MUSCLE (3.8) multiple sequence alignment

CAGL0L12166g       MTADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR
KLLA0F19063g       -MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRR
TPHA0A01830        -MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKR
AGR091W            --MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRR
Ecym_4312          --MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRR
KNAG0G02010        ---MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRR
SAKL0H17138g       -MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRR
KLTH0G13772g       -MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNR
Kwal_56.23832      -MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNR
TBLA0H01460        -MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRR
Kpol_543.36        -MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRR
KAFR0B02700        -MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKR
NDAI0B01960        -MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRR
NCAS0B04990        -MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRR
Suva_10.169        -MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRR
Smik_12.144        -METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRR
YLR085C            -METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRR
Skud_12.153        -MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRR
ZYRO0C01738g       -MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRR
TDEL0F03850        -MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKR
                         . ::**** :**.      *  * * :: *.:   :***:   :.:::   ..*

CAGL0L12166g       PHELGQLTSWELESCIWDYCLYNPDEF-GIDW---QS-LENRHVVLSETCMTLPELSKNT
KLLA0F19063g       PHELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDND-TKDHHLVVSETLMTIPELSKNM
TPHA0A01830        PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEV---NE-DSENHLVLTETPMTLPELSRNT
AGR091W            PSELGQLISWELEEQIWDYCLFNPDEF-GWEL---KD-SKDVDLIASETCMTIPEISKNM
Ecym_4312          PFELGQLVSWELEEHIWDYCLFNSDEFS-WDL---KD-SKDVDLIVSETCMSIPEISKHM
KNAG0G02010        PHELGQLVSWELEGCIWDYCLYNPDEFDGFHL---GDNTREQDLILTETCFTLPELSKNS
SAKL0H17138g       PHELGQLTSWELQSCIWDYCLYNPDEFN-WEI---GN-TKGKHLVLSEMCMSMPELSKGT
KLTH0G13772g       PHKLGQLVSWELESQIWDYCLFNPDEFDGWSL---DT-TKNKHLIASESCMTLPELSKNM
Kwal_56.23832      PHELGQLVSWELETQIWDYCLFNPDDFNGWSI---DT-TKGKHLITSESCMTIPELSKNM
TBLA0H01460        PYELGQLTSWELESAIWDYCFYNPEEFDGFQL---ED-TSKKHLVISETCLSLPEFSRNI
Kpol_543.36        PHELGQLVSWELEGTVWDYCFFNPDEFPNFNL---KE-TKGHHLVVSETCMTLPELSANM
KAFR0B02700        PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNI---GD-TKSKHLITSETCMTLPELGKNM
NDAI0B01960        PHELGQLTSWELESCIWDYCLYNPDEFDGFEL---GG-SGKKHLIVSEPCMTLPELSKNM
NCAS0B04990        PHELGQLTSWELESSIWDYALFNPDEFPGFDL---ND-LKGKHLIASETCMTLPELSKNM
Suva_10.169        PHELGQLTLWELESCIWDYCLFNPSEFDGFDL---KE-GKGHHLVASESCMTLPELSKHA
Smik_12.144        PHELGQLTLWELESCIWDYCFFNPIEFDGFDL---KE-GKGHHLVASESCMTLPELSKHA
YLR085C            PHELGQLTLWELESCIWDYCLFNPSEFDGFDL---KE-GKGHHLVASESCMTLPELSKHA
Skud_12.153        PHELGQLTLWELESCIWDYCFFNPSEFRGFDL---KE-GKGHHLVASESCMTLPELSKHA
ZYRO0C01738g       PHEFGQLTSWELESAIWDYCFFNPDEFNGFDL---KD-SKGQHLVVSETCMTIPELSKNM
TDEL0F03850        PHEYGQLTSWELQSCVWDYCFFNPNEFDGFDL---KD-SKGQHLIASETCMTLPELSKNM
                   *   ***  **::  :***.::*  :*                :: :*  :::**:.   

CAGL0L12166g       DQVLFEEYEVDSLYKAPTAAYIPF----YTTNENIKTISGKSDH----------------
KLLA0F19063g       DQVIFEEYDFKSMFKGPVAQYIPF----YQGQYQDDAMTAAEDK----------------
TPHA0A01830        DQVVFEEYGFDSLYKAPAANFIPF---IKNDDNSFIRLSGKSKT----------------
AGR091W            DQVVFEEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEV----------------
Ecym_4312          DQVVFEEYEFGSLMKCPVAQYIPF------DNMADYKVYGSDGL----------------
KNAG0G02010        DQVVFEEYEFATMFKSPASGFMPF--ANLIGNKNMEHLCGKDTA----------------
SAKL0H17138g       DQVVFEEYEFGSCFKGPVAGFVPF----NWQALEHNMIYAKEDS----------------
KLTH0G13772g       DQVVFEEYEYDSLFKAPVPVFVPF----NAEGDTTHILVAKEDA----------------
Kwal_56.23832      DQVVFEEYEFETMFKAPVPVFVPF----NTGKKSTHMLVAKEDS----------------
TBLA0H01460        DHIIFEEYNYGSIYKSPVAGFIPF----ADLTKDVISISGKADDDDDDNNAKFQEQLVTN
Kpol_543.36        DQVMFEEYEFESLFKSPVAGFVPF----LNLQDNMKMICGKGDD----------------
KAFR0B02700        DQVIFEEYEFGSLMKSPVAGYMPF-----LRNTKDQIIIGERDT----------------
NDAI0B01960        DQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS-------EN
NCAS0B04990        DQVVFEEYEFDSYYKSSIAGFIQF-----ADDKNTKIISGKTEE----------------
Suva_10.169        DQVIFEEYEFDSLFKSPVAVFVPF---TKSYKGKMRTISGKDEDADVAISD-------SD
Smik_12.144        DQVIFEEYEFDSLFKSPVAAFVPF---TKSYKSKMKAISGKDEDADIVVSK-------SN
YLR085C            DQVIFEEYEFDSLFKSPVAVFVPF---TKSYKGEMRTISGKDEDIDIVRGN-------SD
Skud_12.153        DQVIFEEYEFDSLFKSPVAVFVPF---TKSYKGKLKTISGKDEEADVVTSN-------SG
ZYRO0C01738g       DQVVFEEYEFASMFKSPIAGFAPF-------GRPSIAISGKGDD----------------
TDEL0F03850        DQVVFEEYEFDSLLKAPISGFMPF----SKHTENTKVISGKGDS----------------
                   *:::****   :  * . . :  *             : .                    

CAGL0L12166g       ----GELDIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNG
KLLA0F19063g       --------------KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTG
TPHA0A01830        ---------YLDGSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNG
AGR091W            ------------VEAKSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNG
Ecym_4312          ----------PVVRKKDDYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTG
KNAG0G02010        ------VNTDYTTATTKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNG
SAKL0H17138g       ------VYRKDSTGERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNG
KLTH0G13772g       -----DVVASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNG
Kwal_56.23832      ------EVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNG
TBLA0H01460        DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG
Kpol_543.36        -VMGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNG
KAFR0B02700        -------EPFVETPSTEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNG
NDAI0B01960        VTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTG
NCAS0B04990        ----DISLDSVNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDG
Suva_10.169        DKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTG
Smik_12.144        EADMPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTG
YLR085C            STNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTG
Skud_12.153        ITTFTSRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTG
ZYRO0C01738g       --------QPNRKAEPDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNG
TDEL0F03850        -------ESGTSTSETKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFING
                                     *  :.:::* *::*:* :*::**:*:*** **:::****: *

CAGL0L12166g       LLKETISFRHYNVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQG
KLLA0F19063g       LLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLG
TPHA0A01830        LLKETISYRHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMG
AGR091W            LLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIG
Ecym_4312          LLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIG
KNAG0G02010        LLKETLSFRHYNMMDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLG
SAKL0H17138g       FLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQG
KLTH0G13772g       FLREALSFRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQG
Kwal_56.23832      FLREALSFRHYNVMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQG
TBLA0H01460        LLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG
Kpol_543.36        LFKETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIG
KAFR0B02700        LLKETLSFRHYNVMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLG
NDAI0B01960        LLKETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLG
NCAS0B04990        LLKETLSFRHYDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLG
Suva_10.169        LLKETLSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIG
Smik_12.144        LLKETLSFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLG
YLR085C            LLKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLG
Skud_12.153        LLKETLSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIG
ZYRO0C01738g       LLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLG
TDEL0F03850        LLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLG
                   ::.*::*:***:: :*::* *.:**:* :: * :* .:*  .     :::**:: ::  *

CAGL0L12166g       YVRDPKT---ALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELL
KLLA0F19063g       YVKKPGKE--KLTDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVV
TPHA0A01830        YVRDMKKHS-TLPEHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESL
AGR091W            YVRQPKQ---AIPKTSQILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVL
Ecym_4312          YVRQPKQ---AIPEDSQTLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELI
KNAG0G02010        YLVDESNRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPL
SAKL0H17138g       YVKQQKQ---KIPEDSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAI
KLTH0G13772g       YLRKPGQ---TLPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEAL
Kwal_56.23832      YLRKPGQ---VLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAI
TBLA0H01460        YIKDNSKT--KLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI
Kpol_543.36        YVKDKKSNS-QLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETI
KAFR0B02700        YVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVI
NDAI0B01960        YTRENKSK--PLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEIL
NCAS0B04990        HVRDKTK---PLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELL
Suva_10.169        YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIV
Smik_12.144        YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV
YLR085C            YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV
Skud_12.153        YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV
ZYRO0C01738g       YVKDPKK---PLPQDSQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQL
TDEL0F03850        YVADRKN---PPSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPL
                   :               * : * ** *::.* :****:.   :.*::*:::*.: : ** :

CAGL0L12166g       RPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSG-DKSLTGWTAMAKFA
KLLA0F19063g       RPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA
TPHA0A01830        RSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKA-NAELQNWKAMKSFT
AGR091W            RPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQPKL-DAALQGWKSMRQFS
Ecym_4312          RPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKG-DTELQGWKAMMRFS
KNAG0G02010        RPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS
SAKL0H17138g       RPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFS
KLTH0G13772g       RPLLVGNVVVTGGNFNIPNFASRLATELQRQCPTDWSCRVSVPTG-DARLYGWKCMQKFS
Kwal_56.23832      RPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKG-DAGLYGWKCMQKFS
TBLA0H01460        RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKI-DAELFGWKAMAQFS
Kpol_543.36        RPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEK-DCELQGWKSMSQFA
KAFR0B02700        RPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKG-NSELSGWKAMSSFA
NDAI0B01960        RPLLVANIVCTGGNFNLPHFAARLAAELQRQLPTDWTCRISVPKK-ECELFSWKSMCQFA
NCAS0B04990        RPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTK-ECELFGWKAMAQFA
Suva_10.169        RPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEG-DCTLFGWEVMSQFA
Smik_12.144        RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPES-DCALFGWEVMSQFS
YLR085C            RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEG-DCALFGWEVMSQFA
Skud_12.153        RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIG-DCALFGWEVMSQFA
ZYRO0C01738g       RPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSG-PKELYGWSSMASFT
TDEL0F03850        RPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA
                   *.::  *    ****::  :  *:  ***.*   :*      .      *  *  *  *:

CAGL0L12166g       -HT-DAYKKARVTKEDYFEHGLDWTTKERFGYQNWV
KLLA0F19063g       -NS-DQFRSARVTREEYLEHGLDWCTKNRFGYQQWL
TPHA0A01830        ENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNWL
AGR091W            -QT-DSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI
Ecym_4312          -NT-DSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI
KNAG0G02010        -ST-DVYKTTRVTREEYLEHGTDWCSKHRFTYQNWI
SAKL0H17138g       -QT-TAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL
KLTH0G13772g       -ET-QAYRESRVSREEYYEHGVDWCTSKRFGYQAWL
Kwal_56.23832      -ET-EDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL
TBLA0H01460        -DT-DSYRKARITREEYMEHGVEWCTKHRFGYQNWI
Kpol_543.36        QNT-DIYKKARISREEYYEHGTDWTTKKRFGYQNWI
KAFR0B02700        -ST-DIYKATRVTREEYYEHGIDWCTKHRFGYQNWV
NDAI0B01960        -NT-DSYKKTRISKEEYYEHGPDWLTKHKFGYQNWL
NCAS0B04990        -ST-ESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI
Suva_10.169        -KT-ESYQRARVTREEYYEHGPDWCTKHRFGYQNWI
Smik_12.144        -ST-ASYRNARVTREEYYEHGSDWCTKHRFGYQNWI
YLR085C            -KT-DSYRKARVTREEYYEHGPDWCTKHRFGYQNWI
Skud_12.153        -KT-ESYRRARVTRDEYYEHGPDWCTKQRFGYQNWI
ZYRO0C01738g       -NS-PLYSDARVTREEYFEHGVDWCTRHRFGYQNWM
TDEL0F03850        -ST-DLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI
                     .   :   *::. :* *** :* :  .* *: *:

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L12166g
MTADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR
PHELGQLTSWELESCIWDYCLYNPDEF-GIDW---QS-LENRHVVLSETCMTLPELSKNT
DQVLFEEYEVDSLYKAPTAAYIPF----YTTNENIKTISGKSDH----------------
----GELDIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNG
LLKETISFRHYNVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQG
YVRDPKT---ALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELL
RPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSG-DKSLTGWTAMAKFA
-HT-DAYKKARVTKEDYFEHGLDWTTKERFGYQNWV
>KLLA0F19063g
-MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRR
PHELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDND-TKDHHLVVSETLMTIPELSKNM
DQVIFEEYDFKSMFKGPVAQYIPF----YQGQYQDDAMTAAEDK----------------
--------------KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTG
LLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLG
YVKKPGKE--KLTDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVV
RPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA
-NS-DQFRSARVTREEYLEHGLDWCTKNRFGYQQWL
>TPHA0A01830
-MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKR
PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEV---NE-DSENHLVLTETPMTLPELSRNT
DQVVFEEYGFDSLYKAPAANFIPF---IKNDDNSFIRLSGKSKT----------------
---------YLDGSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNG
LLKETISYRHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMG
YVRDMKKHS-TLPEHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESL
RSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKA-NAELQNWKAMKSFT
ENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNWL
>AGR091W
--MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRR
PSELGQLISWELEEQIWDYCLFNPDEF-GWEL---KD-SKDVDLIASETCMTIPEISKNM
DQVVFEEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEV----------------
------------VEAKSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNG
LLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIG
YVRQPKQ---AIPKTSQILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVL
RPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQPKL-DAALQGWKSMRQFS
-QT-DSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI
>Ecym_4312
--MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRR
PFELGQLVSWELEEHIWDYCLFNSDEFS-WDL---KD-SKDVDLIVSETCMSIPEISKHM
DQVVFEEYEFGSLMKCPVAQYIPF------DNMADYKVYGSDGL----------------
----------PVVRKKDDYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTG
LLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIG
YVRQPKQ---AIPEDSQTLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELI
RPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKG-DTELQGWKAMMRFS
-NT-DSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI
>KNAG0G02010
---MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRR
PHELGQLVSWELEGCIWDYCLYNPDEFDGFHL---GDNTREQDLILTETCFTLPELSKNS
DQVVFEEYEFATMFKSPASGFMPF--ANLIGNKNMEHLCGKDTA----------------
------VNTDYTTATTKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNG
LLKETLSFRHYNMMDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLG
YLVDESNRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPL
RPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS
-ST-DVYKTTRVTREEYLEHGTDWCSKHRFTYQNWI
>SAKL0H17138g
-MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRR
PHELGQLTSWELQSCIWDYCLYNPDEFN-WEI---GN-TKGKHLVLSEMCMSMPELSKGT
DQVVFEEYEFGSCFKGPVAGFVPF----NWQALEHNMIYAKEDS----------------
------VYRKDSTGERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNG
FLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQG
YVKQQKQ---KIPEDSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAI
RPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFS
-QT-TAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL
>KLTH0G13772g
-MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNR
PHKLGQLVSWELESQIWDYCLFNPDEFDGWSL---DT-TKNKHLIASESCMTLPELSKNM
DQVVFEEYEYDSLFKAPVPVFVPF----NAEGDTTHILVAKEDA----------------
-----DVVASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNG
FLREALSFRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQG
YLRKPGQ---TLPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEAL
RPLLVGNVVVTGGNFNIPNFASRLATELQRQCPTDWSCRVSVPTG-DARLYGWKCMQKFS
-ET-QAYRESRVSREEYYEHGVDWCTSKRFGYQAWL
>Kwal_56.23832
-MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNR
PHELGQLVSWELETQIWDYCLFNPDDFNGWSI---DT-TKGKHLITSESCMTIPELSKNM
DQVVFEEYEFETMFKAPVPVFVPF----NTGKKSTHMLVAKEDS----------------
------EVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNG
FLREALSFRHYNVMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQG
YLRKPGQ---VLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAI
RPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKG-DAGLYGWKCMQKFS
-ET-EDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL
>TBLA0H01460
-MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRR
PYELGQLTSWELESAIWDYCFYNPEEFDGFQL---ED-TSKKHLVISETCLSLPEFSRNI
DHIIFEEYNYGSIYKSPVAGFIPF----ADLTKDVISISGKADDDDDDNNAKFQEQLVTN
DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG
LLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG
YIKDNSKT--KLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI
RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKI-DAELFGWKAMAQFS
-DT-DSYRKARITREEYMEHGVEWCTKHRFGYQNWI
>Kpol_543.36
-MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRR
PHELGQLVSWELEGTVWDYCFFNPDEFPNFNL---KE-TKGHHLVVSETCMTLPELSANM
DQVMFEEYEFESLFKSPVAGFVPF----LNLQDNMKMICGKGDD----------------
-VMGDLISNMDSQNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNG
LFKETISYRHYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIG
YVKDKKSNS-QLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETI
RPLLVNNIVCVGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEK-DCELQGWKSMSQFA
QNT-DIYKKARISREEYYEHGTDWTTKKRFGYQNWI
>KAFR0B02700
-MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKR
PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNI---GD-TKSKHLITSETCMTLPELGKNM
DQVIFEEYEFGSLMKSPVAGYMPF-----LRNTKDQIIIGERDT----------------
-------EPFVETPSTEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNG
LLKETLSFRHYNVMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLG
YVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVI
RPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKG-NSELSGWKAMSSFA
-ST-DIYKATRVTREEYYEHGIDWCTKHRFGYQNWV
>NDAI0B01960
-MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRR
PHELGQLTSWELESCIWDYCLYNPDEFDGFEL---GG-SGKKHLIVSEPCMTLPELSKNM
DQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS-------EN
VTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTG
LLKETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLG
YTRENKSK--PLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEIL
RPLLVANIVCTGGNFNLPHFAARLAAELQRQLPTDWTCRISVPKK-ECELFSWKSMCQFA
-NT-DSYKKTRISKEEYYEHGPDWLTKHKFGYQNWL
>NCAS0B04990
-MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRR
PHELGQLTSWELESSIWDYALFNPDEFPGFDL---ND-LKGKHLIASETCMTLPELSKNM
DQVVFEEYEFDSYYKSSIAGFIQF-----ADDKNTKIISGKTEE----------------
----DISLDSVNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDG
LLKETLSFRHYDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLG
HVRDKTK---PLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELL
RPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTK-ECELFGWKAMAQFA
-ST-ESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI
>Suva_10.169
-MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRR
PHELGQLTLWELESCIWDYCLFNPSEFDGFDL---KE-GKGHHLVASESCMTLPELSKHA
DQVIFEEYEFDSLFKSPVAVFVPF---TKSYKGKMRTISGKDEDADVAISD-------SD
DKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTG
LLKETLSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIG
YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIV
RPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEG-DCTLFGWEVMSQFA
-KT-ESYQRARVTREEYYEHGPDWCTKHRFGYQNWI
>Smik_12.144
-METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRR
PHELGQLTLWELESCIWDYCFFNPIEFDGFDL---KE-GKGHHLVASESCMTLPELSKHA
DQVIFEEYEFDSLFKSPVAAFVPF---TKSYKSKMKAISGKDEDADIVVSK-------SN
EADMPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTG
LLKETLSFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLG
YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV
RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPES-DCALFGWEVMSQFS
-ST-ASYRNARVTREEYYEHGSDWCTKHRFGYQNWI
>YLR085C
-METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRR
PHELGQLTLWELESCIWDYCLFNPSEFDGFDL---KE-GKGHHLVASESCMTLPELSKHA
DQVIFEEYEFDSLFKSPVAVFVPF---TKSYKGEMRTISGKDEDIDIVRGN-------SD
STNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTG
LLKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLG
YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV
RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEG-DCALFGWEVMSQFA
-KT-DSYRKARVTREEYYEHGPDWCTKHRFGYQNWI
>Skud_12.153
-MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRR
PHELGQLTLWELESCIWDYCFFNPSEFRGFDL---KE-GKGHHLVASESCMTLPELSKHA
DQVIFEEYEFDSLFKSPVAVFVPF---TKSYKGKLKTISGKDEEADVVTSN-------SG
ITTFTSRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTG
LLKETLSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIG
YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV
RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIG-DCALFGWEVMSQFA
-KT-ESYRRARVTRDEYYEHGPDWCTKQRFGYQNWI
>ZYRO0C01738g
-MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRR
PHEFGQLTSWELESAIWDYCFFNPDEFNGFDL---KD-SKGQHLVVSETCMTIPELSKNM
DQVVFEEYEFASMFKSPIAGFAPF-------GRPSIAISGKGDD----------------
--------QPNRKAEPDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNG
LLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLG
YVKDPKK---PLPQDSQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQL
RPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLPSG-PKELYGWSSMASFT
-NS-PLYSDARVTREEYFEHGVDWCTRHRFGYQNWM
>TDEL0F03850
-MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKR
PHEYGQLTSWELQSCVWDYCFFNPNEFDGFDL---KD-SKGQHLIASETCMTLPELSKNM
DQVVFEEYEFDSLLKAPISGFMPF----SKHTENTKVISGKGDS----------------
-------ESGTSTSETKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFING
LLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLG
YVADRKN---PPSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPL
RPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA
-ST-DLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI