MUSCLE (3.8) multiple sequence alignment

Suva_10.166      MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR
YLR082C          MSNFKNFTLNSFEDYYGKPSETPKMEEEKLEVTNVNASSSKKVHKSKKSTSKYDQKNVFR
Smik_12.141      MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVSASSSKKVYKSKKNTTRYDQKNVFR
Skud_12.150      MSNFKNFTLNSFEDFYGKASETPKIEEEKLEAMNTNASSLKKVHKNKKVISKYDQKNVFR
                 **************:***.**...:*:** *. * ..** ***:*.**  :.********

Suva_10.166      NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS
YLR082C          NSMTGIAQILPTKPVKIIEQNIDFANPKSFDLLQSTHTICFNKRINTTNTKLNVETHTSS
Smik_12.141      NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS
Skud_12.150      NSMTALAQVPPSKSVKIIEQNIEFSNPKSFDLLQATHTICFNKKNGTKDTKINMEAQTSS
                 ** *.:.*  * *.:*****.*:*:*********:******... .*.:**:*:*::***

Suva_10.166      DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA
YLR082C          DIDNDILHVGAPTDLGGNSNDEAETRQLRKFRWSNNKEKSLCEKLTVIYWALLLHTTKRA
Smik_12.141      DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA
Skud_12.150      DIDNDMLYVEAPADLGGNSNDEAETRQLRKFRWSNNKEKCLCEKLTVIYWALLLNTTKRA
                 *****:*:* **:************************:*.:*************:*****

Suva_10.166      SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD
YLR082C          SKRRPILCHQMIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWVGDAKTGD
Smik_12.141      SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD
Skud_12.150      SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWIGDTKTSD
                 **********:***************************:*::********** . :**.*

Suva_10.166      LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK
YLR082C          LQEQFNIATVKLYESAEDGRLSIGKDKPFREENTGSDSLVRAEEDSTAVTNENGHISSEK
Smik_12.141      LQEQFNIAIIKLYDSAEDGRLIMAKDRVFREENSRSNSSVRAEEDFTSTTDENDQVALQR
Skud_12.150      LQEQFNIATVKLYESTENGRIIMGKDKVFREENAGSDGLVQ--EESASVTDENGQVALEK
                 ******:* :***:*:*:**:  .**.  ****: .:. :.  *: : .*:*.. ::  .

Suva_10.166      STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT
YLR082C          NLKKDRRESIRNQILTLDLNDEDFFQNVMKVLSAIDEPELRQYVIVISELVSMEMDDGKT
Smik_12.141      NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT
Skud_12.150      NLKEDRRESIRNQILALDLGDEDFFQNTMKNLSAIDEPELRQYGVIISELVSMEIDDGKT
                 . *:**** ***:**:***.****::* ** **:****:****  :*****.**:*****

Suva_10.166      VREKLRDVEMSINRLQVDIREIKEMLIALANK
YLR082C          VREKLRDVELNINRLQVDIKEIKEMLVTLINK
Smik_12.141      VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK
Skud_12.150      VREKLRDVEMSINRLQLDIKEIKELLITLMNK
                 *********:.*****:**.****:*: * :*

FASTA FORMAT for MUSCLE Version 3.6

>Suva_10.166
MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR
NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS
DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA
SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD
LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK
STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT
VREKLRDVEMSINRLQVDIREIKEMLIALANK
>YLR082C
MSNFKNFTLNSFEDYYGKPSETPKMEEEKLEVTNVNASSSKKVHKSKKSTSKYDQKNVFR
NSMTGIAQILPTKPVKIIEQNIDFANPKSFDLLQSTHTICFNKRINTTNTKLNVETHTSS
DIDNDILHVGAPTDLGGNSNDEAETRQLRKFRWSNNKEKSLCEKLTVIYWALLLHTTKRA
SKRRPILCHQMIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWVGDAKTGD
LQEQFNIATVKLYESAEDGRLSIGKDKPFREENTGSDSLVRAEEDSTAVTNENGHISSEK
NLKKDRRESIRNQILTLDLNDEDFFQNVMKVLSAIDEPELRQYVIVISELVSMEMDDGKT
VREKLRDVELNINRLQVDIKEIKEMLVTLINK
>Smik_12.141
MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVSASSSKKVYKSKKNTTRYDQKNVFR
NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS
DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA
SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD
LQEQFNIAIIKLYDSAEDGRLIMAKDRVFREENSRSNSSVRAEEDFTSTTDENDQVALQR
NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT
VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK
>Skud_12.150
MSNFKNFTLNSFEDFYGKASETPKIEEEKLEAMNTNASSLKKVHKNKKVISKYDQKNVFR
NSMTALAQVPPSKSVKIIEQNIEFSNPKSFDLLQATHTICFNKKNGTKDTKINMEAQTSS
DIDNDMLYVEAPADLGGNSNDEAETRQLRKFRWSNNKEKCLCEKLTVIYWALLLNTTKRA
SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWIGDTKTSD
LQEQFNIATVKLYESTENGRIIMGKDKVFREENAGSDGLVQ--EESASVTDENGQVALEK
NLKEDRRESIRNQILALDLGDEDFFQNTMKNLSAIDEPELRQYGVIISELVSMEIDDGKT
VREKLRDVEMSINRLQLDIKEIKELLITLMNK