MUSCLE (3.8) multiple sequence alignment

CAGL0L12188g       ---------MSDR---PVSKRQKVT--------------------------------EED
TBLA0E04410        ---------MPDS---PISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIG
KLLA0F19085g       MTADSSVPHLGDS---PEIKRQRVS-----------------------------------
KNAG0G02020        ---------MLDT---PSSKKRRTV---GEDAVTPCQDLALEEDTTRNDERNKNNATKSS
TPHA0J00720        ---------MSAL---PDAKKQKVK----------------------DIESNSPLNNDIP
AGR089C            ----------MDI---PTPKKPRIL-----------------------------------
Ecym_4311          ---------MADL---RTSKKPKHL-----------------------------------
SAKL0H17094g       ---------MSDS---PLAKKQKTR------------------TDDRGQIQSNPTVSPIP
KLTH0G13750g       ----------MES---PLSKKQKTF---------------------------------VN
Kwal_56.23825      ----------MDS---PLAKKQKTH---------------------------------VS
Kpol_392.8         ---------MPKT---PLSKRPKLV-----EANLN--------ANELDHNDDDQRYNRQE
KAFR0B02710        ---------MSHT---PLSKKQKVV-------------------------SDEERITPNQ
Smik_12.145        ---------MCDS---PLSKRQKRK----------AVEEPELSLDDSDATQELQAEKQAD
YLR086W            ---------MSDS---PLSKRQKRK----------SAQEPELSLDQGDAEEDSQVENRVN
Suva_10.170        ---------MYDS---PLSKRQKRK----------TAEEPELSINHGNGEQEPKAEKQND
Skud_12.154        ---------MCDS---PLSKKQKRK----------ATEEPELSLNDTDAERESRVENRVN
NDAI0B01970        ---------MPESTNIPSPKRQKVL----------------ESHTPEQQEENRREDDESP
NCAS0B05000        ----------MSL---PNTKRQKVT--------------EPESKTPEQGTEDQQANASLR
ZYRO0C01716g       --------MDDDD---SLSKRQKVD--------------------GLNQIDGKHPTVDLD
TDEL0F03860        ---------MPDT---PLTKRQRVN----------------------------DNESREF
                                      *. .                                     

CAGL0L12188g       EEEDVIHTPKAVTFEQSPR--AITPRNLL--GSENRNVLPTG-------GSQ-NLQIPSL
TBLA0E04410        PYQGQEKHIQPQSQDRHGR--SRTPRKLIVSSADHRFTMSQP-----NLLSA-DSQTPSL
KLLA0F19085g       ----------------QSP--TRTPRKLVLGSPEKKYAVSNS---QATTAASNTMDPPSL
KNAG0G02020        LHDSLPKLQSSVSPLDFKK--TVTPRKLIIGPSENKYALSQP----TTSASS-SLQVPAL
TPHA0J00720        KIAQSRNDSPLQVANDPLK--SYTPMKVIISNNHSNSISPLP----SQLMSS-STQPPSL
AGR089C            ----------------------DTPVKLLATSPDRKNVVSRG----SSVSTTMGLRGPSL
Ecym_4311          ----------------------DTPSKLMFGSPGRKHVASQA----SSNSTT-ALRGPSL
SAKL0H17094g       PVSGSSLMAVKSSPTRQDRLPSPTPRKLVLGSPEKKYAYSQP------STSS-SLSVPNL
KLTH0G13750g       RDEDFSQTEESVDVTRASR--SRTPRKLVLGSPDKRFAFSQP------VTSS-SSNVPYL
Kwal_56.23825      NESENSSTEESPDVTRASR--SRTPRKLVLGSPDKRFAFSQP------VSSS-SSNVPHL
Kpol_392.8         IKVSPTTQDAAAVSHLNFK--SQTPKKLILRDYDSIAITPTA----AMPPSS-SLQAPSL
KAFR0B02710        NEQDNDKTHPEVTASSFLK--SHTPRKLLLGSADNKYVLSQPIISSSSHGSS-SLQVPNL
Smik_12.145        RSEKTPDPNSPALETSYAK--SHTPRKLVLSSGENRYAFSQP----TNSATT-SLHVPNL
YLR086W            LSENTPEPDLPALEASYSK--SYTPRKLVLSSGENRYAFSQP----TNSTTT-SLHVPNL
Suva_10.170        RTEKTPDPDSLSLESSYAK--SHTPRKLVLSSGENRYAFSQP----TNSATS-SLHVPNL
Skud_12.154        RTEKTPDPNSPSLESSYAR--SHTPRKLVLSSGENRYAFSQP----TNSATT-SLHVPNL
NDAI0B01970        LRFEHQQSAVSLSPPAISK--SHTPRKLILHQSDNRYAFSQP-----TVSAS-SLQVPSL
NCAS0B05000        SPLQRPEHQQSISPINNSK--SHTPRKLILGQNDNRYAFSQP-----SVSSS-SFQVPTL
ZYRO0C01716g       QGENLSLPTTSSSQNTFAH--AKTPRKLVVGNGDNRYAHSSQ-----SISSS-SLQVPPL
TDEL0F03860        EAVNGSTKSPLTSNSNSTI--SHTPKKLVIGTNDDTTSQSQP-----IVSSS-SLQAPSL
                                          ** :::          .          :      * *

