MUSCLE (3.8) multiple sequence alignment

TPHA0E00170        MSAIFATETSREDIINNIKSLNDSSSLNTESQNNTKIKNKNDTIKLL------------E
Kpol_1043.75       -----------------------MAPTKIEDY---SLNERENIIKNLKS----------N
TBLA0E01700        -----------------------MCPARVSTTTSNTSINGTNINNYNGNPSLKKQKLSME
KAFR0H00160        -----------------------MSPSKVTTP----LKDLNAV----------------E
KLTH0E00902g       -----------------------MSPTKTRNH--------VSA----------------K
Kwal_55.19663      -----------------------MSPSKIRNL--------VSV----------------K
ZYRO0B16456g       -----------------------MSPSKVPVP----ITDTAEV----------------E
AFR292W            -----------------------MSPSKVYQT----------P----------------E
Ecym_4013          -----------------------MSPSKVFQS----------P----------------E
KLLA0A00484g       -----------------------MSPTKTQNS----------A----------------E
SAKL0E15048g       -----------------------MSPSKTYAS----------A----------------E
TDEL0B02120        -----------------------MSPSKMNRS----VTDVSEV----------------E
CAGL0H06633g       ------------------------MPSKSSVS-------GNSV----------------E
KNAG0C06640        ------------------------MPSKSNSA----ATDAISV----------------E
Suva_11.334        -----------------------MSPSKMNAV----AGTTSGV----------------E
YKR097W            -----------------------MSPSKMNAT----VGSTSEV----------------E
Skud_11.337        -----------------------MSPSKMHAT----TGSTSEV----------------E
Smik_11.361        -----------------------MSPSKMNCT----VGSTSEV----------------E
NCAS0A03160        -----------------------MSPIKVSSSKPIDISDSQIV----------------E
NDAI0E05080        -----------------------MSPIKASNT-PIDPTDSNQV----------------E
                                            . .                               :

TPHA0E00170        EFISDNLS-----NHQLINIKRNPPVATLYEDGLK-ENKTTLSSTGALIAYSGVKTGRSP
Kpol_1043.75       SNVKLDNVMKCLYNKDI-TIKRNPPIAELYEDGLK-EDSTTLSSTGALMAYSGVKTGRSP
TBLA0E01700        DQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALK-EPKTVISSSGALIAYSGAKTGRSP
KAFR0H00160        QKIRQELDL----SSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCP
KLTH0E00902g       DHIRQELAL----GEEVVTIRRNAPAALLYEDALK-ENKTTIASSGALIAFSGSKTGRSP
Kwal_55.19663      DRIRKELAL----GEEVVTIRRNAPAALLYEDALK-ENKTRISASGALIAFSGSKTGRSP
ZYRO0B16456g       EQIRKELAL----GSEVVTIRHNAPAATLYEDGLK-EKKTAVVSSGALAAYSGSKTGRSP
AFR292W            EKIRAELGL----SSGVLTIRRNAPAAVLYEDALA-ERKTAISSTGALIAYSGEKTGRSP
Ecym_4013          EKIRSELGL----SSGVLIIRRNAPAALLYEDALL-ERNTAISSTGALIAYSGEKTGRSP
KLLA0A00484g       ENIRAELGL----SAEVVTIRRNAPAALLYEDALK-ERDTAISNAGALIAYSGDKTGRSP
SAKL0E15048g       QRIRNELDL----SDEVVTIRRNAPAALLYEDALK-ERKTTISSSGALIAYSGEKTGRSP
TDEL0B02120        QKIRDELSL----SNEVITIRRNAPAAILYEDALN-EKKTTIASSGALIAYSGDKTGRSP
CAGL0H06633g       ERIRSELGL----SKEVTLIRRNAPAAVLYQDALK-EKKTVISSAGALIAYSGEKTGRSP
KNAG0C06640        QKIRRELNL----SKEVITIRRNAPAAVLYEDALH-ERKTVIASSGALIAYSGEKTGRSP
Suva_11.334        QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGALIAYSGVKTGRSP
YKR097W            QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-ENKTVISSSGALIAYSGVKTGRSP
Skud_11.337        QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGALIAYSGVKTGRSP
Smik_11.361        QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGALIAYSGVKTGRSP
NCAS0A03160        QSIRKELGL----SEDVTTIRRNAPAAVLYEDALH-ERKTVIASSGALIAYSGSKTGRSP
NDAI0E05080        QKIRQELDL----SKDVTTIRRNAPAAILYEDALH-ERNTIISSTGALVAYSGEKTGRSP
                   . :  :       .  :  *..*.. : **:*.*  * .* :  :*** *:** ****.*

TPHA0E00170        KDKRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYR
Kpol_1043.75       KDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYR
TBLA0E01700        KDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYR
KAFR0H00160        KDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYR
KLTH0E00902g       KDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYR
Kwal_55.19663      KDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAGWDPRYR
ZYRO0B16456g       KDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYR
AFR292W            KDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYR
Ecym_4013          KDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYR
KLLA0A00484g       RDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAGWDPRYR
SAKL0E15048g       RDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYR
TDEL0B02120        KDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAGWDPRYR
CAGL0H06633g       KDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYR
KNAG0C06640        KDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYR
Suva_11.334        KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
YKR097W            KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
Skud_11.337        KDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
Smik_11.361        KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
NCAS0A03160        RDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYR
NDAI0E05080        RDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYR
                   .****: *  *  .:******.  .* ** :****: *:* **  :*::**:.***. **

TPHA0E00170        IKIRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVE
Kpol_1043.75       IKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIE
TBLA0E01700        LKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVE
KAFR0H00160        IKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIE
KLTH0E00902g       IKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVE
Kwal_55.19663      IKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIE
ZYRO0B16456g       IKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVE
AFR292W            IKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVE
Ecym_4013          IKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVE
KLLA0A00484g       IKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMTSKTTVE
SAKL0E15048g       IKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVE
TDEL0B02120        IKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMSSKTTVE
CAGL0H06633g       IKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIE
KNAG0C06640        IKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIE
Suva_11.334        IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
YKR097W            IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
Skud_11.337        IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
Smik_11.361        IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
NCAS0A03160        IKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIE
NDAI0E05080        IKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIE
                   :*:*::*.*.***:**.****.*: :**  *..****:**** * **  * .*:**:::*

TPHA0E00170        INFKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLS
Kpol_1043.75       INFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLS
TBLA0E01700        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLS
KAFR0H00160        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLS
KLTH0E00902g       INFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLS
Kwal_55.19663      INFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVTLFFGLS
ZYRO0B16456g       INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLS
AFR292W            INFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLS
Ecym_4013          INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLS
KLLA0A00484g       INFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLS
SAKL0E15048g       INFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLS
TDEL0B02120        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVTLFFGLS
CAGL0H06633g       INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLS
KNAG0C06640        INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLS
Suva_11.334        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLS
YKR097W            INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLS
Skud_11.337        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLS
Smik_11.361        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLS
NCAS0A03160        INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLS
NDAI0E05080        INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLS
                   ***. *** ***********************: *.:******.*:     ***:*****

TPHA0E00170        GTGKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVL
Kpol_1043.75       GTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVL
TBLA0E01700        GTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVL
KAFR0H00160        GTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSIL
KLTH0E00902g       GTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVL
Kwal_55.19663      GTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRFGSVL
ZYRO0B16456g       GTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVL
AFR292W            GTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVL
Ecym_4013          GTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVL
KLLA0A00484g       GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVL
SAKL0E15048g       GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVL
TDEL0B02120        GTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKFGSIL
CAGL0H06633g       GTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVL
KNAG0C06640        GTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVL
Suva_11.334        GTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVL
YKR097W            GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVL
Skud_11.337        GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVL
Smik_11.361        GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVL
NCAS0A03160        GTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSIL
NDAI0E05080        GTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSIL
                   **********  * *********** *************:.*:  ***:*:::*.:*::*

TPHA0E00170        ENCIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLP
Kpol_1043.75       ENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLP
TBLA0E01700        ENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLP
KAFR0H00160        ENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLP
KLTH0E00902g       ENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLP
Kwal_55.19663      ENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCDASGVLP
ZYRO0B16456g       ENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLP
AFR292W            ENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLP
Ecym_4013          ENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLP
KLLA0A00484g       ENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLP
SAKL0E15048g       ENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLP
TDEL0B02120        ENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCDASGVLP
CAGL0H06633g       ENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLP
KNAG0C06640        ENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLP
Suva_11.334        ENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
YKR097W            ENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
Skud_11.337        ENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
Smik_11.361        ENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
NCAS0A03160        ENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLP
NDAI0E05080        ENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLP
                   **  ::  .. * : :  :**********:.* .*:***::  ** *::***********

TPHA0E00170        PVSKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKM
Kpol_1043.75       PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKM
TBLA0E01700        PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKM
KAFR0H00160        PVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKM
KLTH0E00902g       PVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKM
Kwal_55.19663      PVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKM
ZYRO0B16456g       PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKM
AFR292W            PVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKM
Ecym_4013          PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKM
KLLA0A00484g       PVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKM
SAKL0E15048g       PVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKM
TDEL0B02120        PISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKM
CAGL0H06633g       PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKM
KNAG0C06640        PVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKM
Suva_11.334        PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM
YKR097W            PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM
Skud_11.337        PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM
Smik_11.361        PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAAKM
NCAS0A03160        PVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKI
NDAI0E05080        PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKI
                   *::.*:. *************:**** *****:.***:*******:***: ** *** *:

TPHA0E00170        DKHKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPK
Kpol_1043.75       NHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPK
TBLA0E01700        DQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPT
KAFR0H00160        EKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLKVPK
KLTH0E00902g       SQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPR
Kwal_55.19663      SHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPL
ZYRO0B16456g       HQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPA
AFR292W            SQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPK
Ecym_4013          SQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPR
KLLA0A00484g       AEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPK
SAKL0E15048g       AKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPT
TDEL0B02120        SEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTFNLHIPT
CAGL0H06633g       HEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPK
KNAG0C06640        SEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPT
Suva_11.334        SQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPT
YKR097W            SQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPT
Skud_11.337        SHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPT
Smik_11.361        SQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPT
NCAS0A03160        SHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPT
NDAI0E05080        SKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPT
                     : :.*:*:****:* *:  **.**.* *******::*.*:* :  :* ** * *  * 

TPHA0E00170        NA-NGVPSELLNPAGSWTDSSED----YMTAVQRLGKLFNENFKTYEDKATNEVIKAGPV
Kpol_1043.75       NV-ENVPSELLNPSKTWSDPDVT----YSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPA
TBLA0E01700        HV-NGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQ
KAFR0H00160        NV-NNVPTKLLNPSKNWYEGELK----YSGAVKKLSKLFIENFKTYEDKATKEVLAAGPR
KLTH0E00902g       HV-NNVPEHILNPAKNWFEGETK----YKHRVGALAKLFTENFKKYQDRASADVISAGPV
Kwal_55.19663      HV-NNVPSNILNPARSWVGGEAK----YKTKVRTLANLFVENFKKYEANASTEIMCAGPL
ZYRO0B16456g       KV-NGVPDSLLNPAKSWVEGPTK----YNSAVKTLATKFTENFKIYQDQATPDVLAAGPQ
AFR292W            AV-EGVPAELLNPAKNWVEGEGK----YASAVSALASKFTENFKIYQDQATEEVVRAGPQ
Ecym_4013          AV-EGVPSELLNPSRNWVEGEEK----YSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQ
KLLA0A00484g       AVGDKVPASLLNPSKNWAEGEAK----YTSNVKSLANLFVENFKTYQDKATEQVLAAGPQ
SAKL0E15048g       RV-NNVPSELLNPAKNWIEGEAK----YTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQ
TDEL0B02120        KV-NGVPKELLNPSKNWVEGEAK----YNTAVNNLAKLFVENFKIYQDRATPEVLAAGPQ
CAGL0H06633g       AV-EGVPSELLNPARNWSEGEAK----YQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQ
KNAG0C06640        AV-NGVPHELLNPAKNWAQGEAK----YNGAVSNLASLFVENFKIYQDKATPDVLAAGPI
Suva_11.334        KV-NGVPAELLNPAKNWSQGEAK----YKGAVTNLANLFVENFKIYQDRATPDVLAAGPQ
YKR097W            KV-NGVPAELLNPAKNWSQGESK----YRGAVTNLANLFVQNFKIYQDRATPDVLAAGPQ
Skud_11.337        KV-KGVPAELLNPAKNWSQGEAK----YKGSVTNLANLFVENFKIYQDRATPDVLAAGPQ
Smik_11.361        KV-KGVPAELLNPAKNWSQGETK----YKGAVTSLATLFVENFKIYQDRATPDVLAAGPQ
NCAS0A03160        AV-NGVPKEILNPAKNWSEGEAK----YSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQ
NDAI0E05080        NV-NNVPKELLNPAKNWAQGEAK----YNAAVSNLASLFVENFKIYQDKATPEVLAAAPR
                    . . **  :***  .*          *   *  *.  * :**. *: .*: ::: *.* 

TPHA0E00170        L-
Kpol_1043.75       L-
TBLA0E01700        V-
KAFR0H00160        L-
KLTH0E00902g       L-
Kwal_55.19663      L-
ZYRO0B16456g       F-
AFR292W            I-
Ecym_4013          L-
KLLA0A00484g       L-
SAKL0E15048g       L-
TDEL0B02120        V-
CAGL0H06633g       L-
KNAG0C06640        L-
Suva_11.334        F-
YKR097W            FE
Skud_11.337        FE
Smik_11.361        FN
NCAS0A03160        I-
NDAI0E05080        I-
                   . 

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0E00170
MSAIFATETSREDIINNIKSLNDSSSLNTESQNNTKIKNKNDTIKLL------------E
EFISDNLS-----NHQLINIKRNPPVATLYEDGLK-ENKTTLSSTGALIAYSGVKTGRSP
KDKRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYR
IKIRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVE
INFKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLS
GTGKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVL
ENCIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKM
DKHKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPK
NA-NGVPSELLNPAGSWTDSSED----YMTAVQRLGKLFNENFKTYEDKATNEVIKAGPV
L-
>Kpol_1043.75
-----------------------MAPTKIEDY---SLNERENIIKNLKS----------N
SNVKLDNVMKCLYNKDI-TIKRNPPIAELYEDGLK-EDSTTLSSTGALMAYSGVKTGRSP
KDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYR
IKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIE
INFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLS
GTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVL
ENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKM
NHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPK
NV-ENVPSELLNPSKTWSDPDVT----YSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPA
L-
>TBLA0E01700
-----------------------MCPARVSTTTSNTSINGTNINNYNGNPSLKKQKLSME
DQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALK-EPKTVISSSGALIAYSGAKTGRSP
KDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYR
LKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLS
GTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVL
ENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKM
DQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPT
HV-NGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQ
V-
>KAFR0H00160
-----------------------MSPSKVTTP----LKDLNAV----------------E
QKIRQELDL----SSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCP
KDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSIL
ENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLP
PVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKM
EKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLKVPK
NV-NNVPTKLLNPSKNWYEGELK----YSGAVKKLSKLFIENFKTYEDKATKEVLAAGPR
L-
>KLTH0E00902g
-----------------------MSPTKTRNH--------VSA----------------K
DHIRQELAL----GEEVVTIRRNAPAALLYEDALK-ENKTTIASSGALIAFSGSKTGRSP
KDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYR
IKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVE
INFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLS
GTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVL
ENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLP
PVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKM
SQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPR
HV-NNVPEHILNPAKNWFEGETK----YKHRVGALAKLFTENFKKYQDRASADVISAGPV
L-
>Kwal_55.19663
-----------------------MSPSKIRNL--------VSV----------------K
DRIRKELAL----GEEVVTIRRNAPAALLYEDALK-ENKTRISASGALIAFSGSKTGRSP
KDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAGWDPRYR
IKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIE
INFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVTLFFGLS
GTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRFGSVL
ENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKM
SHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPL
HV-NNVPSNILNPARSWVGGEAK----YKTKVRTLANLFVENFKKYEANASTEIMCAGPL
L-
>ZYRO0B16456g
-----------------------MSPSKVPVP----ITDTAEV----------------E
EQIRKELAL----GSEVVTIRHNAPAATLYEDGLK-EKKTAVVSSGALAAYSGSKTGRSP
KDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYR
IKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLS
GTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVL
ENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKM
HQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPA
KV-NGVPDSLLNPAKSWVEGPTK----YNSAVKTLATKFTENFKIYQDQATPDVLAAGPQ
F-
>AFR292W
-----------------------MSPSKVYQT----------P----------------E
EKIRAELGL----SSGVLTIRRNAPAAVLYEDALA-ERKTAISSTGALIAYSGEKTGRSP
KDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYR
IKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVE
INFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLS
GTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVL
ENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLP
PVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKM
SQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPK
AV-EGVPAELLNPAKNWVEGEGK----YASAVSALASKFTENFKIYQDQATEEVVRAGPQ
I-
>Ecym_4013
-----------------------MSPSKVFQS----------P----------------E
EKIRSELGL----SSGVLIIRRNAPAALLYEDALL-ERNTAISSTGALIAYSGEKTGRSP
KDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYR
IKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVE
INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLS
GTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVL
ENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKM
SQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPR
AV-EGVPSELLNPSRNWVEGEEK----YSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQ
L-
>KLLA0A00484g
-----------------------MSPTKTQNS----------A----------------E
ENIRAELGL----SAEVVTIRRNAPAALLYEDALK-ERDTAISNAGALIAYSGDKTGRSP
RDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAGWDPRYR
IKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMTSKTTVE
INFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVL
ENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLP
PVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKM
AEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPK
AVGDKVPASLLNPSKNWAEGEAK----YTSNVKSLANLFVENFKTYQDKATEQVLAAGPQ
L-
>SAKL0E15048g
-----------------------MSPSKTYAS----------A----------------E
QRIRNELDL----SDEVVTIRRNAPAALLYEDALK-ERKTTISSSGALIAYSGEKTGRSP
RDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYR
IKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVE
INFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVL
ENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLP
PVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKM
AKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPT
RV-NNVPSELLNPAKNWIEGEAK----YTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQ
L-
>TDEL0B02120
-----------------------MSPSKMNRS----VTDVSEV----------------E
QKIRDELSL----SNEVITIRRNAPAAILYEDALN-EKKTTIASSGALIAYSGDKTGRSP
KDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAGWDPRYR
IKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMSSKTTVE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVTLFFGLS
GTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKFGSIL
ENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCDASGVLP
PISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKM
SEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTFNLHIPT
KV-NGVPKELLNPSKNWVEGEAK----YNTAVNNLAKLFVENFKIYQDRATPEVLAAGPQ
V-
>CAGL0H06633g
------------------------MPSKSSVS-------GNSV----------------E
ERIRSELGL----SKEVTLIRRNAPAAVLYQDALK-EKKTVISSAGALIAYSGEKTGRSP
KDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIE
INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVL
ENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKM
HEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPK
AV-EGVPSELLNPARNWSEGEAK----YQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQ
L-
>KNAG0C06640
------------------------MPSKSNSA----ATDAISV----------------E
QKIRRELNL----SKEVITIRRNAPAAVLYEDALH-ERKTVIASSGALIAYSGEKTGRSP
KDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIE
INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVL
ENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLP
PVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKM
SEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPT
AV-NGVPHELLNPAKNWAQGEAK----YNGAVSNLASLFVENFKIYQDKATPDVLAAGPI
L-
>Suva_11.334
-----------------------MSPSKMNAV----AGTTSGV----------------E
QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGALIAYSGVKTGRSP
KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVL
ENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM
SQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPT
KV-NGVPAELLNPAKNWSQGEAK----YKGAVTNLANLFVENFKIYQDRATPDVLAAGPQ
F-
>YKR097W
-----------------------MSPSKMNAT----VGSTSEV----------------E
QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-ENKTVISSSGALIAYSGVKTGRSP
KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVL
ENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM
SQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPT
KV-NGVPAELLNPAKNWSQGESK----YRGAVTNLANLFVQNFKIYQDRATPDVLAAGPQ
FE
>Skud_11.337
-----------------------MSPSKMHAT----TGSTSEV----------------E
QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGALIAYSGVKTGRSP
KDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVL
ENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM
SHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPT
KV-KGVPAELLNPAKNWSQGEAK----YKGSVTNLANLFVENFKIYQDRATPDVLAAGPQ
FE
>Smik_11.361
-----------------------MSPSKMNCT----VGSTSEV----------------E
QKIRQELAL----SDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGALIAYSGVKTGRSP
KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR
IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVL
ENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAAKM
SQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPT
KV-KGVPAELLNPAKNWSQGETK----YKGAVTSLATLFVENFKIYQDRATPDVLAAGPQ
FN
>NCAS0A03160
-----------------------MSPIKVSSSKPIDISDSQIV----------------E
QSIRKELGL----SEDVTTIRRNAPAAVLYEDALH-ERKTVIASSGALIAYSGSKTGRSP
RDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYR
IKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIE
INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSIL
ENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKI
SHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPT
AV-NGVPKEILNPAKNWSEGEAK----YSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQ
I-
>NDAI0E05080
-----------------------MSPIKASNT-PIDPTDSNQV----------------E
QKIRQELDL----SKDVTTIRRNAPAAILYEDALH-ERNTIISSTGALVAYSGEKTGRSP
RDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYR
IKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIE
INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLS
GTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSIL
ENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLP
PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKI
SKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPT
NV-NNVPKELLNPAKNWAQGEAK----YNAAVSNLASLFVENFKIYQDKATPEVLAAAPR
I-