEN--KSSLERNEILGSWLQEFGVKTALYEDESCG
NTLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVF
SDDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDL
VNVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSG
WRIQAVVLRAR-G-DHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSI
ASYLPAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFAR
-FHHPVILISWSVMTALAPI--LL-NRVRIQS---SYAHRLKAVAYLYLSVVLTSLLVVN
FALAFGIGLLAFPLILVKNST---------------------------------------
TPRLLFKNSLLLLLSNPFISTCLFAYFFEPL----LPG--LQILEQLVQAWNEFGCWTWC
VVCIGWLPSWLLIAYSSMITDVSTLLNS-------AEKKSS
>AGR087C
MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM
PSQAYSYFRESEWNILRGYRSEIDGMRT--LTADERNRIVASWMEEYGAKAAVYNDDRHG
ETLYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVL
SEDPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDL
LNVAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSG
WRIQSVTLKAR-G-TNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSI
GSYLPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFY
-LPAPALLLAFNVVVSFMPF--AL-VKYKIQK---PFSHRFKAAAYLYFSTVLSSLLVMN
FQLAFMVGLLAFPMTFVRTTVHA-------------------------------------
SVRQKMKNSLLLLLSNPFISICVFVHLFEPE----LTG--FSVFYSLIDAWNDLGCWTWY
VLCLGWYPAWIMVAYSSI--DSVPIAAP--------AKKSS
>Ecym_4309
MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM
PSQAYSYFRESEWNILRGYRRELENLKD--LDIHERNTIVASWMEEYGAKTSINTNNQYG
ETLYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVL
SADPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDL
INTAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNG
WRIQSVTLKAH-G-QDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSI
GSYLPAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAY
-MPLPSLLLAFNVALSFISF--TV-IKYKIQK---PFSYRFKAFAHLYFSIVLTSLLVVN
FALALAVGVLAFPMSLTKTTTNA-------------------------------------
TMQQKLRNSLLLMSSNPFIASWILCQLFEAQ----LAG--TSLFHSLIDAWTQLGCWTWY
VLCIGWYPSWILVAYSSI--DSIPIVTT--------SKKSY
>KLLA0F19118g
MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL
PSQAYSYFRESEWNILRGYRTQLDLFQYV-STTHDSNAEVSKWLQEFGVKTAIYDDEQYG
ETLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVL
SEDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDL
VNVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSG
WRIQSLTLKAK-G-IDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISI
GTYLATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVY
-FPLPRVLLGLSGIFSVLPL--LSRTRLRIQE---PFSYRFKAFAYIYMAIVLTSLLVLN
FSLAIVMGLLAFPMTRTTTIIES-------------------------------------
NLRLSIKNLVLLIISNPFIATWAVVNFVEPR----LSG--FKVFYALIEASQQLGCWTWY
IICLGWYPSWLLVTYASI--DAIEVQTP---------IKKE
>SAKL0H17050g
MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM
PSQAYSYFRETEWNVLRGYRTQIELFKK--SSTHERNEEVSSWLQQFGAKTAIYTNEEYG
ETLYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVL
SEDPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDL
VNVAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSG
WRIHSVTLKAC-G-TDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSI
GSYLPAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLY
-APQPELLLSLNVLLLLMPI--IF-TRVKIRT---PFSYRLKSFAYLYFSVVLTSLLVVN
FSLAFGLGCLAFPMTLVRTTSG--------------------------------------
NLRARLKNCVLLLISNPFIAIWLFAICVDRE----LQG--VQVFYGLTSAWKDLGCWTWF
VICIGWLPSWLLVAYSGI--DSVSIVVPQDEKTESRNIKSE