CAGL0L12188g       LP---PES-LGSARGR-DFKSYSQSPP----RSPGRSPTRRLKLIELSPIKNSRA-ELQK
TBLA0E04410        QH-------PSVSTGR-EHKFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRA-ELQK
KLLA0F19085g       QP---PT--AHAVRGR----EYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRL-ELQK
KNAG0G02020        QQKLVPL--SQDSRGR-RIKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRL-ELQK
TPHA0J00720        QH---P---SSSSRGR-AVKAYSQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRS-ELQK
AGR089C            QP---PVA-HQISRGR---SQYSQSPP----RSPNRSPGRAVELIQLSPIKNSRL-ELQR
Ecym_4311          QP---PTY-SQLSRGR---SVYSQSPP----RSPNRSPARRIELIQLSPIKNSRL-ELQK
SAKL0H17094g       QP---PN--VDGSRGR---RFYSQSPPRSPHRSPNRSPTRRLELIQLSPVKNNRA-ELQK
KLTH0G13750g       QP---LKSELSSSRGR----VYSQSPP----RSPTRSPTRKLELIQLSPTKKTRL-ESQK
Kwal_56.23825      QP---LKNELSSSRGR----VYSQSPP----RSPNRSPTRKLELIQLSPMKKSRL-ESQK
Kpol_392.8         HP---PT--ESSSRGR-TARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRI-ALQK
KAFR0B02710        QP---PL--SQPSRGR-DKKAYSQSPP----RSPGRSPVRKLELIQLSPIKNNRI-ELQK
Smik_12.145        QP---P---GTSSRGR-DYKAYSQSPP----RSPGRSPTRRLELLQLSPVKNSRV-ELQK
YLR086W            QP---P---KTSSRGR-DHKSYSQSPP----RSPGRSPTRRLELLQLSPVKNSRV-ELQK
Suva_10.170        QP---P---EAPSRGR-DYKAYSQSPP----RSPGRSPTRRLELLQLSPVKNSRI-ELQK
Skud_12.154        QP---P---KVSSRGR-DYKAYSQSPP----RSPGRSPARRLELLQLSPVKNSRI-ELQK
NDAI0B01970        QP---PETSSSSSRGRRDIKVYSQSPP----RSPGRSPTRKLELIQLSPVKNNRIRKLQE
NCAS0B05000        QP---PD--SSSSRGRKDIKSYSQSPP----RSPGRSPKRRLELIQLSPVKNNRI-KLRE
ZYRO0C01716g       QP---P---ATSSRGR-GSKTYSQSPP----RSPGRSPTRKLELIQISPLKNSRL-ELQK
TDEL0F03860        QH---P---NSSSRGR-EQRTYSQSPP----RSPGRSPTRKLELIKISPVKKNRL-ELQR
                                 **     ******    *** *** . ::*: :** *..*    . 

CAGL0L12188g       LYESKKLDV--KKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSM
TBLA0E04410        MYELQQTQK--RTIRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSM
KLLA0F19085g       MHEANTQ----TSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSM
KNAG0G02020        LYDAHNAKI-GKMNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSM
TPHA0J00720        IYSSKQEE---KIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSM
AGR089C            LYDTKQK----KVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSM
Ecym_4311          IYDGKQT----TTKRLSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSM
SAKL0H17094g       IYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSM
KLTH0G13750g       TEQVRGLAQ--PIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSL
Kwal_56.23825      FQESRAMMG--SIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSL
Kpol_392.8         IYESKNEK---QIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSM
KAFR0B02710        LYNSKNQ----NKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSM
Smik_12.145        LYNSHQSST-KQQGRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSM
YLR086W            IYDRHQSSS-KQQSRLFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSM
Suva_10.170        LYDSHQPSG-EQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSM
Skud_12.154        LYDSHKSSG-KQQGRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSM
NDAI0B01970        LYNSQI-----KKERLFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSM
NCAS0B05000        LYDAHNSQS--KKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSM
ZYRO0C01716g       IYDAQQNQA--RHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSM
TDEL0F03860        LYDAEQSQR--NAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSM
                     .           *: :  * * :****** * :***  .***:**************:

CAGL0L12188g       LFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDK----DD-GSTTIDETK
TBLA0E04410        LFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVEIHFQYVIDD----PNGGPSKIDESK
KLLA0F19085g       LFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDT----DN-GETKILPSA
KNAG0G02020        LFVFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTD-GDT--MEAE
TPHA0J00720        LFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDY----PD-DTTKINPSK
AGR089C            LFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDE----PD-GTTRVLSGK
Ecym_4311          LFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYVMDD----AD-GNTKVLPDV
SAKL0H17094g       LFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDE----SD-GTTRSDDEK
KLTH0G13750g       LFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDE----LD-GRTTVRQDR
Kwal_56.23825      LFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDE----PD-GTTSIIQQK
Kpol_392.8         LFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDK----PD-GTTIINTVK
KAFR0B02710        LFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDE----ND-GTSKIIEDR
Smik_12.145        LFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVIDE----SS-GTSRIDEEK
YLR086W            LFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVIDE----SS-GTSRIDEEK
Suva_10.170        LFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDE----PS-GTSRIDEEK
Skud_12.154        LFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYIIDE----PS-GTSRIDEEK
NDAI0B01970        LFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDK----SN-GSSKIDDNK
NCAS0B05000        LFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE----HD-GDTKISETK
ZYRO0C01716g       LFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE----PS-GETRIDEEK
TDEL0F03860        LFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDE----PD-GTTRIDEEK
                   **.*****.****..*  ***:** . .:  * * : * *  *      . . :      

CAGL0L12188g       GNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA
TBLA0E04410        EKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP
KLLA0F19085g       GTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA
KNAG0G02020        NTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA
TPHA0J00720        QPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP
AGR089C            PELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKP
Ecym_4311          QELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKP
SAKL0H17094g       PPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP
KLTH0G13750g       PGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKP
Kwal_56.23825      PSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKP
Kpol_392.8         EKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP
KAFR0B02710        KPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA
Smik_12.145        PGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP
YLR086W            PGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP
Suva_10.170        PGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS
Skud_12.154        PGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKP
NDAI0B01970        PKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP
NCAS0B05000        PKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP
ZYRO0C01716g       PNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS
TDEL0F03860        PTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP
                     : : *..*.*.:***::: :*:.:  :* :*..:*:****:**********.*:**..

CAGL0L12188g       KAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLES
TBLA0E04410        KSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVD
KLLA0F19085g       KAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLES
KNAG0G02020        KAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEK
TPHA0J00720        KAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDREKESLES
AGR089C            KAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEP
Ecym_4311          KADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEA
SAKL0H17094g       KAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLES
KLTH0G13750g       KAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLES
Kwal_56.23825      KAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQ
Kpol_392.8         KAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLES
KAFR0B02710        KAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLES
Smik_12.145        KAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLES
YLR086W            KAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLES
Suva_10.170        KAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENRFEIVNREKNSLES
Skud_12.154        KAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANRFEIVDREKNSLES
NDAI0B01970        KAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLES
NCAS0B05000        KAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLES
ZYRO0C01716g       KAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLEN
TDEL0F03860        KAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLET
                   *::.:.:********** **  :*  *     .:  :*: * *.  *: ::: ** .*  

CAGL0L12188g       GKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANS
TBLA0E04410        GKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISK
KLLA0F19085g       GKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQK
KNAG0G02020        DKDAALEFLEKEKQLTLLKSKLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMK
TPHA0J00720        EKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKN
AGR089C            GKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQK
Ecym_4311          GKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTEKLENERNKYGELQK
SAKL0H17094g       GKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQR
KLTH0G13750g       GKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKR
Kwal_56.23825      GKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSE
Kpol_392.8         GKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEI
KAFR0B02710        DKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQS
Smik_12.145        GKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLK
YLR086W            GKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLK
Suva_10.170        GKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKDFESEKKKFQESLK
Skud_12.154        GKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNREFESEKKKFQESLR
NDAI0B01970        SKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQR
NCAS0B05000        GKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQN
ZYRO0C01716g       GKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKK
TDEL0F03860        GKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLK
                    *: ** :: :*.  ..  ::  *  :     *      :                    

CAGL0L12188g       HISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKI
TBLA0E04410        ELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNT
KLLA0F19085g       EAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQ
KNAG0G02020        EVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVES
TPHA0J00720        KIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEE
AGR089C            EIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNT
Ecym_4311          EITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQV
SAKL0H17094g       EVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKS
KLTH0G13750g       EIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHA
Kwal_56.23825      EMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQS
Kpol_392.8         QMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELED
KAFR0B02710        EIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHD
Smik_12.145        KVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKC
YLR086W            KVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKS
Suva_10.170        EVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNLVNKMGKAEKILKS
Skud_12.154        EVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNLVNKMGKAEKALKS
NDAI0B01970        ETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQ
NCAS0B05000        EINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIAT
ZYRO0C01716g       ELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSS
TDEL0F03860        EVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKS
                                                    :       :  ..   *          

CAGL0L12188g       LQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAE
TBLA0E04410        TEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILK
KLLA0F19085g       SESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMES
KNAG0G02020        SKSLISKNEHELQEQSQLQEEYEAEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIAS
TPHA0J00720        DLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILK
AGR089C            VEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAV
Ecym_4311          AEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMSLRDKTSSISEEVAS
SAKL0H17094g       TENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIAN
KLTH0G13750g       TVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGE
Kwal_56.23825      ITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISEQIRE
Kpol_392.8         CNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQ
KAFR0B02710        KRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQISL
Smik_12.145        TKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQ
YLR086W            TKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIR
Suva_10.170        TNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSLKDKTKDISAEIIQ
Skud_12.154        TKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSLKDKTKDISAKIIR
NDAI0B01970        SKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSLKDKTTDISNEIAQ
NCAS0B05000        TEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILI
ZYRO0C01716g       MDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQ
TDEL0F03860        NQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQ
                              :                *          *  :*  *  *   ::  :  

CAGL0L12188g       YEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQE
TBLA0E04410        NEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEK
KLLA0F19085g       LERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKET
KNAG0G02020        IEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKD
TPHA0J00720        TEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKE
AGR089C            LEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREES
Ecym_4311          LEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKK
SAKL0H17094g       HERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIA
KLTH0G13750g       IEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQA
Kwal_56.23825      IEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGS
Kpol_392.8         HEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLISVKIEEKISREKE
KAFR0B02710        YEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI
Smik_12.145        HEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKILARKAHKQELQDL
YLR086W            HEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDL
Suva_10.170        HEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENIAAKKARKQELQGF
Skud_12.154        HEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKIISKKQRKQELQGL
NDAI0B01970        HERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEK
NCAS0B05000        HEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREED
ZYRO0C01716g       LEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKE
TDEL0F03860        YEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKV
                    *.: .*   : :    :::: :    :: .               :             

CAGL0L12188g       IKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVL
TBLA0E04410        ITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVL
KLLA0F19085g       ETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVL
KNAG0G02020        VTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVL
TPHA0J00720        VKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVL
AGR089C            IETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVL
Ecym_4311          INKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVL
SAKL0H17094g       IHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVL
KLTH0G13750g       IEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVL
Kwal_56.23825      VFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVL
Kpol_392.8         IGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVL
KAFR0B02710        IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL
Smik_12.145        ILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEARSSLSEAQNKSKVL
YLR086W            ILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVL
Suva_10.170        ILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEARSSLSKAENKSKVL
Skud_12.154        VLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVL
NDAI0B01970        LIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVL
NCAS0B05000        LVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVL
ZYRO0C01716g       LDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVL
TDEL0F03860        IRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVL
                                    .  :         .:.  :   **   : .      :*.. **

CAGL0L12188g       SALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRK
TBLA0E04410        TALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRK
KLLA0F19085g       LALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRK
KNAG0G02020        TSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRK
TPHA0J00720        RALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRK
AGR089C            TALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRK
Ecym_4311          GALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVETVECAQQCIEHLRK
SAKL0H17094g       SALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRK
KLTH0G13750g       SALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRK
Kwal_56.23825      AALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRK
Kpol_392.8         ASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRK
KAFR0B02710        SALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRK
Smik_12.145        TALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDTVECAQQCIDYLRK
YLR086W            TALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDTVECAQHCIDYLRK
Suva_10.170        TALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDTVECAQHCIDYLRK
Skud_12.154        TALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRK
NDAI0B01970        SALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRK
NCAS0B05000        TALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCIEYLRK
ZYRO0C01716g       TALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRK
TDEL0F03860        TALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRK
                    :* .:*.***: *::****:*. *   :*:*:*.*..**:*:**:.*:..* **:.***

CAGL0L12188g       NKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNME
TBLA0E04410        NRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLL
KLLA0F19085g       NKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQ
KNAG0G02020        NKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLK
TPHA0J00720        NNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLK
AGR089C            NKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLS
Ecym_4311          NKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLA
SAKL0H17094g       NKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLK
KLTH0G13750g       NKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLK
Kwal_56.23825      NKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLK
Kpol_392.8         NKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLK
KAFR0B02710        NKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIR
Smik_12.145        NKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLK
YLR086W            NKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLK
Suva_10.170        NKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLK
Skud_12.154        NKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLK
NDAI0B01970        NKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLK
NCAS0B05000        NKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLK
ZYRO0C01716g       NKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLK
TDEL0F03860        NKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLA
                   *.**:.**::*:.*.        **    **:*:       *  *::*** :**.  .: 

CAGL0L12188g       QANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKS-SSKGSAFFSPEEVQ
TBLA0E04410        HANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQ
KLLA0F19085g       QANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKAT-TAS---QYSRDEVE
KNAG0G02020        QANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTK-VSGTSEIFSLEDMK
TPHA0J00720        EANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNS-TSKEKSTYSSEEVM
AGR089C            QANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQ-----SSLYTPEEVQ
Ecym_4311          QANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQR-SND---MYTSEEVQ
SAKL0H17094g       QANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAG----YTPEEVQ
KLTH0G13750g       EANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERL-NTG--ASFTAEEVR
Kwal_56.23825      EANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQ-SNS---AFTAEEVQ
Kpol_392.8         DANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKS-GNSGFKSYTIEDVE
KAFR0B02710        QANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNS-NMEHLEVYEAGDVE
Smik_12.145        QANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTN-QSNKIDDYTPEEVN
YLR086W            QANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN-QSDKVDDYTPEEVD
Suva_10.170        QANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKN-QSDRMDDYTPEEVN
Skud_12.154        QANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTN-QSDEIEDYTPEEVI
NDAI0B01970        QANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKK-GQENIDIYSNDDIE
NCAS0B05000        QANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRK-GQNYFDDYNPEDVE
ZYRO0C01716g       QANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRN-KTEDIEIYSSEEVA
TDEL0F03860        QANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQN-NSYSPDIFSPEEVA
                    ** ****  *:***::.*:*** ***::***     * *                 :: 

CAGL0L12188g       AIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNIN
TBLA0E04410        KLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLIS
KLLA0F19085g       KMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQ
KNAG0G02020        KLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRS
TPHA0J00720        EIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRK
AGR089C            RMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIE
Ecym_4311          RMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKD
SAKL0H17094g       NIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTELKLKQE
KLTH0G13750g       QIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCED
Kwal_56.23825      QIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEG
Kpol_392.8         KIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQ
KAFR0B02710        KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQ
Smik_12.145        KIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQ
YLR086W            KIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQ
Suva_10.170        KIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEADSLASELALAEE
Skud_12.154        KIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQ
NDAI0B01970        KIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQD
NCAS0B05000        QIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKER
ZYRO0C01716g       QLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEI
TDEL0F03860        QLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEK
                    :: :*   * .:  * .   .*:  :    :  *  :  : .  ::      :      

CAGL0L12188g       VLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGD
TBLA0E04410        QLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGI
KLLA0F19085g       RLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGI
KNAG0G02020        QLTEKSNDYEKSIKDTDDLDLLLGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGS
TPHA0J00720        QLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGI
AGR089C            RKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGL
Ecym_4311          TLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGL
SAKL0H17094g       QLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIMKIGGT
KLTH0G13750g       RAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGT
Kwal_56.23825      RLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGT
Kpol_392.8         QLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGI
KAFR0B02710        QLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGK
Smik_12.145        QVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGT
YLR086W            QVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGI
Suva_10.170        QVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGT
Skud_12.154        QAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGT
NDAI0B01970        QLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKIDKLKKRIMEIGGI
NCAS0B05000        QLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGI
ZYRO0C01716g       QMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGA
TDEL0F03860        LLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGS
                                            :  *                 :  :.  *:  ** 

CAGL0L12188g       ELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAEN
TBLA0E04410        ELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNNILKKLQNELNTTKDNSLEFKTNLEN
KLLA0F19085g       ELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISI
KNAG0G02020        ELQLQNSKVSSLNQRIDILQAKLKKSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAH
TPHA0J00720        KLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKKIA
AGR089C            ELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQK
Ecym_4311          KLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSK
SAKL0H17094g       KLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASNDIESCNLEISK
KLTH0G13750g       KLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELES
Kwal_56.23825      KLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSL
Kpol_392.8         KLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSECSTDLLTSTDKLEN
KAFR0B02710        ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLET
Smik_12.145        KLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSERDVELSSNELKA
YLR086W            KLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSERDVELSSDELKV
Suva_10.170        NLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVERDIELSSNELKV
Skud_12.154        KLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFEQDEELSSNELKV
NDAI0B01970        DLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDS
NCAS0B05000        ELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKE
ZYRO0C01716g       ELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQT
TDEL0F03860        ELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQEIAS
                   .*:     * .  :.      . *       .    : .  .       :      .   

CAGL0L12188g       ADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNK
TBLA0E04410        SKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNK
KLLA0F19085g       LSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDR
KNAG0G02020        AKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENK
TPHA0J00720        LENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIK
AGR089C            MKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQ
Ecym_4311          TNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTH
SAKL0H17094g       ISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINNR
KLTH0G13750g       IKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQ
Kwal_56.23825      IENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQ
Kpol_392.8         TDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNK
KAFR0B02710        LQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNK
Smik_12.145        IEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENIDEFKSLEIEMKNK
YLR086W            IEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESINEFKSIEIEMKNK
Suva_10.170        IEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNK
Skud_12.154        IEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNK
NDAI0B01970        FSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEIDVKDR
NCAS0B05000        ISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNK
ZYRO0C01716g       LKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNE
TDEL0F03860        LKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDK
                    .                .                      .       :   .::    

CAGL0L12188g       LEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEEN------ASVDKSDPKLEN
TBLA0E04410        LDKLKDLSHHLEKQIGKLDTELNALTIREISQNLESFDERL-------EKYDISKNGATE
KLLA0F19085g       LEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDG--------IIESCTDVTAKV
KNAG0G02020        IERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQ-QPTTGTDETTSN
TPHA0J00720        SEKLASLLNQIKKILKALEEDHSSLSIREVAYDL--------------DLLNIKEQEAQK
AGR089C            LQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSF--SHSPTPDTKREN
Ecym_4311          LEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLE---SLTDRAVTPSNQ
SAKL0H17094g       LEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENE-DDFEVQDEEVQR
KLTH0G13750g       LEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSE----SRSGDELHGQSS
Kwal_56.23825      LDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESLENE----SKNEVAAETPGE
Kpol_392.8         EEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQDE--EDVSMKDNAVSV
KAFR0B02710        LEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSS
Smik_12.145        LEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDI----VKTDNKIEQAVV
YLR086W            LEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDS----VKEDVKNNQELD
Suva_10.170        LEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDI----LDKEGEDRQETN
Skud_12.154        LEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDN---------NQMDVVEDGIKD
NDAI0B01970        LEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDN--------NSINGVDRTSHG
NCAS0B05000        LEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE--------SEAKAPNNGTLS
ZYRO0C01716g       LEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNAS---DPSENPVSDVEE
TDEL0F03860        LEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG--------ESTNNSKMP-NE
                    :.                       :*.    :                          

CAGL0L12188g       TSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQG--GFINPGIPVLSASELAK
TBLA0E04410        DTQHTSSALNSVSNINTD---------------TMDIDSTD--NEINPGIKRLSELEINE
KLLA0F19085g       MNGDIVQTQSITDVGNND---------------AME-DSGE--AATHSGLPSLTETELEN
KNAG0G02020        VDNEMLGAADAGVENMNTSSLSNSVKVASDEI-SMDVDDCG--DLVSQGIPRLSDKELST
TPHA0J00720        IKTELYADFEQNQSNDVIND-------------EMIIEDNN--NEIAKGIPSYMESDFKQ
AGR089C            IQSSMLETHLASPSPNERKISIAENNL------SMEVDEQA--SVLENGLPKLPDSELAR
Ecym_4311          CIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA--SYIGPGLPKLTEAELDN
SAKL0H17094g       EQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYE--NETSNGLPKFSEAQLQS
KLTH0G13750g       EARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKE
Kwal_56.23825      EDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTE--ESLPNGLPKLLEDELEN
Kpol_392.8         SANNSLGNSENMEGVEIETNESDVSPDANNDL-EMEIDEDN--NEISKGIPRISEDEFKN
KAFR0B02710        HTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVT--EEVSKGIPKLTDDDLKS
Smik_12.145        KEKRSSETQDEKNIQEEERTCDDHH--------SMDIDETS--NEVIRGIPRFSEEELKE
YLR086W            QEYRSCETQDESEIKDAETSCDNYH--------PMNIDETS--DEVSRGIPRLSEDELRE
Suva_10.170        QEDISGEAKGETQGEEGDNDDRH----------CMNIDETS--DEVSRGIPRLSEDELKE
Skud_12.154        EQDADQDKPSGIPDDEKIQEKDDADNNHH----SMNIDEMS--SEISRGIPKLCEEELKD
NDAI0B01970        GGVPLQDQNKVVRENNMRNEKNSTEA-------EMEIDDVA--DEFSPGIPRISKAKLLQ
NCAS0B05000        DEQIHDQTGHELTNTAVQDDD------------SMDIDNGA--EVISNGLPILSDDELSA
ZYRO0C01716g       SESSVGEGKDENKDLDAQDQVQDAEKQGDN---QMDVEDGG--EYSDRGLTQFSEDELHE
TDEL0F03860        LQEKRTEGADATRQEGEESDVSMEEEKSNDE--VMEVDEKP--HELENGLPRVSEAELKS
                                                         .         .:      .:  

CAGL0L12188g       VDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEG
TBLA0E04410        LDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEV
KLLA0F19085g       LDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCES
KNAG0G02020        IDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEE
TPHA0J00720        FDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELED
AGR089C            VDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEV
Ecym_4311          IDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEM
SAKL0H17094g       IQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEE
KLTH0G13750g       LNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDN
Kwal_56.23825      FEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNEN
Kpol_392.8         VDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDK
KAFR0B02710        IDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELEK
Smik_12.145        LDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEV
YLR086W            LDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGI
Suva_10.170        LNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEI
Skud_12.154        LDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEI
NDAI0B01970        IDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLLDE
NCAS0B05000        LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE
ZYRO0C01716g       IEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKVKEKLDE
TDEL0F03860        LDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGE
                   .:   :      *   .     :: :*:**  *. :.. *. :*: ::  .:        

CAGL0L12188g       IKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
TBLA0E04410        LKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
KLLA0F19085g       FKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
KNAG0G02020        LKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
TPHA0J00720        LKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
AGR089C            LKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
Ecym_4311          LKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
SAKL0H17094g       LKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
KLTH0G13750g       LRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
Kwal_56.23825      LKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
Kpol_392.8         LKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
KAFR0B02710        LKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
Smik_12.145        LKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
YLR086W            LKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
Suva_10.170        LKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
Skud_12.154        LKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NDAI0B01970        LKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWR
NCAS0B05000        LKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
ZYRO0C01716g       LKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWR
TDEL0F03860        LKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
                   :.. * ::*  .*  *.: :**:**:**:********:*:******** ***********

CAGL0L12188g       NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
TBLA0E04410        NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQL
KLLA0F19085g       NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
KNAG0G02020        NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
TPHA0J00720        NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
AGR089C            NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Ecym_4311          NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
SAKL0H17094g       NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
KLTH0G13750g       NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Kwal_56.23825      NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Kpol_392.8         NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
KAFR0B02710        NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Smik_12.145        NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
YLR086W            NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Suva_10.170        NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Skud_12.154        NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
NDAI0B01970        NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
NCAS0B05000        NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
ZYRO0C01716g       NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
TDEL0F03860        NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
                   **:*********************.*******************************:**:

CAGL0L12188g       IVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA----
TBLA0E04410        IVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRDT---
KLLA0F19085g       IVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS----
KNAG0G02020        IVISLRNNMFELAKQLVGIYKHENMTKNATIRNREDLIQ-----
TPHA0J00720        IVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCRK----
AGR089C            IVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL----
Ecym_4311          IVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNIK----
SAKL0H17094g       IVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV----
KLTH0G13750g       IVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS----
Kwal_56.23825      IVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDRS----
Kpol_392.8         IVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD----
KAFR0B02710        IVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC-----
Smik_12.145        IVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT----
YLR086W            IVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT----
Suva_10.170        IVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN----
Skud_12.154        IVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD----
NDAI0B01970        IVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV-
NCAS0B05000        IVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSDINRE
ZYRO0C01716g       IVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS----
TDEL0F03860        IVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNRT----
                   ************::.*:*:**  * *...:: * : :       

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L12188g
---------MSDR---PVSKRQKVT--------------------------------EED
EEEDVIHTPKAVTFEQSPR--AITPRNLL--GSENRNVLPTG-------GSQ-NLQIPSL
LP---PES-LGSARGR-DFKSYSQSPP----RSPGRSPTRRLKLIELSPIKNSRA-ELQK
LYESKKLDV--KKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDK----DD-GSTTIDETK
GNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA
KAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLES
GKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANS
HISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKI
LQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAE
YEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQE
IKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVL
SALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRK
NKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNME
QANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKS-SSKGSAFFSPEEVQ
AIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNIN
VLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGD
ELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAEN
ADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNK
LEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEEN------ASVDKSDPKLEN
TSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQG--GFINPGIPVLSASELAK
VDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEG
IKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA----
>TBLA0E04410
---------MPDS---PISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIG
PYQGQEKHIQPQSQDRHGR--SRTPRKLIVSSADHRFTMSQP-----NLLSA-DSQTPSL
QH-------PSVSTGR-EHKFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRA-ELQK
MYELQQTQK--RTIRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVEIHFQYVIDD----PNGGPSKIDESK
EKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP
KSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVD
GKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISK
ELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNT
TEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILK
NEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEK
ITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVL
TALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRK
NRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLL
HANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQ
KLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLIS
QLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGI
ELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNNILKKLQNELNTTKDNSLEFKTNLEN
SKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNK
LDKLKDLSHHLEKQIGKLDTELNALTIREISQNLESFDERL-------EKYDISKNGATE
DTQHTSSALNSVSNINTD---------------TMDIDSTD--NEINPGIKRLSELEINE
LDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEV
LKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQL
IVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRDT---
>KLLA0F19085g
MTADSSVPHLGDS---PEIKRQRVS-----------------------------------
----------------QSP--TRTPRKLVLGSPEKKYAVSNS---QATTAASNTMDPPSL
QP---PT--AHAVRGR----EYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRL-ELQK
MHEANTQ----TSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDT----DN-GETKILPSA
GTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA
KAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLES
GKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQK
EAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQ
SESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMES
LERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKET
ETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVL
LALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRK
NKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQ
QANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKAT-TAS---QYSRDEVE
KMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQ
RLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGI
ELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISI
LSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDR
LEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDG--------IIESCTDVTAKV
MNGDIVQTQSITDVGNND---------------AME-DSGE--AATHSGLPSLTETELEN
LDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCES
FKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS----
>KNAG0G02020
---------MLDT---PSSKKRRTV---GEDAVTPCQDLALEEDTTRNDERNKNNATKSS
LHDSLPKLQSSVSPLDFKK--TVTPRKLIIGPSENKYALSQP----TTSASS-SLQVPAL
QQKLVPL--SQDSRGR-RIKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRL-ELQK
LYDAHNAKI-GKMNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTD-GDT--MEAE
NTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA
KAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEK
DKDAALEFLEKEKQLTLLKSKLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMK
EVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVES
SKSLISKNEHELQEQSQLQEEYEAEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIAS
IEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKD
VTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVL
TSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRK
NKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLK
QANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTK-VSGTSEIFSLEDMK
KLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRS
QLTEKSNDYEKSIKDTDDLDLLLGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGS
ELQLQNSKVSSLNQRIDILQAKLKKSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAH
AKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENK
IERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQ-QPTTGTDETTSN
VDNEMLGAADAGVENMNTSSLSNSVKVASDEI-SMDVDDCG--DLVSQGIPRLSDKELST
IDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEE
LKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAKQLVGIYKHENMTKNATIRNREDLIQ-----
>TPHA0J00720
---------MSAL---PDAKKQKVK----------------------DIESNSPLNNDIP
KIAQSRNDSPLQVANDPLK--SYTPMKVIISNNHSNSISPLP----SQLMSS-STQPPSL
QH---P---SSSSRGR-AVKAYSQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRS-ELQK
IYSSKQEE---KIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDY----PD-DTTKINPSK
QPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP
KAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDREKESLES
EKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKN
KIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEE
DLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILK
TEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKE
VKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVL
RALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRK
NNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLK
EANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNS-TSKEKSTYSSEEVM
EIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRK
QLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGI
KLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKKIA
LENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIK
SEKLASLLNQIKKILKALEEDHSSLSIREVAYDL--------------DLLNIKEQEAQK
IKTELYADFEQNQSNDVIND-------------EMIIEDNN--NEIAKGIPSYMESDFKQ
FDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELED
LKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCRK----
>AGR089C
----------MDI---PTPKKPRIL-----------------------------------
----------------------DTPVKLLATSPDRKNVVSRG----SSVSTTMGLRGPSL
QP---PVA-HQISRGR---SQYSQSPP----RSPNRSPGRAVELIQLSPIKNSRL-ELQR
LYDTKQK----KVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSM
LFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDE----PD-GTTRVLSGK
PELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKP
KAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEP
GKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQK
EIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNT
VEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAV
LEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREES
IETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVL
TALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRK
NKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLS
QANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQ-----SSLYTPEEVQ
RMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIE
RKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGL
ELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQK
MKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQ
LQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSF--SHSPTPDTKREN
IQSSMLETHLASPSPNERKISIAENNL------SMEVDEQA--SVLENGLPKLPDSELAR
VDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEV
LKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL----
>Ecym_4311
---------MADL---RTSKKPKHL-----------------------------------
----------------------DTPSKLMFGSPGRKHVASQA----SSNSTT-ALRGPSL
QP---PTY-SQLSRGR---SVYSQSPP----RSPNRSPARRIELIQLSPIKNSRL-ELQK
IYDGKQT----TTKRLSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYVMDD----AD-GNTKVLPDV
QELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKP
KADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEA
GKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTEKLENERNKYGELQK
EITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQV
AEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMSLRDKTSSISEEVAS
LEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKK
INKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVL
GALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVETVECAQQCIEHLRK
NKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLA
QANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQR-SND---MYTSEEVQ
RMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKD
TLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGL
KLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSK
TNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTH
LEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLE---SLTDRAVTPSNQ
CIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA--SYIGPGLPKLTEAELDN
IDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEM
LKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNIK----
>SAKL0H17094g
---------MSDS---PLAKKQKTR------------------TDDRGQIQSNPTVSPIP
PVSGSSLMAVKSSPTRQDRLPSPTPRKLVLGSPEKKYAYSQP------STSS-SLSVPNL
QP---PN--VDGSRGR---RFYSQSPPRSPHRSPNRSPTRRLELIQLSPVKNNRA-ELQK
IYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDE----SD-GTTRSDDEK
PPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP
KAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLES
GKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQR
EVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKS
TENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIAN
HERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIA
IHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVL
SALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRK
NKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLK
QANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAG----YTPEEVQ
NIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTELKLKQE
QLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIMKIGGT
KLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASNDIESCNLEISK
ISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINNR
LEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENE-DDFEVQDEEVQR
EQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYE--NETSNGLPKFSEAQLQS
IQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEE
LKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV----
>KLTH0G13750g
----------MES---PLSKKQKTF---------------------------------VN
RDEDFSQTEESVDVTRASR--SRTPRKLVLGSPDKRFAFSQP------VTSS-SSNVPYL
QP---LKSELSSSRGR----VYSQSPP----RSPTRSPTRKLELIQLSPTKKTRL-ESQK
TEQVRGLAQ--PIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSL
LFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDE----LD-GRTTVRQDR
PGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKP
KAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLES
GKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKR
EIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHA
TVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGE
IEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQA
IEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVL
SALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRK
NKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLK
EANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERL-NTG--ASFTAEEVR
QIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCED
RAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGT
KLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELES
IKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQ
LEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSE----SRSGDELHGQSS
EARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKE
LNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDN
LRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS----
>Kwal_56.23825
----------MDS---PLAKKQKTH---------------------------------VS
NESENSSTEESPDVTRASR--SRTPRKLVLGSPDKRFAFSQP------VSSS-SSNVPHL
QP---LKNELSSSRGR----VYSQSPP----RSPNRSPTRKLELIQLSPMKKSRL-ESQK
FQESRAMMG--SIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSL
LFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDE----PD-GTTSIIQQK
PSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKP
KAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQ
GKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSE
EMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQS
ITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISEQIRE
IEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGS
VFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVL
AALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRK
NKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLK
EANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQ-SNS---AFTAEEVQ
QIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEG
RLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGT
KLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSL
IENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQ
LDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESLENE----SKNEVAAETPGE
EDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTE--ESLPNGLPKLLEDELEN
FEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNEN
LKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDRS----
>Kpol_392.8
---------MPKT---PLSKRPKLV-----EANLN--------ANELDHNDDDQRYNRQE
IKVSPTTQDAAAVSHLNFK--SQTPKKLILRDYDSIAITPTA----AMPPSS-SLQAPSL
HP---PT--ESSSRGR-TARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRI-ALQK
IYESKNEK---QIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSM
LFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDK----PD-GTTIINTVK
EKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP
KAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLES
GKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEI
QMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELED
CNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQ
HEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLISVKIEEKISREKE
IGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVL
ASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRK
NKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLK
DANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKS-GNSGFKSYTIEDVE
KIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQ
QLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGI
KLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSECSTDLLTSTDKLEN
TDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNK
EEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQDE--EDVSMKDNAVSV
SANNSLGNSENMEGVEIETNESDVSPDANNDL-EMEIDEDN--NEISKGIPRISEDEFKN
VDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDK
LKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD----
>KAFR0B02710
---------MSHT---PLSKKQKVV-------------------------SDEERITPNQ
NEQDNDKTHPEVTASSFLK--SHTPRKLLLGSADNKYVLSQPIISSSSHGSS-SLQVPNL
QP---PL--SQPSRGR-DKKAYSQSPP----RSPGRSPVRKLELIQLSPIKNNRI-ELQK
LYNSKNQ----NKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDE----ND-GTSKIIEDR
KPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA
KAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLES
DKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQS
EIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHD
KRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQISL
YEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI
IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL
SALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRK
NKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIR
QANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNS-NMEHLEVYEAGDVE
KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQ
QLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGK
ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLET
LQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNK
LEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSS
HTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVT--EEVSKGIPKLTDDDLKS
IDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELEK
LKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC-----
>Smik_12.145
---------MCDS---PLSKRQKRK----------AVEEPELSLDDSDATQELQAEKQAD
RSEKTPDPNSPALETSYAK--SHTPRKLVLSSGENRYAFSQP----TNSATT-SLHVPNL
QP---P---GTSSRGR-DYKAYSQSPP----RSPGRSPTRRLELLQLSPVKNSRV-ELQK
LYNSHQSST-KQQGRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVIDE----SS-GTSRIDEEK
PGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP
KAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLES
GKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLK
KVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKC
TKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQ
HEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKILARKAHKQELQDL
ILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEARSSLSEAQNKSKVL
TALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDTVECAQQCIDYLRK
NKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLK
QANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTN-QSNKIDDYTPEEVN
KIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQ
QVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGT
KLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSERDVELSSNELKA
IEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENIDEFKSLEIEMKNK
LEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDI----VKTDNKIEQAVV
KEKRSSETQDEKNIQEEERTCDDHH--------SMDIDETS--NEVIRGIPRFSEEELKE
LDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEV
LKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT----
>YLR086W
---------MSDS---PLSKRQKRK----------SAQEPELSLDQGDAEEDSQVENRVN
LSENTPEPDLPALEASYSK--SYTPRKLVLSSGENRYAFSQP----TNSTTT-SLHVPNL
QP---P---KTSSRGR-DHKSYSQSPP----RSPGRSPTRRLELLQLSPVKNSRV-ELQK
IYDRHQSSS-KQQSRLFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVIDE----SS-GTSRIDEEK
PGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP
KAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLES
GKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLK
KVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKS
TKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIR
HEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDL
ILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVL
TALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDTVECAQHCIDYLRK
NKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLK
QANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN-QSDKVDDYTPEEVD
KIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQ
QVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGI
KLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSERDVELSSDELKV
IEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESINEFKSIEIEMKNK
LEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDS----VKEDVKNNQELD
QEYRSCETQDESEIKDAETSCDNYH--------PMNIDETS--DEVSRGIPRLSEDELRE
LDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGI
LKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT----
>Suva_10.170
---------MYDS---PLSKRQKRK----------TAEEPELSINHGNGEQEPKAEKQND
RTEKTPDPDSLSLESSYAK--SHTPRKLVLSSGENRYAFSQP----TNSATS-SLHVPNL
QP---P---EAPSRGR-DYKAYSQSPP----RSPGRSPTRRLELLQLSPVKNSRI-ELQK
LYDSHQPSG-EQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDE----PS-GTSRIDEEK
PGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS
KAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENRFEIVNREKNSLES
GKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKDFESEKKKFQESLK
EVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNLVNKMGKAEKILKS
TNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSLKDKTKDISAEIIQ
HEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENIAAKKARKQELQGF
ILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEARSSLSKAENKSKVL
TALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDTVECAQHCIDYLRK
NKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLK
QANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKN-QSDRMDDYTPEEVN
KIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEADSLASELALAEE
QVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGT
NLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVERDIELSSNELKV
IEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNK
LEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDI----LDKEGEDRQETN
QEDISGEAKGETQGEEGDNDDRH----------CMNIDETS--DEVSRGIPRLSEDELKE
LNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEI
LKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN----
>Skud_12.154
---------MCDS---PLSKKQKRK----------ATEEPELSLNDTDAERESRVENRVN
RTEKTPDPNSPSLESSYAR--SHTPRKLVLSSGENRYAFSQP----TNSATT-SLHVPNL
QP---P---KVSSRGR-DYKAYSQSPP----RSPGRSPARRLELLQLSPVKNSRI-ELQK
LYDSHKSSG-KQQGRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYIIDE----PS-GTSRIDEEK
PGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKP
KAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANRFEIVDREKNSLES
GKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNREFESEKKKFQESLR
EVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNLVNKMGKAEKALKS
TKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSLKDKTKDISAKIIR
HEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKIISKKQRKQELQGL
VLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVL
TALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRK
NKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLK
QANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTN-QSDEIEDYTPEEVI
KIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQ
QAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGT
KLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFEQDEELSSNELKV
IEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNK
LEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDN---------NQMDVVEDGIKD
EQDADQDKPSGIPDDEKIQEKDDADNNHH----SMNIDEMS--SEISRGIPKLCEEELKD
LDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEI
LKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD----
>NDAI0B01970
---------MPESTNIPSPKRQKVL----------------ESHTPEQQEENRREDDESP
LRFEHQQSAVSLSPPAISK--SHTPRKLILHQSDNRYAFSQP-----TVSAS-SLQVPSL
QP---PETSSSSSRGRRDIKVYSQSPP----RSPGRSPTRKLELIQLSPVKNNRIRKLQE
LYNSQI-----KKERLFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDK----SN-GSSKIDDNK
PKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP
KAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLES
SKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQR
ETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQ
SKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSLKDKTTDISNEIAQ
HERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEK
LIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVL
SALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRK
NKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLK
QANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKK-GQENIDIYSNDDIE
KIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQD
QLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKIDKLKKRIMEIGGI
DLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDS
FSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEIDVKDR
LEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDN--------NSINGVDRTSHG
GGVPLQDQNKVVRENNMRNEKNSTEA-------EMEIDDVA--DEFSPGIPRISKAKLLQ
IDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLLDE
LKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWR
NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV-
>NCAS0B05000
----------MSL---PNTKRQKVT--------------EPESKTPEQGTEDQQANASLR
SPLQRPEHQQSISPINNSK--SHTPRKLILGQNDNRYAFSQP-----SVSSS-SFQVPTL
QP---PD--SSSSRGRKDIKSYSQSPP----RSPGRSPKRRLELIQLSPVKNNRI-KLRE
LYDAHNSQS--KKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE----HD-GDTKISETK
PKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP
KAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLES
GKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQN
EINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIAT
TEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILI
HEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREED
LVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVL
TALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCIEYLRK
NKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLK
QANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRK-GQNYFDDYNPEDVE
QIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKER
QLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGI
ELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKE
ISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNK
LEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE--------SEAKAPNNGTLS
DEQIHDQTGHELTNTAVQDDD------------SMDIDNGA--EVISNGLPILSDDELSA
LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE
LKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSDINRE
>ZYRO0C01716g
--------MDDDD---SLSKRQKVD--------------------GLNQIDGKHPTVDLD
QGENLSLPTTSSSQNTFAH--AKTPRKLVVGNGDNRYAHSSQ-----SISSS-SLQVPPL
QP---P---ATSSRGR-GSKTYSQSPP----RSPGRSPTRKLELIQISPLKNSRL-ELQK
IYDAQQNQA--RHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE----PS-GETRIDEEK
PNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKS
KAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLEN
GKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKK
ELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSS
MDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQ
LEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKE
LDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVL
TALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRK
NKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLK
QANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRN-KTEDIEIYSSEEVA
QLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEI
QMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGA
ELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQT
LKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNE
LEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNAS---DPSENPVSDVEE
SESSVGEGKDENKDLDAQDQVQDAEKQGDN---QMDVEDGG--EYSDRGLTQFSEDELHE
IEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKVKEKLDE
LKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS----
>TDEL0F03860
---------MPDT---PLTKRQRVN----------------------------DNESREF
EAVNGSTKSPLTSNSNSTI--SHTPKKLVIGTNDDTTSQSQP-----IVSSS-SLQAPSL
QH---P---NSSSRGR-EQRTYSQSPP----RSPGRSPTRKLELIKISPVKKNRL-ELQR
LYDAEQSQR--NAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSM
LFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDE----PD-GTTRIDEEK
PTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP
KAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLET
GKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLK
EVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKS
NQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQ
YEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKV
IRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVL
TALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRK
NKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLA
QANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQN-NSYSPDIFSPEEVA
QLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEK
LLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGS
ELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQEIAS
LKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDK
LEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG--------ESTNNSKMP-NE
LQEKRTEGADATRQEGEESDVSMEEEKSNDE--VMEVDEKP--HELENGLPRVSEAELKS
LDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGE
LKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR
NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
IVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNRT----