MUSCLE (3.8) multiple sequence alignment

CAGL0L12144g       -------------------------------------------MLNFSSSRNNEIQLL--
KLTH0G13838g       --MRATTCLATSVLALA---KFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLL--
Kwal_56.23589      --MLTKSWLATSFLVVA---KLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLL--
AGR095W            --MRLHMGLVAALAPLG---DVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVF--
Ecym_4315          --MYIHKYTLLVLSFVA---GLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIF--
KNAG0G02000        ----MWCSVVYCLWFAV---AITRASNLENVRRILNATEVTVPTFDVG-NKNNQFQIL--
TBLA0E04390        --MRICIRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTS
KLLA0F18975g       --MFSINPLIYVLLVLA---GMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYM--
TPHA0B03250        MSIISTIVRLVVLFSLA---NNATASSLSNILKLLNIQEFELPNLNFN-NTSNSIQLL--
Kpol_392.10        ---MLATIVRLISLGII---GVSQASQLTNVKDSLGINTVNIPQINFG-NTNNEIQIL--
SAKL0H17204g       --MTAFLKILTATYALC---QLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALL--
TDEL0F03830        -----MYGLLFLLFQSV---CLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLF--
ZYRO0C01804g       ----MLFFALLSFYFLL---AITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELL--
Suva_10.168        --MFVHRLWTLALPLLT---LGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQIL--
Skud_12.152        --MFVHRLWTLIFPFLA---QASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQIL--
YLR084C            --MFVHRLWTLAFPFLV---EISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQIL--
Smik_12.143        --MFVHRLWTLAFLFLA---QASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQIL--
KAFR0B02690        --MRTHHKLIKSLSLFT---TLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLL--
NDAI0B02380        ----MLFSWVFNFLLLI---HILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLL--
NCAS0B04980        ----MLIKILLGALLLI---PQIYASQLSSLQENLNITHINIPNLNLT-TDDNSFELL--
                                                                      .  .  :  

CAGL0L12144g       GSIETFNYYNYQGQQNFTTASSS--QNELELIYYSNNTLLRLDAVPTD---VEMRHIIPF
KLTH0G13838g       GNFKDINILKYSGQKNFTGEVSG--NPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPF
Kwal_56.23589      GNFQNLNYYRYTGQDNFTGISDE--KARESLIYHSNGTLLELSSPQYSNESFSVDHVIPL
AGR095W            DDFQAFEYYNYKGQQLFTGQEQ---HQGSSLIYYSEGTYVQLAKLDDD---TVVRRIVPF
Ecym_4315          DDFQTFDYYTYKGQQIFTGLAD---ERKNSLIYYSNNTYVQLAELPDG---AEIKKIVPW
KNAG0G02000        DDINGISFYEYLGQQNFTTDANV--TDVQRLIYYSNETFMSLSDSIAAE--AQIQGIIPL
TBLA0E04390        NGFDTLNFVHYNGQQNFTQPIIS--SSQNHLIYYSNDTYIRLLDIPYS---TRIQHIIPY
KLLA0F18975g       NNFEELTVISYTGQQNFTVQ-----ANESSLLYYSNDTFVKLFETSPE---TTVTMIVPL
TPHA0B03250        GDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSND---TDIQKIIPV
Kpol_392.10        SNIEGLTFYQYQGQQNFTGSIDTN-SNTHGLIYYSNDTLIKLLEGSDN---TKIDQIVPL
SAKL0H17204g       GDFEDLTFYRYTGQENFTGSIT---ETEKDLIYYSNGTFIKLDSLSDENATADINHIIPF
TDEL0F03830        GGFNALTFPQYEGQENFTGTINNN-TDSRGIVYYSNDTFIKLINGSSD---SYVEKIVPF
ZYRO0C01804g       GDFQDLTFYKYTGQENFTSPLNSS-TDSHGLIYYSNDTFLQLANGSND---TDIKQIVPL
Suva_10.168        GGVDALSFYEYTGQQNFTKEIGSE-TNSRGLVYYSNNTYILLEEADED---TRIDKITPF
Skud_12.152        GGVDALSLYEYTGQQNFTKEISPG-TNSRGLVYYSNNTYIQVEDASDD---TRIDKITPF
YLR084C            GGVDALSFYEYTGQQNFTKEIGPE-TSSHGLVYYSNNTYIQLEDASDD---TRIDKITPF
Smik_12.143        GGVDAISFYKYTGQQNFTKGISPG-TNSHGLVYYSNNTYIQLEDASDD---TRIDKITPF
KAFR0B02690        GSYDALSLYTYTGQQNFSYQITPD-TNSNGLVYYSNNTLIQLNQGLDD---TRINNIVPI
NDAI0B02380        GDIDGLSFYRYKGQQNFTTGIIPG-SNSNGLIYYSNNTLIQLEEPSND---TYIAKITPF
NCAS0B04980        GGIDSLSFYRYTGQQNFTSGILPN-SNSNGLTYYSNNTFIQLYEPSLD---SRIERIIPF
                   .. . :    * **. *:            : *:*: . : :           :  : * 

CAGL0L12144g       MDDCFILSGIGTI-SGIELSRQILLNLTQLSYQPIFEKEL-GMVKSIFVDNE--VVYFGG
KLTH0G13838g       KDDAFILSGAGSI-SGHQLSRQLLFNLSSLEFREIFGQDL-AQVNTITANGD--KVFFGG
Kwal_56.23589      RDDSFILSGTGAI-SGAVLDHQVVFNLSDLSYTAIFNQSL-SPVNAITVNGN--KAYFGG
AGR095W            GSDSFILSGTGKL-QDQRLEHQLMYNLSTLEVTEILPQSL-ESVNDILVDGD--MVYFGG
Ecym_4315          GDDSFILSGRGVF-EGHRLEHQLIYNLSSFEITEILKEPL-EHVNDILTDGE--VVYFGG
KNAG0G02000        GDDSFILSGQGMI-NNVSLASQLVFNMTDLSITKIFDTPL-RSIEGVTVDGP--LVYFMG
TBLA0E04390        GQDAFILSGTGSL-NGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGG
KLLA0F18975g       FEDSFILSGTGQI-NGVALEQQILLNLTSLTTSPIFPSAV-ENVMDILTVNE--TVIFVG
TPHA0B03250        GDDSFVLSGSGHL-NGYALGRQLLYNLTTLSIKPIFDQDL-GNITSILVDEE--IVYFGG
Kpol_392.10        DEDAFILSGSGTL-GGFQLENQLLYNLSDLSIIPLFNNQL-QNIKSILVDKD--IVYFGG
SAKL0H17204g       GDDSFILSGTGTLPGGHNLEQQLLYNLSSLEYTAIFNQSI-STVNDILADDE--IVYFGG
TDEL0F03830        GSESFILGGSGSL-LGYELGRQLLYNLSDLSLRPIFENSL-TDVRVILEDYP--VAYFGG
ZYRO0C01804g       GEDSFILSGSGHI-DGYNLQRQLHYNLTDLSFKPIFQEGL-TEVNSILVDQP--LVYFGG
Suva_10.168        GADSFILSGSGSI-NGVPLGNQVLYNLSTLSMARIFTQSL-GSVEAVLVNDT--SVYFGG
Skud_12.152        GADSFILSGSGTI-NNMPIGNQILYNLSTLSMAPIFDQPL-GSVESVLINGT--SVYFGG
YLR084C            GVDSFILSGSGTI-NNISVGNQILYNLSTLSMTPIFNQSL-GAVQAVLADNS--SIYFGG
Smik_12.143        GDDSFILSGSGTI-NNISVGNQILYNLSTLSMAPIFNQSL-GDVETVLVNDT--SVYFGG
KAFR0B02690        GSDSFILSGSGSL-NEYSLENQLFYNLSSLSVYPIFNTTL-EQVESILVDED--LVYFGG
NDAI0B02380        GSDSFILSGTGSL-SGYSLTNQLLYNLTTLSIEPIFNTSI-EEVKTILIDDS--LVYFGG
NCAS0B04980        GSDSFILSGKGSL-GGYSLSNQLLFNLSSFSLKQIFNQTL-DSVNSILVDGT--VVCFGG
                     :.*:*.* * :     :  *:  *:: :    ::   :   :  :          * *

CAGL0L12144g       DITYNNNGVS-GRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKLE
KLTH0G13838g       SFEYEMSNQT-IHSLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVD
Kwal_56.23589      SFKFKGPDQD-THGLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTID
AGR095W            QFTYSDGNKS-GHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLE
Ecym_4315          GFTYNDGNLS-GHSVVKWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTID
KNAG0G02000        NFTFNN-----NTGAIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVW
TBLA0E04390        NFSYLLPDSNISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLD
KLLA0F18975g       NFSMSVSNET-GHGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQ
TPHA0B03250        EFTYQTRSQN-SSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLG
Kpol_392.10        NFSYTSNNKT-ANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLD
SAKL0H17204g       EFQYTLGNST-GHSVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLD
TDEL0F03830        NFSFDNGSTV-GHSVATWNSSSNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLD
ZYRO0C01804g       NFTFSNGSQT-GHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELD
Suva_10.168        NFSYNNGSMT-GHGALVWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLD
Skud_12.152        NFSYNNGSMT-GHSALIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLD
YLR084C            NFSYNNGSMT-GYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLD
Smik_12.143        NFSYNNGSMI-GHSALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLD
KAFR0B02690        NFTFSNGTDD-GHSVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLD
NDAI0B02380        NFTVLNGTSN-IHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLD
NCAS0B04980        NFTLSTNSLN-GHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLD
                    :           .   *:          * *:*  : :*.:  *. ..::* * *  : 

CAGL0L12144g       NNSFVSKTNRTRNFSI--------SMEDSEVGQQISLRQATWNA-NSN--LDVDAFICP-
KLTH0G13838g       NTQQLNNINVSNTS----------NTSVPELGHQISLQSAAWVS-DGT--LDKSAIKCP-
Kwal_56.23589      EKSALNSTLGINST----------SDSAPELSHKIPLKTAKWTS-DGS--LQKDDLVCPS
AGR095W            AASYAETASVLASTEKPQL-----NVTTIETNALTSLRYSTITS-DGH--LDKGKFICP-
Ecym_4315          NTALLPHRNVSSSFLS--------NSTNIETNALASLRFSSLVH-DGT--LNSSAFVCP-
KNAG0G02000        NSSLLLQSNVSEESVR--------NTTSLLLNPSVPLQYSQWKT-NGE--LDSSQLICP-
TBLA0E04390        DPSILHIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICP-
KLLA0F18975g       NASLLQEFGNATNSSHE-------DLTSLQFDQSVPLKLSSI---TGE-NVQSDILLCP-
TPHA0B03250        NSSLLTYNTTSNFSNFTNSTE---NSSTIQLEQQISLKYATWDA-GTA-YFDQNNFVCE-
Kpol_392.10        DKSLLVSNITTYTQQNSTSSSS--TETNLELEQQISLKYASWAS-LGD-LKSSTQFICP-
SAKL0H17204g       DNTLLKQIRGSNSSK---------NATDIEFDQLIPLKHAGWSS-QGS--LEHSSLICP-
TDEL0F03830        DQTLLITNENTSKTN---------HSQSIEINELLPLRAATWNT-DSDSSFDSSAFICP-
ZYRO0C01804g       DVKLLENHILGSNNSSSKS-----NWTDVELGLAIPLQNANWTS-SSS-QFDADDFICP-
Suva_10.168        DSSILTTSSTNTTNASSTL-----NATTLELGQRIPLRYASWDS-QGSTTFESSYLVCP-
Skud_12.152        DSSALITAGSNNTTNSTSLL----NATKLELGQRIPLRYATWDF-QGSTTFESNSLVCP-
YLR084C            DPSALISSSNNGTNSTSSL-----NATTLELGQRIPLRYASWDS-QGSTTFASDSLVCP-
Smik_12.143        DSSVLITSSNNGTNSTFSL-----NATKLELGQRISLRYASWDS-QGSTTLASNSLVCP-
KAFR0B02690        DASLLTSNTSNATT----------NIYDLELSPLLPLNEATWSS-DVS-DFDASSFICV-
NDAI0B02380        EPDFLIQNTTSSQNNIF-------NSTTVDIGQLVPLSASTWDT--GESTFDSDTFVCP-
NCAS0B04980        NSTLLNVVNDTMR-----------NISDINLGQLIPLSAATWSS-TGS-FFDEETFVCP-
                                                      .*  .               : *  

CAGL0L12144g       NSDQQAWYSEGS-----YGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGIL
KLTH0G13838g       STESTGWLKTGS----TQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIM
Kwal_56.23589      NSATSAWLGTGT-----TGQFELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIM
AGR095W            TSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIM
Ecym_4315          EGSADSWTIPHS----TMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIM
KNAG0G02000        DPSKDSWSVSAT-----TGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIM
TBLA0E04390        TSEIEAWASDSK-----AGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIM
KLLA0F18975g       SGGQNGWSASEA----VQSTLQFDLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIM
TPHA0B03250        AGSSEAWIVEGR-----SGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIM
Kpol_392.10        NGQNEAWSSAGT-----TGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIM
SAKL0H17204g       SDDSDGWFQEGT----ATGDFTVSLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGIM
TDEL0F03830        NSQKEAWSVPST-----SGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIM
ZYRO0C01804g       DPERESWLQSGT-----SGSLACSLPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGIL
Suva_10.168        DTSKDAWLYPGT-----SGSLVCTLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIM
Skud_12.152        NANEDAWVYPAT-----SGTLVCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIM
YLR084C            NTNEDAWLYPDT-----SGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIM
Smik_12.143        NDNGNAWLYPAT-----SGSLVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIM
KAFR0B02690        NPDSDAWFVSGT-----TGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIM
NDAI0B02380        DTTEESWIQSGT-----TGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIM
NCAS0B04980        DPTIEAWFQNGT-----SGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIM
                        .*           . :   .       *:*:.*:      :  *.. .    .*:

CAGL0L12144g       NLTYLDPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEF
KLTH0G13838g       NLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SYPGDQVQYFENRTT-LQWSESFQDF
Kwal_56.23589      NLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSK-AASTDQVEFLNNQTT-VQWSESYQDF
AGR095W            NMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEF
Ecym_4315          NMTYVDPITGALAVCDAWCPLQPLSVLSNLAEN-STSSVMAAFPNNNNVLVKWTAAYQEF
KNAG0G02000        NLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEANTVAIINNNSTNIQWTPNYQEF
TBLA0E04390        SLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEF
KLLA0F18975g       NLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVG-INNNSTNLKWSESYQEF
TPHA0B03250        NLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEF
Kpol_392.10        NLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSAFINGNKTNIGWSTDYQEF
SAKL0H17204g       NLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQEF
TDEL0F03830        NLTYVDPLSGELLNCDAFCPLMLQDSLKAAVAN--GNTSQVVRLDNNLTDIQWSYDYQDF
ZYRO0C01804g       NLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNNTTDIKWGRDFQEF
Suva_10.168        NLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDF
Skud_12.152        NLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDF
YLR084C            NLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDF
Smik_12.143        NLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDF
KAFR0B02690        NMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDA-ASVSEMARLLSDNATVIKWSAEYQEF
NDAI0B02380        NLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEF
NCAS0B04980        NLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEF
                   .::*:**    :  *   ***     *                  .    : *   :*:*

CAGL0L12144g       AFVNQLPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDI-----A
KLTH0G13838g       AFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQ-GSA-----T
Kwal_56.23589      AFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPDCSS-TSN-----Y
AGR095W            AFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGE-QQL------
Ecym_4315          AFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDS-QQN-----F
KNAG0G02000        ALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSFNTPNCNN-NDKDSNNTF
TBLA0E04390        AFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCND-QTA-----Y
KLLA0F18975g       AFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYNEPNCES-VTE-----Y
TPHA0B03250        AFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTESTSL----F
Kpol_392.10        AFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNSLNEPACDS-PNTV----I
SAKL0H17204g       AFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPNCDN-INS-----Y
TDEL0F03830        AFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCES-NDI-----A
ZYRO0C01804g       AFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPACGK-MQS-----Y
Suva_10.168        AFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYGCSA-LAND----S
Skud_12.152        AFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEYGCSA-LAND----S
YLR084C            AFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSA-LTND----S
Smik_12.143        AFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYGCSA-LVND----S
KAFR0B02690        GFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTS-NNSD----Y
NDAI0B02380        AFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCNS-IES-----S
NCAS0B04980        AFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNS-LES-----F
                   .: . .    : . *  *:    .: . .:::     : *.: *   *            

CAGL0L12144g       ----------------SYVKLS-GNGWFTVANDNSYLANSYIPNQG-TKPSITYFVGINV
KLTH0G13838g       ----------------SNALLSNSSAWDSGSSEGNYLSTSVQDSE--TNPFVIFYPSIIY
Kwal_56.23589      ----------------SKASLS-ASQWDQGSSDEDYVYTLVENSQ--EAPSVTFYPQIVY
AGR095W            ----------------SPFSTT-ANIWHQGATDASYLSANVVESN----PMVNVKPVIPH
Ecym_4315          ----------------PASVVSKDTVWYQGLPDQSYMATSFTAGK----PSVTLTPSIPY
KNAG0G02000        ----------------TSSSLS-PNNWT---SVGEYLTVGYTPNEN-PVPKVTYKIDIQH
TBLA0E04390        DNEDLIKAALPRVMGSSYSILS-DNDWYTPLPNSDYLACTYLSSSK-LIPTVTFYPNLLY
KLLA0F18975g       ----------------SKAELS-SDNWYTTDESDTYISTNIDD----NIPYVTFHPNITY
TPHA0B03250        ----------------SSSVLS-DNGWYKGLDSDSYIAANYQSDSS-PLPTVQFYPNIQA
Kpol_392.10        ----------------PSSYLS-NNIWYQGLNSQSYIATKYTPGDD-PSPLVNFYPSINR
SAKL0H17204g       ----------------SHAVTSSKQQWTQGSMDSSYILSTY-DGTG-DLPSVNFYPNITY
TDEL0F03830        ----------------STSALS-DSEWQQGLFGQSYLVADFRTGQE-TLPKVTFYPAINY
ZYRO0C01804g       ----------------SNATIS-NNDWRQGLNGQTYLSTSYVEDQG-NIPRVTFHPQIQY
Suva_10.168        ----------------SSSILS-DNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIH
Skud_12.152        ----------------SSSTLS-SNSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVH
YLR084C            ----------------SSSTLS-SNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIH
Smik_12.143        ----------------SSSILS-NNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPNIIH
KAFR0B02690        ----------------TSSTLS-DNDWVFGASGQTYVTTFYTEGDD-PIPQVTFNANLPY
NDAI0B02380        ----------------SSSSLS-ANDWEMGLTGQTYISTTYTPNQD-PVPYVSFSPQIKY
NCAS0B04980        ----------------SSSDLS-NNTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKY
                                   .    :    *        *:            * :     :  

CAGL0L12144g       PGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVL
KLTH0G13838g       PGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFL
Kwal_56.23589      SGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYL
AGR095W            SGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQNNYRLKYDPLYTGHL
Ecym_4315          PGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLM-NRWIYQNNENLKYDPLFRGYL
KNAG0G02000        SGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQL
TBLA0E04390        AGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYL
KLLA0F18975g       PGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSL
TPHA0B03250        VGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKL
Kpol_392.10        IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL
SAKL0H17204g       AGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYL
TDEL0F03830        AGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHL
ZYRO0C01804g       PGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHL
Suva_10.168        PGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYL
Skud_12.152        PGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYL
YLR084C            PGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYL
Smik_12.143        SGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYL
KAFR0B02690        SGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYL
NDAI0B02380        PGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYL
NCAS0B04980        SGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYL
                    * : ..  ****  * :*  *.::* :         : .  :::.*   *:* :: * *

CAGL0L12144g       NNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISSEFISDQIDGDRS---LHLNGIFE
KLTH0G13838g       DSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTS-------GFINGLLH
Kwal_56.23589      ENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKT------GKLNGLLH
AGR095W            DPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPRE------KSLNGLFQ
Ecym_4315          DDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNS-----NLLNGLFQ
KNAG0G02000        NSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSK-------LALNGLFQ
TBLA0E04390        DPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSSNEIDIYN--VTLNGLFQ
KLLA0F18975g       GSAPEIIVTWDKAI--GESDSVMVVDRLGVITEYIDTISISSNDTT------FHLNGLFQ
TPHA0B03250        TVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTS--LKLNGLFQ
Kpol_392.10        DYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQ
SAKL0H17204g       ESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTIN------ETLNGLFQ
TDEL0F03830        ETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDET-------IPLNGMFQ
ZYRO0C01804g       KSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKD--------ITLNGIFQ
Suva_10.168        DFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH--TPLNGILQ
Skud_12.152        DFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEY--IPLNGVLQ
YLR084C            DFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE--TLLNGILQ
Smik_12.143        DFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ--TPLNGIFQ
KAFR0B02690        KNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGST---VALNGLFQ
NDAI0B02380        SSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEI--MNLNGLLQ
NCAS0B04980        NYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNS-----LELNGLFQ
                        : : :   :        :*..        ..                  :**:: 

CAGL0L12144g       YSPSNFTFDNGYLT-GKIDYTILDDFGVSNFNKGASIFAVDQNQ-NLYLGS-TNGSVYEL
KLTH0G13838g       YSTSNTSSFLSELG--SYSATDLAHYSVSKLPKHSNIFANMFED-DLVLFT-TDGEMARL
Kwal_56.23589      YSLSNSSSYLQNFK--SNNSTDLAQYSVSNFAKNSNFFVDKFKN-YIMLFA-SSGKVSKL
AGR095W            YTPAGSSLDNGIQK-------YINKDPQTDMPEGVSLVGQVYDG-KLILGVKSTGHIAVV
Ecym_4315          YAASNFTNTNLSTL---VGSTNIDQYPVRNIPHSSSLFGQIYND-TLFIGSPSIDGLAKI
KNAG0G02000        YQISNFTNDSIPM---KIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSG-TEGNMFSI
TBLA0E04390        YPEYNSVNNLNE----NYTNSTINQYAYSNYPANVSLIAAAYDKDTLLVGG-SINKLQEF
KLLA0F18975g       YNTANVTASIFST------NDTFNDYALYNFPLDANLYAASLNN-DILIGG-NFNGIAKV
TPHA0B03250        YQLSNFTSDTKT----KVGNNSIHQLALSQFPSSVSLIGNTFNN-SIFLAG-STSNIVQL
Kpol_392.10        YQLSNFTSSNNNST-LKVDNTSLNLFPVSRFSSSVSLYGVEYNE-TLLLGG-SIAGVYAL
SAKL0H17204g       YQISNFTTISNDSL--KIGNTTINRYSIENVPSNSELFAGYYNN-TLLVDG-AFNGIAVL
TDEL0F03830        YQLSNFTNSTDSKP--SIANTTLNSYTVQNFPKNASLFSSMYNN-TLWVGG-SVSGVAAV
ZYRO0C01804g       YQISNFTKNITKE---SIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLAD-SKSKAAEI
Suva_10.168        YQRSNFTATTSNGT--KIANTTLNLFSVDNYPKNSSMFADVYDK-KLILGG-KDNHISVI
Skud_12.152        YQKSNFTSTTSNET--KIGNTTLNVFAVDNYPNNSSLFADTNGD-RLILGG-TNNHISII
YLR084C            YQKSNFTSTRLNET--KVGNTTLNLFPVKNYPKNSSLYADIYDN-KLVIGG-VSNRISIV
Smik_12.143        YQKSNFTGTTSNKT--KVGNTTLNLFPVNNYPKNASLLVEIYND-KLIVGG-VSNRISTI
KAFR0B02690        YQLSNFSSTFNSSS-AKVGKTFLNQYPLDIFNTNSSLFASTYDN-YLLVGG-AEQSVYAL
NDAI0B02380        YQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGN-SNGGIKVV
NCAS0B04980        YQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYND-TLLVGA-GDDGLSIY
                   *   .                 :            .:         : :           

CAGL0L12144g       NSLNG-SS--VPSTEN-NLSGLINGMYSVEEGLVIFGSIAHRG-REYGAVILNK-SITPL
KLTH0G13838g       KLANN-LS--IEEYTFETIGKDISTISEYSGGLIIVGTFNGSS--EPAARGFNG-TFFNL
Kwal_56.23589      EIDQQ-FD--VRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGST---KGAKFYNG-SFFDI
AGR095W            TPKGTDWN--DVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSS-GPSSALHYDG-NFGSF
Ecym_4315          SRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTN--MASSLSFNG-SISTI
KNAG0G02000        NLNTD-LS--VQNSTRLISTENFTTFQPYSNGLVMLD-------GQGNVSLFKD-NFKNL
TBLA0E04390        QIEKNGQN--ISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSS-GSYKAITFTNNKFGTL
KLLA0F18975g       ELNDE-AL--ISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSF
TPHA0B03250        QLNSD-LE--LRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNG-TFSSF
Kpol_392.10        SLSNY-TN--IRSTRIVETGGEVTGTGAYAGGVVLFGNFNISN-RIVSSLSYNG-TFDSF
SAKL0H17204g       QLNDD-LN--IISEQRMGTGGPTEGINTYSNGLLFLGDFNLSS-QQISTLSYNG-TFSSF
TDEL0F03830        ELDED-LH--VSSTAKYATGGTVEGISSYSDGIILFGTFNLSS-QPVSTLTFNG-VFGSF
ZYRO0C01804g       KLDKN-WS--VDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQ-RQPLALSFNG-SFNSY
Suva_10.168        DFNDN-LE--VTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSD-NKSTVLMFNG-SFESV
Skud_12.152        GLNDN-LE--VVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSN-NQSSVLLFNG-SFENV
YLR084C            DLNDD-FE--VTSSKNQTIQGDVHGITKTNQGLLIFGDILSSN-NQSAVFLFNG-SFENV
Smik_12.143        DLNEN-FE--IKSSENRTIQGDVYGITKTGQGLLIYGDLRSSD-NQSTVLLFNE-SFGKV
KAFR0B02690        ESSND-LN--FSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSG-VTEGAVTYNG-SFNPF
NDAI0B02380        KLNEN-MD--IESSNEASLTGNTAGFSSYSGGILAYGEYNLSS-KITYLVNYNG-TFNEI
NCAS0B04980        ELNKD-LA--IQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSK-ESSNVLSFNG-SFDSI
                                                  *:                       :   

CAGL0L12144g       DIVA-NDSIQASFNSTLFGS-NLLVFDNSTIFNMTSFMVFE-NTSYRNLDLRNAGKNSND
KLTH0G13838g       TEF--NSTVRTFSNLTLGQT-EMLIFDKNIILNGTTGEKIY-DTSKLTLEVASAGRNPYN
Kwal_56.23589      PLS--HSNVTTFTNFTLDGA-ELVSLGNYYAINTTTDTLFR-NSSKMTLTARSAGLNNLG
AGR095W            FDL--NSETSSIINMTIDGS-ELLLFNNKFIYNTSTSQMLT--SSMFQLSALSAAANSNN
Ecym_4315          FRS--NAPSLSILNLTIDGS-EILVFDNGYVYNVSSQSDIS-NSETLKLSLLSAGANLED
KNAG0G02000        NTTMDGSLATDVANITLNGD-ELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSIN
TBLA0E04390        GNF--TDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFK-NTSTFELSLWSAGKNAQN
KLLA0F18975g       GQL--DEPIDRIVNFTIDGH-ELLLFDNAYIFNVSANMYVS-NSSTFEITGQSAGINSGN
TPHA0B03250        SQL--GDNVTTFANFTYEGS-ELLFFNNDYLYNVSSESYIY-NNTMFTASVLATGANSNN
Kpol_392.10        GNV--NSNIATFSNLTFGES-EILAFNNEYFFNTSTSSYIF-NTSALSLSIWSAGSNDFG
SAKL0H17204g       GNL--RTNITRFNNITIDDS-ELLVFNNRYIFNVSSNEYIR-NTSSFALSLWSAGSNSKE
TDEL0F03830        GNL--ETTLRTYTNVSFQQD-ELLVFNNEYVFNLSSNSYIS-NSSTFGLSLWSAGRNQFD
ZYRO0C01804g       DKI--NRSVERFTNIDLKGT-ELLVFDNEFFYNVSSQSYVS-NTTRFSLSVWSAGQNTNG
Suva_10.168        SNY--SKAVENAINITLANN-DLIVFNNDYIFNASSNSQIS-NSTSFSLSLWSAGNNDND
Skud_12.152        FNY--SRTVNSAINISLANN-DLIVFDNDYIVNTSSSAQIL-NSTSFSLSLWSAGSNGND
YLR084C            FNQ--SRTVNSALNISLANN-DFIVLDNDYVVNASSNALIR-NSSSFSLSLWAAGNNGDG
Smik_12.143        PNY--SKRVNSATNISIADN-ELFVFDNNYIINASSNAQIS-NSTSFSLSLWAAGNNGNG
KAFR0B02690        TQYG-NSSIDTFKNVTFGNS-EILVFNNAYLYNVSSSTLMS-NSSSLSLSLWSAGANANG
NDAI0B02380        PNFNKNSSITNVVNLTIHDT-ELLVIDNQAIYNVSSSSTIT-NSSALQLSLWSSGSNLNR
NCAS0B04980        GNI--TSPITNFANITIDDS-ELLVFDNNLIFNVSSSSQIS-NTSSFSLSLWSSGSNSNG
                                *       ::. :.:    * :        .         :. *   

CAGL0L12144g       DMLLVGNIVNKGSAIGNESLLISSN-GTYSPF--S-LSDNDTIEGAIYLNDTKALYSL--
KLTH0G13838g       DTLFQGYVLQNDYTNLNGSFFISTN-SEEVSQNFW-ALGGKLPYDAAFVDNSTTAYAY--
Kwal_56.23589      ETVFYGSLTRNEYTDLNGSFFISSN-SQSSSR-LR-GSQGRIWYDATYIDNSTTGYAF--
AGR095W            DLLFTGSIADIKHGSAHGAVALDAE-GNIFTSGTP-SISGARVHRGVYLNDTATAYAYYS
Ecym_4315          DLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLP-SVDDGIIYRGLFINDSSSAYAY--
KNAG0G02000        DTIFLGKVVQWQYAIANQSAQVNAD-FNDGIEQMS-LPSNTVPSRGIFLNDDSTGYFY--
TBLA0E04390        DLIFSGLVSENENVNLTGVVSINAN-EQIKEL--N-LGNNIYPYSAVFLNDSSTIYAY--
KLLA0F18975g       DSLLFGSFLKRSVGELNGLASLSSD-GQVSSPTLPELPTDVQPYKAAYINDTSAAYAL--
TPHA0B03250        DTLLLGNIVRSEYSNFNEPLKLYGN-SSLESL--T-FSSSIVPYAAVFLNDTANLYAY--
Kpol_392.10        DTLFSGLITRNEFPNLNNSAVLTGN-GTAQSL--Q-LRNGIQPYLGVYLNDSLTAYLY--
SAKL0H17204g       DGILVGAVSQRQYTELNGAVYINDA-NSISTIGLP-SFDGKRVYTATYINDSSTAYAYSS
TDEL0F03830        DTLFSGAVTKNQFPGLYGSASIYSN-SSVAHF--S-LQNGAQPYAACHLNDSVTAYAY--
ZYRO0C01804g       DLIFSGAVSDNDYENLQGPVSLFQN-GSAVSS--N-IKDNINPYMGAYLNDTLTAYAY--
Suva_10.168        DVLFSGAVSQMQFSDLSGSARFLNE-STVEAL--N-LNKGIVPYLGAYLNESTIAYAY--
Skud_12.152        DVLFSGAVSRMQFGGLNGSARFLSE-DKVQAL--N-LDNAVVPYLAAYLNESTTAYAY--
YLR084C            DVLFSGAVSHMQYGNLNGSVRFLNE-NEIEPL--N-LEGGIVPYLGAYLNESATAYAY--
Smik_12.143        DVLFSGTVSHMEFSNLNGSASFKNE-DQVQAL--N-IGRGIVPYFGAYLNESVSAYAY--
KAFR0B02690        DLLFNGASSQMSYSFNNESINIGAN-NIVQGL--N-FNESIDPYLGLYMNTSHGAYFY--
NDAI0B02380        DTVFSGAIALLDYTDLNGSIAIGNN-FTVTNITNN-VSSTNSLYTGLFLNDSLSIYAS--
NCAS0B04980        DTLFSGALSQVQFTNLSGSVSIANN-LSATS-----LRSIGSPYAAIFLNDSVTGYVL--
                   : :: *               .                       . .::     *    

CAGL0L12144g       SSGNV-----NYFQLSDKQRL---PWTWQS---TVVPVFYSNGQQLL--GAIQENSNKS-
KLTH0G13838g       YNPDNTSNSFGVSVMNDSGSTVQLSA-WSG---KVGAMASSKNDSLLAIG-GKDQHTDS-
Kwal_56.23589      YDPSSTNGSYGVSIYKDMAKERDLSYRWTN---MVGSMLYSKNSSLLALG-MKNETRSP-
AGR095W            VSPNSSVATGGVVIETPGN-----NFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPG-
Ecym_4315          YSKSLGSSKGGIVVYG-EHEP---EY-LSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLA-
KNAG0G02000        KESNK-S---KLYITNSNSTS---GLEWYG---EPETVVYDKNDTLLMVGYYNDNTFSS-
TBLA0E04390        MEPNTRLN--RLIHSN-GEQI---SWSWKN---KISSMAFFPNESLLSVGTISDKDVFP-
KLLA0F18975g       QEGSTDNVQHRVLITNTNSSSHMLQIQWSA---PINAFLYDNVPNILAIGTNGSNSSSQY
TPHA0B03250        KDGEN-S---KIIYGN-NMTT---SLDFSG---TLNKLSFSNNSSLLFAN-AITNNGSS-
Kpol_392.10        DSSSN-S---NILFSN-GLQG---NWNLPR---SVSSAYYSDNETMFVGSSLSNGDSGA-
SAKL0H17204g       KNDST-H---HVLIAR-GNRSEDLPVSWSH---AVNTMIYNKDDSLLAVGTNAGDTNGT-
TDEL0F03830        RYGSV-S---QLYFDN-GKEG---PWTWFG---TINSMRYSKNSTILAIG-TDGSTDEP-
ZYRO0C01804g       KDGSD-S---RIVFSN-GDEG---PWRWTN---SIETMIYRNRDALLALG-TSSSPSLP-
Suva_10.168        KTNSL-S---KIYFSN-NVSP---SWNWSN---NITKMVYANNQTLLVIG--SESSTTA-
Skud_12.152        ETNLL-N---KIYFSN-NVDP---SWNWST---SITRMLYANNQSLLTVG--SESSTTA-
YLR084C            EVDSL-N---KIYFSN-EVYP---SWNWSS---GITQMLYADNQTLLAVS--AGSSTTA-
Smik_12.143        ETDAL-N---KIYFSN-KVNP---SWNWSN---TITRMLYANNQTMLVVS--SESSSTA-
KAFR0B02690        QDDDN-T---RVYFTN-GSQP---SWQWPN---DVVAAIYSDNQSLLIAGTSSSLESSS-
NDAI0B02380        KTDSY-S---ELLFSN-GYSA---PWSFFE---GINYMVYSSHQTMLAVA-SSDFNKNS-
NCAS0B04980        KNDSSTS---EMIFSD-GSKA---PWRWTG---YVDSMLYLTNQSMLAVGSSSSVNG---
                                                                ::             

CAGL0L12144g       --QIVLIDLFSSQVINDTGNLT-MHKINAIVNFASNATALVGGDFSL--SNPACVGLCLY
KLTH0G13838g       --QLLVTNSSSGESLASYKWDS-EISLNSIIFFARNNSVLVGGSFRV--NNTQCSGLCLF
Kwal_56.23589      --QLLLTNLTTGEDTATFEWKT-NVSINSLIFFDQNTSVLVGGDFNE--SESNCSGLCLF
AGR095W            --ALILYDLRTLQEVAREKLNP-GERINSIVLFGEDNTLLVGGSF----EKDGCHDLCLY
Ecym_4315          --SLYIHDLSADFAPIKETFEI-GEVINTMVLFGRNYTLLVGGTF----TRNGCRDLCLY
KNAG0G02000        --TLSLTNLTSFDVIKEENLNV-GSSISSLLYFAKNDTLLVAGDFEP--SNGNCSDLCLY
TBLA0E04390        --SFSILNLTSNKVIANETLNK-NSQISSLLYFTKNSSVLVGGNFTF--SDYQCSGLCLF
KLLA0F18975g       DVQFSILNLTGYENVARVNFST-NERVNSMVSFSSNNSILVGGSYEI----DNCNDLCLY
TPHA0B03250        --SLVISNISDGMSLASENLNN-YGYITSMIDFNSNNTILVSGNFTL--DDVDCHGICLY
Kpol_392.10        --ELFVLNFTTMDLLYNETFDV-NSSINSIVSFGRNSSLLVGGDFTA--PNTNCSNLCLL
SAKL0H17204g       --SLSLFNISNSKMIGEENLGA-KSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLY
TDEL0F03830        --ILSLFNLTSFDVLANTTISE-NGTISSMVFFDRNSSLLVGGDYHI--SDADCSGLCLY
ZYRO0C01804g       --QLSVLNLTTSEVLANETLDK-GAEVNSMILFGKNSTLLIGGNFSF--SDAHCNGLCLY
Suva_10.168        --ELSILNLRNFTTIANETLGS-NAKINAFVNFEKNSSLLVGGDFQM--SKPNCTGLCVY
Skud_12.152        --ELSIFNLKNFTMIANETMGS-NAKINALVNFEKNSSLLVGGNFQM--SKPNCSGLCLY
YLR084C            --ELSIFDLRNLTMIANETLGS-NARINALVNFEKNCSMLVGGDFQM--TEPNCTGLCLY
Smik_12.143        --DLTIFNLRNMTTIANETLGS-NAKVSALVNFEKNSSILVGGDFQI--TKPNCSGLCLY
KAFR0B02690        --FLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGNFSM--PNVNCFGLCLF
NDAI0B02380        --ELSILNLTTFETIANETLNV-NSKINGLINFEHNSTLIVGGNFTI--LQSNCSGLCLY
NCAS0B04980        --ELSILNLDSFKVLANETLNQ-NSSVKTMVHFERNSSILVGGNFSI--SNTECFGLCLY
                      : : :                  :. :: *  : : ::.* :        * .:*: 

CAGL0L12144g       NYNNSNWSSFLNNSITGNISQIKF-N-DTQMLLSGKLEVNKTADINLLSINLTSNKQDIL
KLTH0G13838g       NYQDKKWSPFLNNSIRGVINRMEIFN-NSNLLIAGSFRLNETDGVSLASICLKDSSSEIL
Kwal_56.23589      DYERKHWSPFFDNMINGSIHSMKIFN-KSSLVLGGFFDINDTKQVNLASMSLTDGSYNIL
AGR095W            NFVKRSWSAFASGLISGEIKQLQFVN-NRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQ
Ecym_4315          NYATNNWTRFMDGNITGDIRQLQFLD-GNTLMVAGLLASSDSKDLQLVEIDLSNMEIISK
KNAG0G02000        NYKSGQWDSLANNSVSGSVAALQLYQ-NDTILVLGNLTLPQANDVNMAFVNLSNNHVGSL
TBLA0E04390        NYETKNWSTFMNNTLEGTVSKLELKN-NSNILISGTLSTNKSANIDLALLNLNTYNVSIL
KLLA0F18975g       NYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTV
TPHA0B03250        NYFTKKWSAFANSTIKGSIVEMQLWN-SDQILISGLFSAQNYSSITLASLDIKGYNISVL
Kpol_392.10        NLGNNQWSSFSNK-FDGTITGLEFAN-DSRLLISGSYRFENQSGISLGYIDLNNQEFKSL
SAKL0H17204g       NYNASKWSNFYNNSISGNITDLQFFN-GTQLLISGNLYTENETGINLAKLNMASNEVTIL
TDEL0F03830        NYDQKQWTKFANNSITGNITEMQLSE-SYDLLISGAMNVANKTSVNLLSFNMSNYEVNPL
ZYRO0C01804g       NYKNKRWSTFANDSITGQVTQVQLRN-SSELLIAGSLRVNGTSDVNLVSVNITGQGMKTL
Suva_10.168        NYESKSWSTFFNNTIVGEITQLAFNN-ESELIISGLFATEKQQSIRLGSFNLTNSTMVPL
Skud_12.152        NYESKSWSTFFNNTFFGEITQLSFSA-ASQLVISGLFDTEEYQSVRLASFNLTNSTMIPL
YLR084C            NYESKTWSTFLNNTIFGEITQLSFTN-SSELIISGLFETKEYQSIRLGSFNLTNSTMIPL
Smik_12.143        NYETKSWSTFFNNTIFGEVTQLSLAN-SSELIISGLFNTREHQSIRLGSFNLNNFTMVPL
KAFR0B02690        NYGNSTWSSFADASINGTVDHMQLFN-ESELIVSGLFSTKNISSITMASLNLKNNKITAL
NDAI0B02380        NYDSNEWLTFANHSINGTIAQMELIN-GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSI
NCAS0B04980        NYTGNQWYTFLNGTINGTITKLQIFN-DSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLI
                   :     *  : .  . * :  : :      ::  *         : :  . :        

CAGL0L12144g       LYNNS--VVLDDFILVRNL---VVGWNSTDIFIRNVTQWSNLNIFDDGTN-----ATINR
KLTH0G13838g       HEGNI---TLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFTENSK----FKGLD
Kwal_56.23589      HQGTE---TILDFIFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSV----FGGLS
AGR095W            HEQPN-GRAFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIR----IDGIS
Ecym_4315          LQGTN-TGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQ------TQING
KNAG0G02000        IMKKDAPVNLHSMIVSNSR---IVAWNDTVLFSFDGNSWTRVSVPGTDSSA----TSISS
TBLA0E04390        LQNTN----LTSFEFTGNQ---IAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFD
KLLA0F18975g       KSGTE---PLLSFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNND------SIVSG
TPHA0B03250        SDDSK--IEISSFIHDGQS---ITVWSNDTIMEYKSEKWNEISFPNTTS------KYIES
Kpol_392.10        LSDSQ---KVNSFNYNNGT---IVAWDSSTIYSYRGDSWSNHQIPNTNSS-----TSIKN
SAKL0H17204g       RHGST---MVQSFVTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSL----YMGAQ
TDEL0F03830        VWDSN--GPIKSFIAEDND---IITWNETSLSGYSDGDWQNLEFDNSSL------ISIVD
ZYRO0C01804g       LRGWE--GPLRSFVVSEDR---LVVWNDTSLMAYDNTSWRHISTSNSTSF-----TKLQD
Suva_10.168        LTGSG--GKLNSFTVTEES---IVAWNDTSLLIYKDQKWNTTSLPGNGSSV----SSVTT
Skud_12.152        LTGAE--GKINSFVVTEES---IVAWNDTSLLIYRDQEWNITSVPGNDSSI----GSVST
YLR084C            LSGSE--GKLNSFTVTEDS---IVAWNDTSLFIYRNQEWNITSLPGNASSI----SSVSA
Smik_12.143        LSGSE--GKLNSFVVTDNS---LVAWNDTSLFIYGNQKWNITSLPSDDSLI----GSVST
KAFR0B02690        KSGES--NTFKSFTVADQK---IVAWNNTALSIYEDNVWTVERISNINSS-----SVVDN
NDAI0B02380        KMGDA--NILQSFATIGDK---IITWNGIMLESYENGAWSTIQSNFNSS------TTIRS
NCAS0B04980        RWGFK--EPVKDFITIDDN---IFAWNETSLFEYTSNSWVDIPISNSNSS-----TTIDS
                            .  .                 :       *                     

CAGL0L12144g       IENFGADSN-----------------PALIIYGQFDSMKYGTINAVIYD--FNSWYPYF-
KLTH0G13838g       VFPLKDTTR----KQKRDSSSK-----VLLITGSLQHAKFGSINAAFYD--SGEWTPFL-
Kwal_56.23589      EFPIQQGGQ----NKKREEEKNS-----LLITGDLLHKTYGKISAALYD--FNDWIPYF-
AGR095W            LLMLNNPRS----QNKRNRVGNE----LVVIHGQMNSSEYGEINAMHYN--FENWEPYYF
Ecym_4315          LTLLSTDFSQRNSIMKRDRVGNE----LVVINGNFSSPDYGDINAMYYD--FNGWNPYYF
KNAG0G02000        VQFISMEGT--------------DD--ALLLLGEFRHSEFGDIKSIVYN--FRDWIPYL-
TBLA0E04390        ITNKNSSSI----LEKRALRDTN----IMVATGQFYSKGLGTVQALYYT--SDTWIPYF-
KLLA0F18975g       FKVLSGTES-----KKRDEGSH-----IVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYF-
TPHA0B03250        VEAVS--------IDLQNSTSNVSK--ILFAYGEFNSTLYGRLNAMLFR--AGDWKPYF-
Kpol_392.10        VQIVSKLNN---SLSTNNTSNNLND-ELILVFGELYSEDYGFVQAMFYD--FQNWIPYY-
SAKL0H17204g       LIPLKQTSS------KRDVSNR-----ALLVNGDLKHSTYGSVSAMLYD--FEDWMPYF-
TDEL0F03830        VIAVKTEPA----LDKRQTFSSTFD--AILVAGQNYA---EYPQASIYN--FQRWLPYY-
ZYRO0C01804g       IHQVSLEHS----LEKRANSSSNSNLDGLLVYGNDKTQG-DSYQASIYD--YYSWTPLF-
Suva_10.168        IDTNTDSYA----LRKRATTDAEKG-SILLLNGNFSIPQYGNLQGLLFD--SQNWTPYF-
Skud_12.152        INTNAGPGT----LNRRATNNAENG-TILLLSGNFSIPDYGNLQGLLFD--FETWSPYF-
YLR084C            IYTDIESNT----LNKRGINNVNNG-SILLLNGNFNISQYGYLQSLLFD--FQKWTPYF-
Smik_12.143        ISTNTKSDT----LNKRATNNAHDG-SILLLNGNFTMPQYGNLQSLLFD--FQAWTPYF-
KAFR0B02690        LNYVTLASA----LSKRDTSSSD----AILVSGQLYDNSYGHIQAMVYD--FSSWVPYL-
NDAI0B02380        IEPIGFGPT----LQKRDGTGSADG---FIINGNIYDTEYGTIQAMIYN--FKEWRPYY-
NCAS0B04980        IGWTTTTDN---NLKKRDNSETSNN--VLIVKGQIYDNVYGHIQAMIYN--FEEWIPYL-
                                               ..  *           .  :      * *   

CAGL0L12144g       ----EVDVVSQTATPLFFADRDQSSYGNTRHVVP----------DHI---------IVSS
KLTH0G13838g       -SSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQ----------GTFSS------NTSSG
Kwal_56.23589      -STTPATSTDGLGQSRIYSNKDISSAFNYQGVLQ----------SSRGG------NSSSV
AGR095W            TIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE---------------------VVVSD
Ecym_4315          SVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLS----------NDN---------DNDD
KNAG0G02000        -LYVDG---PRQGTGHLFMNRDISLHNIAQIPLL----------NSTRVLTNQSFASSTS
TBLA0E04390        -YGNLTNNMDTSNSINIFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTN-TTSTT
KLLA0F18975g       -VISDPKEQESLPSSSFFQNVNDLYLSSSQTVLQ----------SNN------S-DTSAS
TPHA0B03250        --SINNFQVNEDPAITLFENRDLSSLFNSKNSLP----------ANI----TSA-ETSSR
Kpol_392.10        --ITQPYSSLNTSKNSLFMNKDISLLYESQVVLQ----------NPNSTISISS-TSSSS
SAKL0H17204g       --IVDG--ENAGRASNIFMNKDLSSLYTTQTILQ----------GSN----------TST
TDEL0F03830        --VANKADDEDPSRTTFFTNQDDSQLYDSQNLLS----------DPT----RTT-TSSSS
ZYRO0C01804g       --IANSKSENSNSGPNIFMNQDVSDFFISEQMLP----------NPT----NHT-SSRSS
Suva_10.168        --TSET-LEASSYNPTIFINRDVSADFNSQIPLS----------NSN-MTVTSP-QSTSP
Skud_12.152        --VSES-SNTSNRNPTIFINRDVSTEFNSQIPLS----------NLN-VTETGP-QSASS
YLR084C            --ISET-TNTSNYNPIIFINRDVSTEFNSQSPLA----------NVN-ITVTSP-QSTSS
Smik_12.143        --ISEI-SNSSNYNPTFFINRDVSTEFNSQITLP----------NLN-ITVTNP-QSTSS
KAFR0B02690        --LINSESDSSINA---FIDRDMSSFTNTQVALL----------TNSGTVSNSS-SSTTS
NDAI0B02380        --IISS--TNSQIAGQIFMNRDDSALYNSQSVLQ----------NPNNATVTTP-SSTSS
NCAS0B04980        --SINSLVSSANQPAELFIDRDVSKLFDSQLALQ----------VSN-----TT-ASITA
                                    : : :          :                           

CAGL0L12144g       SHSSSAPSSSSS---------HKTNEKPYKIRRGFVVLIGLALALATLIVLGITGVVIAL
KLTH0G13838g       TSGTPSPSGSSP---------SNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSY
Kwal_56.23589      PSGTSSPTSSSP---------SQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTF
AGR095W            SPPTAEP--------------------KRKLAKGYVVLIALGLALATIALLGIIGVILAY
Ecym_4315          TPAASEPATHEK---------H-----TKKLAKIFVVLIALALALATVAVLGVVGVLFAY
KNAG0G02000        SSVSSTSTTLPKVST------THSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAY
TBLA0E04390        NLTSPSNTTSPQPSSSIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSF
KLLA0F18975g       STPTPSTTSSSH---------STK---DKKIDRGFIVLIGLALALATVAVIGLIGALICY
TPHA0B03250        STVSSATATTVV---------NKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAY
Kpol_392.10        ATTRSSSTSSTS---------LKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAY
SAKL0H17204g       STTSSNMPSETS---------DKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAY
TDEL0F03830        STTSSSQTSPSK---------GSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLAL
ZYRO0C01804g       SSSSSAVTSNSG---------DKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAY
Suva_10.168        LSPSSSASSEPN---------KKSK--KKNMDRGFVVLIGLALALGTVSVLGIVGVILAY
Skud_12.152        QFPSSSASSELK---------PKS---KKRIDRGFVVLIGLALALGTVSVLGIAGVILAY
YLR084C            QPPSSSASSESK---------SKSK--KKKIGRGFVVLIGLALALGTVSVLGIAGVILAY
Smik_12.143        QSPSTSATSESK---------SKSE--KKKIDRGFVVLIGLALALGTVSVLGIVGVILAY
KAFR0B02690        PGASASATSIPN---------KTH---KRKIDRGFVVLLGLALALGTVAVLGIAGVIMAY
NDAI0B02380        GTPSATHSSQPH---------HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAY
NCAS0B04980        SSSTPTPTSSPK---------KKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAY
                       .                         : . ::**:.*.*::.*: ::*  *  :  

CAGL0L12144g       LFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL-
KLTH0G13838g       FFGDSGDG-YQLSKPRTDENEMIDTVPPEKLMRFI-
Kwal_56.23589      FFGKSSDK-YQSLEPRADESEMIDTVPPEKLMRFI-
AGR095W            AFGDHNA--YQPLKPRINEDEMLKTVPPEKLMKFI-
Ecym_4315          LFGDHNA--YEPLKPRINEAEMLKTVPPEKLMKFI-
KNAG0G02000        IFRDNVGDSYQTLNPRMDENAMVNTLPPEKLKNAT-
TBLA0E04390        IFRDSRGD-YESLKPRTTEHEMFDAVPPEKLMPFVL
KLLA0F18975g       FFINNNG--YESLKPRINQDEMLDTVPPEKLMKFI-
TPHA0B03250        IFRDEQK--YESIKPRIDGQEMLDTVPPEKLMKFI-
Kpol_392.10        IFSDDKGE-YVRIKPRIDEHEMLDTVPPEKLMKFI-
SAKL0H17204g       FFAGNKGQ-YEPLKPRVDEGDMIDTVPPEKLMKFV-
TDEL0F03830        VFNGHSG--YEQVDPRADESEMIDTVPPEKLLKFL-
ZYRO0C01804g       MFGEDIGG-YEFLSPPAEGTKAAETAPPAKSSKFL-
Suva_10.168        VFKDPEGD-YRPIKPRIDENEMLDTVPPEKLMKFV-
Skud_12.152        VFKDPEGD-YKPIKPRIDENEMLDTVPPEKLMKFV-
YLR084C            VFKDPEGD-YKPIKPRIDENEMLDTVPPEKLMKFV-
Smik_12.143        VFKDPEGD-YKPIKPRIDENEMLDTVPPEKLMKFV-
KAFR0B02690        VFRDDNGA-YEPINPRIDENEMIETVPPEKLMKYI-
NDAI0B02380        IFKDGDGS-HDALNPRTNEDEMLETVPPEKLMKFL-
NCAS0B04980        AFRDDDGD-YDVITPRVNEDEMLKTVPPEKLMEFI-
                    *       :    .        .  .* *      

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L12144g
-------------------------------------------MLNFSSSRNNEIQLL--
GSIETFNYYNYQGQQNFTTASSS--QNELELIYYSNNTLLRLDAVPTD---VEMRHIIPF
MDDCFILSGIGTI-SGIELSRQILLNLTQLSYQPIFEKEL-GMVKSIFVDNE--VVYFGG
DITYNNNGVS-GRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKLE
NNSFVSKTNRTRNFSI--------SMEDSEVGQQISLRQATWNA-NSN--LDVDAFICP-
NSDQQAWYSEGS-----YGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGIL
NLTYLDPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEF
AFVNQLPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDI-----A
----------------SYVKLS-GNGWFTVANDNSYLANSYIPNQG-TKPSITYFVGINV
PGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVL
NNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISSEFISDQIDGDRS---LHLNGIFE
YSPSNFTFDNGYLT-GKIDYTILDDFGVSNFNKGASIFAVDQNQ-NLYLGS-TNGSVYEL
NSLNG-SS--VPSTEN-NLSGLINGMYSVEEGLVIFGSIAHRG-REYGAVILNK-SITPL
DIVA-NDSIQASFNSTLFGS-NLLVFDNSTIFNMTSFMVFE-NTSYRNLDLRNAGKNSND
DMLLVGNIVNKGSAIGNESLLISSN-GTYSPF--S-LSDNDTIEGAIYLNDTKALYSL--
SSGNV-----NYFQLSDKQRL---PWTWQS---TVVPVFYSNGQQLL--GAIQENSNKS-
--QIVLIDLFSSQVINDTGNLT-MHKINAIVNFASNATALVGGDFSL--SNPACVGLCLY
NYNNSNWSSFLNNSITGNISQIKF-N-DTQMLLSGKLEVNKTADINLLSINLTSNKQDIL
LYNNS--VVLDDFILVRNL---VVGWNSTDIFIRNVTQWSNLNIFDDGTN-----ATINR
IENFGADSN-----------------PALIIYGQFDSMKYGTINAVIYD--FNSWYPYF-
----EVDVVSQTATPLFFADRDQSSYGNTRHVVP----------DHI---------IVSS
SHSSSAPSSSSS---------HKTNEKPYKIRRGFVVLIGLALALATLIVLGITGVVIAL
LFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL-
>KLTH0G13838g
--MRATTCLATSVLALA---KFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLL--
GNFKDINILKYSGQKNFTGEVSG--NPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPF
KDDAFILSGAGSI-SGHQLSRQLLFNLSSLEFREIFGQDL-AQVNTITANGD--KVFFGG
SFEYEMSNQT-IHSLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVD
NTQQLNNINVSNTS----------NTSVPELGHQISLQSAAWVS-DGT--LDKSAIKCP-
STESTGWLKTGS----TQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIM
NLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SYPGDQVQYFENRTT-LQWSESFQDF
AFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQ-GSA-----T
----------------SNALLSNSSAWDSGSSEGNYLSTSVQDSE--TNPFVIFYPSIIY
PGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFL
DSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTS-------GFINGLLH
YSTSNTSSFLSELG--SYSATDLAHYSVSKLPKHSNIFANMFED-DLVLFT-TDGEMARL
KLANN-LS--IEEYTFETIGKDISTISEYSGGLIIVGTFNGSS--EPAARGFNG-TFFNL
TEF--NSTVRTFSNLTLGQT-EMLIFDKNIILNGTTGEKIY-DTSKLTLEVASAGRNPYN
DTLFQGYVLQNDYTNLNGSFFISTN-SEEVSQNFW-ALGGKLPYDAAFVDNSTTAYAY--
YNPDNTSNSFGVSVMNDSGSTVQLSA-WSG---KVGAMASSKNDSLLAIG-GKDQHTDS-
--QLLVTNSSSGESLASYKWDS-EISLNSIIFFARNNSVLVGGSFRV--NNTQCSGLCLF
NYQDKKWSPFLNNSIRGVINRMEIFN-NSNLLIAGSFRLNETDGVSLASICLKDSSSEIL
HEGNI---TLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFTENSK----FKGLD
VFPLKDTTR----KQKRDSSSK-----VLLITGSLQHAKFGSINAAFYD--SGEWTPFL-
-SSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQ----------GTFSS------NTSSG
TSGTPSPSGSSP---------SNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSY
FFGDSGDG-YQLSKPRTDENEMIDTVPPEKLMRFI-
>Kwal_56.23589
--MLTKSWLATSFLVVA---KLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLL--
GNFQNLNYYRYTGQDNFTGISDE--KARESLIYHSNGTLLELSSPQYSNESFSVDHVIPL
RDDSFILSGTGAI-SGAVLDHQVVFNLSDLSYTAIFNQSL-SPVNAITVNGN--KAYFGG
SFKFKGPDQD-THGLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTID
EKSALNSTLGINST----------SDSAPELSHKIPLKTAKWTS-DGS--LQKDDLVCPS
NSATSAWLGTGT-----TGQFELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIM
NLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSK-AASTDQVEFLNNQTT-VQWSESYQDF
AFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPDCSS-TSN-----Y
----------------SKASLS-ASQWDQGSSDEDYVYTLVENSQ--EAPSVTFYPQIVY
SGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYL
ENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKT------GKLNGLLH
YSLSNSSSYLQNFK--SNNSTDLAQYSVSNFAKNSNFFVDKFKN-YIMLFA-SSGKVSKL
EIDQQ-FD--VRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGST---KGAKFYNG-SFFDI
PLS--HSNVTTFTNFTLDGA-ELVSLGNYYAINTTTDTLFR-NSSKMTLTARSAGLNNLG
ETVFYGSLTRNEYTDLNGSFFISSN-SQSSSR-LR-GSQGRIWYDATYIDNSTTGYAF--
YDPSSTNGSYGVSIYKDMAKERDLSYRWTN---MVGSMLYSKNSSLLALG-MKNETRSP-
--QLLLTNLTTGEDTATFEWKT-NVSINSLIFFDQNTSVLVGGDFNE--SESNCSGLCLF
DYERKHWSPFFDNMINGSIHSMKIFN-KSSLVLGGFFDINDTKQVNLASMSLTDGSYNIL
HQGTE---TILDFIFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSV----FGGLS
EFPIQQGGQ----NKKREEEKNS-----LLITGDLLHKTYGKISAALYD--FNDWIPYF-
-STTPATSTDGLGQSRIYSNKDISSAFNYQGVLQ----------SSRGG------NSSSV
PSGTSSPTSSSP---------SQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTF
FFGKSSDK-YQSLEPRADESEMIDTVPPEKLMRFI-
>AGR095W
--MRLHMGLVAALAPLG---DVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVF--
DDFQAFEYYNYKGQQLFTGQEQ---HQGSSLIYYSEGTYVQLAKLDDD---TVVRRIVPF
GSDSFILSGTGKL-QDQRLEHQLMYNLSTLEVTEILPQSL-ESVNDILVDGD--MVYFGG
QFTYSDGNKS-GHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLE
AASYAETASVLASTEKPQL-----NVTTIETNALTSLRYSTITS-DGH--LDKGKFICP-
TSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIM
NMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEF
AFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGE-QQL------
----------------SPFSTT-ANIWHQGATDASYLSANVVESN----PMVNVKPVIPH
SGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQNNYRLKYDPLYTGHL
DPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPRE------KSLNGLFQ
YTPAGSSLDNGIQK-------YINKDPQTDMPEGVSLVGQVYDG-KLILGVKSTGHIAVV
TPKGTDWN--DVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSS-GPSSALHYDG-NFGSF
FDL--NSETSSIINMTIDGS-ELLLFNNKFIYNTSTSQMLT--SSMFQLSALSAAANSNN
DLLFTGSIADIKHGSAHGAVALDAE-GNIFTSGTP-SISGARVHRGVYLNDTATAYAYYS
VSPNSSVATGGVVIETPGN-----NFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPG-
--ALILYDLRTLQEVAREKLNP-GERINSIVLFGEDNTLLVGGSF----EKDGCHDLCLY
NFVKRSWSAFASGLISGEIKQLQFVN-NRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQ
HEQPN-GRAFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIR----IDGIS
LLMLNNPRS----QNKRNRVGNE----LVVIHGQMNSSEYGEINAMHYN--FENWEPYYF
TIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE---------------------VVVSD
SPPTAEP--------------------KRKLAKGYVVLIALGLALATIALLGIIGVILAY
AFGDHNA--YQPLKPRINEDEMLKTVPPEKLMKFI-
>Ecym_4315
--MYIHKYTLLVLSFVA---GLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIF--
DDFQTFDYYTYKGQQIFTGLAD---ERKNSLIYYSNNTYVQLAELPDG---AEIKKIVPW
GDDSFILSGRGVF-EGHRLEHQLIYNLSSFEITEILKEPL-EHVNDILTDGE--VVYFGG
GFTYNDGNLS-GHSVVKWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTID
NTALLPHRNVSSSFLS--------NSTNIETNALASLRFSSLVH-DGT--LNSSAFVCP-
EGSADSWTIPHS----TMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIM
NMTYVDPITGALAVCDAWCPLQPLSVLSNLAEN-STSSVMAAFPNNNNVLVKWTAAYQEF
AFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDS-QQN-----F
----------------PASVVSKDTVWYQGLPDQSYMATSFTAGK----PSVTLTPSIPY
PGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLM-NRWIYQNNENLKYDPLFRGYL
DDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNS-----NLLNGLFQ
YAASNFTNTNLSTL---VGSTNIDQYPVRNIPHSSSLFGQIYND-TLFIGSPSIDGLAKI
SRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTN--MASSLSFNG-SISTI
FRS--NAPSLSILNLTIDGS-EILVFDNGYVYNVSSQSDIS-NSETLKLSLLSAGANLED
DLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLP-SVDDGIIYRGLFINDSSSAYAY--
YSKSLGSSKGGIVVYG-EHEP---EY-LSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLA-
--SLYIHDLSADFAPIKETFEI-GEVINTMVLFGRNYTLLVGGTF----TRNGCRDLCLY
NYATNNWTRFMDGNITGDIRQLQFLD-GNTLMVAGLLASSDSKDLQLVEIDLSNMEIISK
LQGTN-TGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQ------TQING
LTLLSTDFSQRNSIMKRDRVGNE----LVVINGNFSSPDYGDINAMYYD--FNGWNPYYF
SVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLS----------NDN---------DNDD
TPAASEPATHEK---------H-----TKKLAKIFVVLIALALALATVAVLGVVGVLFAY
LFGDHNA--YEPLKPRINEAEMLKTVPPEKLMKFI-
>KNAG0G02000
----MWCSVVYCLWFAV---AITRASNLENVRRILNATEVTVPTFDVG-NKNNQFQIL--
DDINGISFYEYLGQQNFTTDANV--TDVQRLIYYSNETFMSLSDSIAAE--AQIQGIIPL
GDDSFILSGQGMI-NNVSLASQLVFNMTDLSITKIFDTPL-RSIEGVTVDGP--LVYFMG
NFTFNN-----NTGAIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVW
NSSLLLQSNVSEESVR--------NTTSLLLNPSVPLQYSQWKT-NGE--LDSSQLICP-
DPSKDSWSVSAT-----TGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIM
NLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEANTVAIINNNSTNIQWTPNYQEF
ALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSFNTPNCNN-NDKDSNNTF
----------------TSSSLS-PNNWT---SVGEYLTVGYTPNEN-PVPKVTYKIDIQH
SGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQL
NSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSK-------LALNGLFQ
YQISNFTNDSIPM---KIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSG-TEGNMFSI
NLNTD-LS--VQNSTRLISTENFTTFQPYSNGLVMLD-------GQGNVSLFKD-NFKNL
NTTMDGSLATDVANITLNGD-ELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSIN
DTIFLGKVVQWQYAIANQSAQVNAD-FNDGIEQMS-LPSNTVPSRGIFLNDDSTGYFY--
KESNK-S---KLYITNSNSTS---GLEWYG---EPETVVYDKNDTLLMVGYYNDNTFSS-
--TLSLTNLTSFDVIKEENLNV-GSSISSLLYFAKNDTLLVAGDFEP--SNGNCSDLCLY
NYKSGQWDSLANNSVSGSVAALQLYQ-NDTILVLGNLTLPQANDVNMAFVNLSNNHVGSL
IMKKDAPVNLHSMIVSNSR---IVAWNDTVLFSFDGNSWTRVSVPGTDSSA----TSISS
VQFISMEGT--------------DD--ALLLLGEFRHSEFGDIKSIVYN--FRDWIPYL-
-LYVDG---PRQGTGHLFMNRDISLHNIAQIPLL----------NSTRVLTNQSFASSTS
SSVSSTSTTLPKVST------THSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAY
IFRDNVGDSYQTLNPRMDENAMVNTLPPEKLKNAT-
>TBLA0E04390
--MRICIRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTS
NGFDTLNFVHYNGQQNFTQPIIS--SSQNHLIYYSNDTYIRLLDIPYS---TRIQHIIPY
GQDAFILSGTGSL-NGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGG
NFSYLLPDSNISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLD
DPSILHIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICP-
TSEIEAWASDSK-----AGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIM
SLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEF
AFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCND-QTA-----Y
DNEDLIKAALPRVMGSSYSILS-DNDWYTPLPNSDYLACTYLSSSK-LIPTVTFYPNLLY
AGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYL
DPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSSNEIDIYN--VTLNGLFQ
YPEYNSVNNLNE----NYTNSTINQYAYSNYPANVSLIAAAYDKDTLLVGG-SINKLQEF
QIEKNGQN--ISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSS-GSYKAITFTNNKFGTL
GNF--TDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFK-NTSTFELSLWSAGKNAQN
DLIFSGLVSENENVNLTGVVSINAN-EQIKEL--N-LGNNIYPYSAVFLNDSSTIYAY--
MEPNTRLN--RLIHSN-GEQI---SWSWKN---KISSMAFFPNESLLSVGTISDKDVFP-
--SFSILNLTSNKVIANETLNK-NSQISSLLYFTKNSSVLVGGNFTF--SDYQCSGLCLF
NYETKNWSTFMNNTLEGTVSKLELKN-NSNILISGTLSTNKSANIDLALLNLNTYNVSIL
LQNTN----LTSFEFTGNQ---IAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFD
ITNKNSSSI----LEKRALRDTN----IMVATGQFYSKGLGTVQALYYT--SDTWIPYF-
-YGNLTNNMDTSNSINIFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTN-TTSTT
NLTSPSNTTSPQPSSSIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSF
IFRDSRGD-YESLKPRTTEHEMFDAVPPEKLMPFVL
>KLLA0F18975g
--MFSINPLIYVLLVLA---GMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYM--
NNFEELTVISYTGQQNFTVQ-----ANESSLLYYSNDTFVKLFETSPE---TTVTMIVPL
FEDSFILSGTGQI-NGVALEQQILLNLTSLTTSPIFPSAV-ENVMDILTVNE--TVIFVG
NFSMSVSNET-GHGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQ
NASLLQEFGNATNSSHE-------DLTSLQFDQSVPLKLSSI---TGE-NVQSDILLCP-
SGGQNGWSASEA----VQSTLQFDLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIM
NLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVG-INNNSTNLKWSESYQEF
AFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYNEPNCES-VTE-----Y
----------------SKAELS-SDNWYTTDESDTYISTNIDD----NIPYVTFHPNITY
PGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSL
GSAPEIIVTWDKAI--GESDSVMVVDRLGVITEYIDTISISSNDTT------FHLNGLFQ
YNTANVTASIFST------NDTFNDYALYNFPLDANLYAASLNN-DILIGG-NFNGIAKV
ELNDE-AL--ISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSF
GQL--DEPIDRIVNFTIDGH-ELLLFDNAYIFNVSANMYVS-NSSTFEITGQSAGINSGN
DSLLFGSFLKRSVGELNGLASLSSD-GQVSSPTLPELPTDVQPYKAAYINDTSAAYAL--
QEGSTDNVQHRVLITNTNSSSHMLQIQWSA---PINAFLYDNVPNILAIGTNGSNSSSQY
DVQFSILNLTGYENVARVNFST-NERVNSMVSFSSNNSILVGGSYEI----DNCNDLCLY
NYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTV
KSGTE---PLLSFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNND------SIVSG
FKVLSGTES-----KKRDEGSH-----IVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYF-
-VISDPKEQESLPSSSFFQNVNDLYLSSSQTVLQ----------SNN------S-DTSAS
STPTPSTTSSSH---------STK---DKKIDRGFIVLIGLALALATVAVIGLIGALICY
FFINNNG--YESLKPRINQDEMLDTVPPEKLMKFI-
>TPHA0B03250
MSIISTIVRLVVLFSLA---NNATASSLSNILKLLNIQEFELPNLNFN-NTSNSIQLL--
GDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSND---TDIQKIIPV
GDDSFVLSGSGHL-NGYALGRQLLYNLTTLSIKPIFDQDL-GNITSILVDEE--IVYFGG
EFTYQTRSQN-SSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLG
NSSLLTYNTTSNFSNFTNSTE---NSSTIQLEQQISLKYATWDA-GTA-YFDQNNFVCE-
AGSSEAWIVEGR-----SGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIM
NLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEF
AFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTESTSL----F
----------------SSSVLS-DNGWYKGLDSDSYIAANYQSDSS-PLPTVQFYPNIQA
VGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKL
TVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTS--LKLNGLFQ
YQLSNFTSDTKT----KVGNNSIHQLALSQFPSSVSLIGNTFNN-SIFLAG-STSNIVQL
QLNSD-LE--LRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNG-TFSSF
SQL--GDNVTTFANFTYEGS-ELLFFNNDYLYNVSSESYIY-NNTMFTASVLATGANSNN
DTLLLGNIVRSEYSNFNEPLKLYGN-SSLESL--T-FSSSIVPYAAVFLNDTANLYAY--
KDGEN-S---KIIYGN-NMTT---SLDFSG---TLNKLSFSNNSSLLFAN-AITNNGSS-
--SLVISNISDGMSLASENLNN-YGYITSMIDFNSNNTILVSGNFTL--DDVDCHGICLY
NYFTKKWSAFANSTIKGSIVEMQLWN-SDQILISGLFSAQNYSSITLASLDIKGYNISVL
SDDSK--IEISSFIHDGQS---ITVWSNDTIMEYKSEKWNEISFPNTTS------KYIES
VEAVS--------IDLQNSTSNVSK--ILFAYGEFNSTLYGRLNAMLFR--AGDWKPYF-
--SINNFQVNEDPAITLFENRDLSSLFNSKNSLP----------ANI----TSA-ETSSR
STVSSATATTVV---------NKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAY
IFRDEQK--YESIKPRIDGQEMLDTVPPEKLMKFI-
>Kpol_392.10
---MLATIVRLISLGII---GVSQASQLTNVKDSLGINTVNIPQINFG-NTNNEIQIL--
SNIEGLTFYQYQGQQNFTGSIDTN-SNTHGLIYYSNDTLIKLLEGSDN---TKIDQIVPL
DEDAFILSGSGTL-GGFQLENQLLYNLSDLSIIPLFNNQL-QNIKSILVDKD--IVYFGG
NFSYTSNNKT-ANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLD
DKSLLVSNITTYTQQNSTSSSS--TETNLELEQQISLKYASWAS-LGD-LKSSTQFICP-
NGQNEAWSSAGT-----TGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIM
NLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSAFINGNKTNIGWSTDYQEF
AFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNSLNEPACDS-PNTV----I
----------------PSSYLS-NNIWYQGLNSQSYIATKYTPGDD-PSPLVNFYPSINR
IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL
DYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQ
YQLSNFTSSNNNST-LKVDNTSLNLFPVSRFSSSVSLYGVEYNE-TLLLGG-SIAGVYAL
SLSNY-TN--IRSTRIVETGGEVTGTGAYAGGVVLFGNFNISN-RIVSSLSYNG-TFDSF
GNV--NSNIATFSNLTFGES-EILAFNNEYFFNTSTSSYIF-NTSALSLSIWSAGSNDFG
DTLFSGLITRNEFPNLNNSAVLTGN-GTAQSL--Q-LRNGIQPYLGVYLNDSLTAYLY--
DSSSN-S---NILFSN-GLQG---NWNLPR---SVSSAYYSDNETMFVGSSLSNGDSGA-
--ELFVLNFTTMDLLYNETFDV-NSSINSIVSFGRNSSLLVGGDFTA--PNTNCSNLCLL
NLGNNQWSSFSNK-FDGTITGLEFAN-DSRLLISGSYRFENQSGISLGYIDLNNQEFKSL
LSDSQ---KVNSFNYNNGT---IVAWDSSTIYSYRGDSWSNHQIPNTNSS-----TSIKN
VQIVSKLNN---SLSTNNTSNNLND-ELILVFGELYSEDYGFVQAMFYD--FQNWIPYY-
--ITQPYSSLNTSKNSLFMNKDISLLYESQVVLQ----------NPNSTISISS-TSSSS
ATTRSSSTSSTS---------LKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAY
IFSDDKGE-YVRIKPRIDEHEMLDTVPPEKLMKFI-
>SAKL0H17204g
--MTAFLKILTATYALC---QLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALL--
GDFEDLTFYRYTGQENFTGSIT---ETEKDLIYYSNGTFIKLDSLSDENATADINHIIPF
GDDSFILSGTGTLPGGHNLEQQLLYNLSSLEYTAIFNQSI-STVNDILADDE--IVYFGG
EFQYTLGNST-GHSVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLD
DNTLLKQIRGSNSSK---------NATDIEFDQLIPLKHAGWSS-QGS--LEHSSLICP-
SDDSDGWFQEGT----ATGDFTVSLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGIM
NLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQEF
AFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPNCDN-INS-----Y
----------------SHAVTSSKQQWTQGSMDSSYILSTY-DGTG-DLPSVNFYPNITY
AGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYL
ESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTIN------ETLNGLFQ
YQISNFTTISNDSL--KIGNTTINRYSIENVPSNSELFAGYYNN-TLLVDG-AFNGIAVL
QLNDD-LN--IISEQRMGTGGPTEGINTYSNGLLFLGDFNLSS-QQISTLSYNG-TFSSF
GNL--RTNITRFNNITIDDS-ELLVFNNRYIFNVSSNEYIR-NTSSFALSLWSAGSNSKE
DGILVGAVSQRQYTELNGAVYINDA-NSISTIGLP-SFDGKRVYTATYINDSSTAYAYSS
KNDST-H---HVLIAR-GNRSEDLPVSWSH---AVNTMIYNKDDSLLAVGTNAGDTNGT-
--SLSLFNISNSKMIGEENLGA-KSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLY
NYNASKWSNFYNNSISGNITDLQFFN-GTQLLISGNLYTENETGINLAKLNMASNEVTIL
RHGST---MVQSFVTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSL----YMGAQ
LIPLKQTSS------KRDVSNR-----ALLVNGDLKHSTYGSVSAMLYD--FEDWMPYF-
--IVDG--ENAGRASNIFMNKDLSSLYTTQTILQ----------GSN----------TST
STTSSNMPSETS---------DKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAY
FFAGNKGQ-YEPLKPRVDEGDMIDTVPPEKLMKFV-
>TDEL0F03830
-----MYGLLFLLFQSV---CLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLF--
GGFNALTFPQYEGQENFTGTINNN-TDSRGIVYYSNDTFIKLINGSSD---SYVEKIVPF
GSESFILGGSGSL-LGYELGRQLLYNLSDLSLRPIFENSL-TDVRVILEDYP--VAYFGG
NFSFDNGSTV-GHSVATWNSSSNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLD
DQTLLITNENTSKTN---------HSQSIEINELLPLRAATWNT-DSDSSFDSSAFICP-
NSQKEAWSVPST-----SGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIM
NLTYVDPLSGELLNCDAFCPLMLQDSLKAAVAN--GNTSQVVRLDNNLTDIQWSYDYQDF
AFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCES-NDI-----A
----------------STSALS-DSEWQQGLFGQSYLVADFRTGQE-TLPKVTFYPAINY
AGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHL
ETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDET-------IPLNGMFQ
YQLSNFTNSTDSKP--SIANTTLNSYTVQNFPKNASLFSSMYNN-TLWVGG-SVSGVAAV
ELDED-LH--VSSTAKYATGGTVEGISSYSDGIILFGTFNLSS-QPVSTLTFNG-VFGSF
GNL--ETTLRTYTNVSFQQD-ELLVFNNEYVFNLSSNSYIS-NSSTFGLSLWSAGRNQFD
DTLFSGAVTKNQFPGLYGSASIYSN-SSVAHF--S-LQNGAQPYAACHLNDSVTAYAY--
RYGSV-S---QLYFDN-GKEG---PWTWFG---TINSMRYSKNSTILAIG-TDGSTDEP-
--ILSLFNLTSFDVLANTTISE-NGTISSMVFFDRNSSLLVGGDYHI--SDADCSGLCLY
NYDQKQWTKFANNSITGNITEMQLSE-SYDLLISGAMNVANKTSVNLLSFNMSNYEVNPL
VWDSN--GPIKSFIAEDND---IITWNETSLSGYSDGDWQNLEFDNSSL------ISIVD
VIAVKTEPA----LDKRQTFSSTFD--AILVAGQNYA---EYPQASIYN--FQRWLPYY-
--VANKADDEDPSRTTFFTNQDDSQLYDSQNLLS----------DPT----RTT-TSSSS
STTSSSQTSPSK---------GSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLAL
VFNGHSG--YEQVDPRADESEMIDTVPPEKLLKFL-
>ZYRO0C01804g
----MLFFALLSFYFLL---AITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELL--
GDFQDLTFYKYTGQENFTSPLNSS-TDSHGLIYYSNDTFLQLANGSND---TDIKQIVPL
GEDSFILSGSGHI-DGYNLQRQLHYNLTDLSFKPIFQEGL-TEVNSILVDQP--LVYFGG
NFTFSNGSQT-GHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELD
DVKLLENHILGSNNSSSKS-----NWTDVELGLAIPLQNANWTS-SSS-QFDADDFICP-
DPERESWLQSGT-----SGSLACSLPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGIL
NLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNNTTDIKWGRDFQEF
AFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPACGK-MQS-----Y
----------------SNATIS-NNDWRQGLNGQTYLSTSYVEDQG-NIPRVTFHPQIQY
PGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHL
KSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKD--------ITLNGIFQ
YQISNFTKNITKE---SIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLAD-SKSKAAEI
KLDKN-WS--VDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQ-RQPLALSFNG-SFNSY
DKI--NRSVERFTNIDLKGT-ELLVFDNEFFYNVSSQSYVS-NTTRFSLSVWSAGQNTNG
DLIFSGAVSDNDYENLQGPVSLFQN-GSAVSS--N-IKDNINPYMGAYLNDTLTAYAY--
KDGSD-S---RIVFSN-GDEG---PWRWTN---SIETMIYRNRDALLALG-TSSSPSLP-
--QLSVLNLTTSEVLANETLDK-GAEVNSMILFGKNSTLLIGGNFSF--SDAHCNGLCLY
NYKNKRWSTFANDSITGQVTQVQLRN-SSELLIAGSLRVNGTSDVNLVSVNITGQGMKTL
LRGWE--GPLRSFVVSEDR---LVVWNDTSLMAYDNTSWRHISTSNSTSF-----TKLQD
IHQVSLEHS----LEKRANSSSNSNLDGLLVYGNDKTQG-DSYQASIYD--YYSWTPLF-
--IANSKSENSNSGPNIFMNQDVSDFFISEQMLP----------NPT----NHT-SSRSS
SSSSSAVTSNSG---------DKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAY
MFGEDIGG-YEFLSPPAEGTKAAETAPPAKSSKFL-
>Suva_10.168
--MFVHRLWTLALPLLT---LGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQIL--
GGVDALSFYEYTGQQNFTKEIGSE-TNSRGLVYYSNNTYILLEEADED---TRIDKITPF
GADSFILSGSGSI-NGVPLGNQVLYNLSTLSMARIFTQSL-GSVEAVLVNDT--SVYFGG
NFSYNNGSMT-GHGALVWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLD
DSSILTTSSTNTTNASSTL-----NATTLELGQRIPLRYASWDS-QGSTTFESSYLVCP-
DTSKDAWLYPGT-----SGSLVCTLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIM
NLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDF
AFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYGCSA-LAND----S
----------------SSSILS-DNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIH
PGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYL
DFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH--TPLNGILQ
YQRSNFTATTSNGT--KIANTTLNLFSVDNYPKNSSMFADVYDK-KLILGG-KDNHISVI
DFNDN-LE--VTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSD-NKSTVLMFNG-SFESV
SNY--SKAVENAINITLANN-DLIVFNNDYIFNASSNSQIS-NSTSFSLSLWSAGNNDND
DVLFSGAVSQMQFSDLSGSARFLNE-STVEAL--N-LNKGIVPYLGAYLNESTIAYAY--
KTNSL-S---KIYFSN-NVSP---SWNWSN---NITKMVYANNQTLLVIG--SESSTTA-
--ELSILNLRNFTTIANETLGS-NAKINAFVNFEKNSSLLVGGDFQM--SKPNCTGLCVY
NYESKSWSTFFNNTIVGEITQLAFNN-ESELIISGLFATEKQQSIRLGSFNLTNSTMVPL
LTGSG--GKLNSFTVTEES---IVAWNDTSLLIYKDQKWNTTSLPGNGSSV----SSVTT
IDTNTDSYA----LRKRATTDAEKG-SILLLNGNFSIPQYGNLQGLLFD--SQNWTPYF-
--TSET-LEASSYNPTIFINRDVSADFNSQIPLS----------NSN-MTVTSP-QSTSP
LSPSSSASSEPN---------KKSK--KKNMDRGFVVLIGLALALGTVSVLGIVGVILAY
VFKDPEGD-YRPIKPRIDENEMLDTVPPEKLMKFV-
>Skud_12.152
--MFVHRLWTLIFPFLA---QASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQIL--
GGVDALSLYEYTGQQNFTKEISPG-TNSRGLVYYSNNTYIQVEDASDD---TRIDKITPF
GADSFILSGSGTI-NNMPIGNQILYNLSTLSMAPIFDQPL-GSVESVLINGT--SVYFGG
NFSYNNGSMT-GHSALIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLD
DSSALITAGSNNTTNSTSLL----NATKLELGQRIPLRYATWDF-QGSTTFESNSLVCP-
NANEDAWVYPAT-----SGTLVCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIM
NLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDF
AFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEYGCSA-LAND----S
----------------SSSTLS-SNSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVH
PGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYL
DFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEY--IPLNGVLQ
YQKSNFTSTTSNET--KIGNTTLNVFAVDNYPNNSSLFADTNGD-RLILGG-TNNHISII
GLNDN-LE--VVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSN-NQSSVLLFNG-SFENV
FNY--SRTVNSAINISLANN-DLIVFDNDYIVNTSSSAQIL-NSTSFSLSLWSAGSNGND
DVLFSGAVSRMQFGGLNGSARFLSE-DKVQAL--N-LDNAVVPYLAAYLNESTTAYAY--
ETNLL-N---KIYFSN-NVDP---SWNWST---SITRMLYANNQSLLTVG--SESSTTA-
--ELSIFNLKNFTMIANETMGS-NAKINALVNFEKNSSLLVGGNFQM--SKPNCSGLCLY
NYESKSWSTFFNNTFFGEITQLSFSA-ASQLVISGLFDTEEYQSVRLASFNLTNSTMIPL
LTGAE--GKINSFVVTEES---IVAWNDTSLLIYRDQEWNITSVPGNDSSI----GSVST
INTNAGPGT----LNRRATNNAENG-TILLLSGNFSIPDYGNLQGLLFD--FETWSPYF-
--VSES-SNTSNRNPTIFINRDVSTEFNSQIPLS----------NLN-VTETGP-QSASS
QFPSSSASSELK---------PKS---KKRIDRGFVVLIGLALALGTVSVLGIAGVILAY
VFKDPEGD-YKPIKPRIDENEMLDTVPPEKLMKFV-
>YLR084C
--MFVHRLWTLAFPFLV---EISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQIL--
GGVDALSFYEYTGQQNFTKEIGPE-TSSHGLVYYSNNTYIQLEDASDD---TRIDKITPF
GVDSFILSGSGTI-NNISVGNQILYNLSTLSMTPIFNQSL-GAVQAVLADNS--SIYFGG
NFSYNNGSMT-GYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLD
DPSALISSSNNGTNSTSSL-----NATTLELGQRIPLRYASWDS-QGSTTFASDSLVCP-
NTNEDAWLYPDT-----SGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIM
NLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDF
AFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSA-LTND----S
----------------SSSTLS-SNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIH
PGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYL
DFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE--TLLNGILQ
YQKSNFTSTRLNET--KVGNTTLNLFPVKNYPKNSSLYADIYDN-KLVIGG-VSNRISIV
DLNDD-FE--VTSSKNQTIQGDVHGITKTNQGLLIFGDILSSN-NQSAVFLFNG-SFENV
FNQ--SRTVNSALNISLANN-DFIVLDNDYVVNASSNALIR-NSSSFSLSLWAAGNNGDG
DVLFSGAVSHMQYGNLNGSVRFLNE-NEIEPL--N-LEGGIVPYLGAYLNESATAYAY--
EVDSL-N---KIYFSN-EVYP---SWNWSS---GITQMLYADNQTLLAVS--AGSSTTA-
--ELSIFDLRNLTMIANETLGS-NARINALVNFEKNCSMLVGGDFQM--TEPNCTGLCLY
NYESKTWSTFLNNTIFGEITQLSFTN-SSELIISGLFETKEYQSIRLGSFNLTNSTMIPL
LSGSE--GKLNSFTVTEDS---IVAWNDTSLFIYRNQEWNITSLPGNASSI----SSVSA
IYTDIESNT----LNKRGINNVNNG-SILLLNGNFNISQYGYLQSLLFD--FQKWTPYF-
--ISET-TNTSNYNPIIFINRDVSTEFNSQSPLA----------NVN-ITVTSP-QSTSS
QPPSSSASSESK---------SKSK--KKKIGRGFVVLIGLALALGTVSVLGIAGVILAY
VFKDPEGD-YKPIKPRIDENEMLDTVPPEKLMKFV-
>Smik_12.143
--MFVHRLWTLAFLFLA---QASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQIL--
GGVDAISFYKYTGQQNFTKGISPG-TNSHGLVYYSNNTYIQLEDASDD---TRIDKITPF
GDDSFILSGSGTI-NNISVGNQILYNLSTLSMAPIFNQSL-GDVETVLVNDT--SVYFGG
NFSYNNGSMI-GHSALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLD
DSSVLITSSNNGTNSTFSL-----NATKLELGQRISLRYASWDS-QGSTTLASNSLVCP-
NDNGNAWLYPAT-----SGSLVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIM
NLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDF
AFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYGCSA-LVND----S
----------------SSSILS-NNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPNIIH
SGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYL
DFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ--TPLNGIFQ
YQKSNFTGTTSNKT--KVGNTTLNLFPVNNYPKNASLLVEIYND-KLIVGG-VSNRISTI
DLNEN-FE--IKSSENRTIQGDVYGITKTGQGLLIYGDLRSSD-NQSTVLLFNE-SFGKV
PNY--SKRVNSATNISIADN-ELFVFDNNYIINASSNAQIS-NSTSFSLSLWAAGNNGNG
DVLFSGTVSHMEFSNLNGSASFKNE-DQVQAL--N-IGRGIVPYFGAYLNESVSAYAY--
ETDAL-N---KIYFSN-KVNP---SWNWSN---TITRMLYANNQTMLVVS--SESSSTA-
--DLTIFNLRNMTTIANETLGS-NAKVSALVNFEKNSSILVGGDFQI--TKPNCSGLCLY
NYETKSWSTFFNNTIFGEVTQLSLAN-SSELIISGLFNTREHQSIRLGSFNLNNFTMVPL
LSGSE--GKLNSFVVTDNS---LVAWNDTSLFIYGNQKWNITSLPSDDSLI----GSVST
ISTNTKSDT----LNKRATNNAHDG-SILLLNGNFTMPQYGNLQSLLFD--FQAWTPYF-
--ISEI-SNSSNYNPTFFINRDVSTEFNSQITLP----------NLN-ITVTNP-QSTSS
QSPSTSATSESK---------SKSE--KKKIDRGFVVLIGLALALGTVSVLGIVGVILAY
VFKDPEGD-YKPIKPRIDENEMLDTVPPEKLMKFV-
>KAFR0B02690
--MRTHHKLIKSLSLFT---TLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLL--
GSYDALSLYTYTGQQNFSYQITPD-TNSNGLVYYSNNTLIQLNQGLDD---TRINNIVPI
GSDSFILSGSGSL-NEYSLENQLFYNLSSLSVYPIFNTTL-EQVESILVDED--LVYFGG
NFTFSNGTDD-GHSVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLD
DASLLTSNTSNATT----------NIYDLELSPLLPLNEATWSS-DVS-DFDASSFICV-
NPDSDAWFVSGT-----TGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIM
NMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDA-ASVSEMARLLSDNATVIKWSAEYQEF
GFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTS-NNSD----Y
----------------TSSTLS-DNDWVFGASGQTYVTTFYTEGDD-PIPQVTFNANLPY
SGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYL
KNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGST---VALNGLFQ
YQLSNFSSTFNSSS-AKVGKTFLNQYPLDIFNTNSSLFASTYDN-YLLVGG-AEQSVYAL
ESSND-LN--FSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSG-VTEGAVTYNG-SFNPF
TQYG-NSSIDTFKNVTFGNS-EILVFNNAYLYNVSSSTLMS-NSSSLSLSLWSAGANANG
DLLFNGASSQMSYSFNNESINIGAN-NIVQGL--N-FNESIDPYLGLYMNTSHGAYFY--
QDDDN-T---RVYFTN-GSQP---SWQWPN---DVVAAIYSDNQSLLIAGTSSSLESSS-
--FLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGNFSM--PNVNCFGLCLF
NYGNSTWSSFADASINGTVDHMQLFN-ESELIVSGLFSTKNISSITMASLNLKNNKITAL
KSGES--NTFKSFTVADQK---IVAWNNTALSIYEDNVWTVERISNINSS-----SVVDN
LNYVTLASA----LSKRDTSSSD----AILVSGQLYDNSYGHIQAMVYD--FSSWVPYL-
--LINSESDSSINA---FIDRDMSSFTNTQVALL----------TNSGTVSNSS-SSTTS
PGASASATSIPN---------KTH---KRKIDRGFVVLLGLALALGTVAVLGIAGVIMAY
VFRDDNGA-YEPINPRIDENEMIETVPPEKLMKYI-
>NDAI0B02380
----MLFSWVFNFLLLI---HILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLL--
GDIDGLSFYRYKGQQNFTTGIIPG-SNSNGLIYYSNNTLIQLEEPSND---TYIAKITPF
GSDSFILSGTGSL-SGYSLTNQLLYNLTTLSIEPIFNTSI-EEVKTILIDDS--LVYFGG
NFTVLNGTSN-IHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLD
EPDFLIQNTTSSQNNIF-------NSTTVDIGQLVPLSASTWDT--GESTFDSDTFVCP-
DTTEESWIQSGT-----TGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIM
NLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEF
AFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCNS-IES-----S
----------------SSSSLS-ANDWEMGLTGQTYISTTYTPNQD-PVPYVSFSPQIKY
PGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYL
SSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEI--MNLNGLLQ
YQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGN-SNGGIKVV
KLNEN-MD--IESSNEASLTGNTAGFSSYSGGILAYGEYNLSS-KITYLVNYNG-TFNEI
PNFNKNSSITNVVNLTIHDT-ELLVIDNQAIYNVSSSSTIT-NSSALQLSLWSSGSNLNR
DTVFSGAIALLDYTDLNGSIAIGNN-FTVTNITNN-VSSTNSLYTGLFLNDSLSIYAS--
KTDSY-S---ELLFSN-GYSA---PWSFFE---GINYMVYSSHQTMLAVA-SSDFNKNS-
--ELSILNLTTFETIANETLNV-NSKINGLINFEHNSTLIVGGNFTI--LQSNCSGLCLY
NYDSNEWLTFANHSINGTIAQMELIN-GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSI
KMGDA--NILQSFATIGDK---IITWNGIMLESYENGAWSTIQSNFNSS------TTIRS
IEPIGFGPT----LQKRDGTGSADG---FIINGNIYDTEYGTIQAMIYN--FKEWRPYY-
--IISS--TNSQIAGQIFMNRDDSALYNSQSVLQ----------NPNNATVTTP-SSTSS
GTPSATHSSQPH---------HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAY
IFKDGDGS-HDALNPRTNEDEMLETVPPEKLMKFL-
>NCAS0B04980
----MLIKILLGALLLI---PQIYASQLSSLQENLNITHINIPNLNLT-TDDNSFELL--
GGIDSLSFYRYTGQQNFTSGILPN-SNSNGLTYYSNNTFIQLYEPSLD---SRIERIIPF
GSDSFILSGKGSL-GGYSLSNQLLFNLSSFSLKQIFNQTL-DSVNSILVDGT--VVCFGG
NFTLSTNSLN-GHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLD
NSTLLNVVNDTMR-----------NISDINLGQLIPLSAATWSS-TGS-FFDEETFVCP-
DPTIEAWFQNGT-----SGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIM
NLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEF
AFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNS-LES-----F
----------------SSSDLS-NNTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKY
SGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYL
NYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNS-----LELNGLFQ
YQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYND-TLLVGA-GDDGLSIY
ELNKD-LA--IQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSK-ESSNVLSFNG-SFDSI
GNI--TSPITNFANITIDDS-ELLVFDNNLIFNVSSSSQIS-NTSSFSLSLWSSGSNSNG
DTLFSGALSQVQFTNLSGSVSIANN-LSATS-----LRSIGSPYAAIFLNDSVTGYVL--
KNDSSTS---EMIFSD-GSKA---PWRWTG---YVDSMLYLTNQSMLAVGSSSSVNG---
--ELSILNLDSFKVLANETLNQ-NSSVKTMVHFERNSSILVGGNFSI--SNTECFGLCLY
NYTGNQWYTFLNGTINGTITKLQIFN-DSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLI
RWGFK--EPVKDFITIDDN---IFAWNETSLFEYTSNSWVDIPISNSNSS-----TTIDS
IGWTTTTDN---NLKKRDNSETSNN--VLIVKGQIYDNVYGHIQAMIYN--FEEWIPYL-
--SINSLVSSANQPAELFIDRDVSKLFDSQLALQ----------VSN-----TT-ASITA
SSSTPTPTSSPK---------KKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAY
AFRDDDGD-YDVITPRVNEDEMLKTVPPEKLMEFI-