MUSCLE (3.8) multiple sequence alignment

KAFR0H00240       --------------------MSTHIATNDDPSSINTSMEKNYIE--LKNTKVSSSDGEHK
TBLA0A09120       -----------------MFNLKKNKSTESFETENEQVNDVTTIDVTDNNQNVVQMVNGGG
KLLA0E12915g      MSAAEKDFLTDDKISDDIINNNNNNNNNNNNNSQALNVDSTVSS--DDEFTGEKKDEKFK
ZYRO0G06688g      -------------------------MNSASPSITGPEKNKVIIE--DKSLEVSGSHERGE
TDEL0B02230       -------------------MKRTETSSTDGVDSVEKQKAVEVVD--DKLVEVISSHNGLE
Kpol_529.28       ------------------MSDSLTRRTSGELEDDSFASHIDSKQ--DHEVKIVSKFDSTS
NCAS0A03220       -----------------MFFHREHEKDGADVVTEKETVDISEKA--QEKTQEITLKETTG
CAGL0G02453g      -------------------MLNRFSKRNDEKNAVEVQKDVSSID--DNSSKEVYEIEDQE
SAKL0E14828g      -----------------------MSTIKNLWNKTETEVVVTSSP--ENSVEKIARPESFV
NDAI0E05020       --------------MTRDVQSINTPEIRDIVLKDEKIEEITTTK--KETNATTSSTEEKL
KNAG0C06570       -------------------MTLRQVNTFSEDDSLDKKNDLVLTK---ENSHTIEEDSRIV
Suva_11.329       --------------------MLNHLSQGSDDIQDEKQGEFPVVE--EEKNQTVTLKDSYV
Skud_11.331       ------------------------------------------------------------
Smik_11.356       --------------------MLNHPSRSSDEVQDEKQGDFPVIE--EEKTHAVTLKDSYV
YKR093W           --------------------MLNHPSQGSDDAQDEKQGDFPVIE--EEKTQAVTLKDSYV
                                                                              

KAFR0H00240       --------------DTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRC
TBLA0A09120       -DIDYIPTQDEKRDQKFETFQEDSSIINDENEVITEDFEEPTEEELRTLKHVGGKIPLRC
KLLA0E12915g      NNTDIKVYISKDHHASSDKIDFIGAVDEDDNQ--NENGREPTEEELSTLRHVSERIPFTC
ZYRO0G06688g      --------------LDFDEYE-------------VPNDDEPTEEELRSLRHVGGHIPFRC
TDEL0B02230       ----------------VESYD-----------------DEPTEEEMKTLKHVAGTIPFRC
Kpol_529.28       -------------LQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRC
NCAS0A03220       --------SSEEVHDELETYH----IHHDEEC--EPGYEIPTEEDMETLRHVSGKIPLRC
CAGL0G02453g      -----------IHHLDRDKSNAESNFALGE----DDDFEAPTEEELKTLRHVAGHIPLRC
SAKL0E14828g      --------------DVLDKNQYINAD--------SDHGREPTDEEMKTLRHVSEQIPVRC
NDAI0E05020       --------HDVETYNLSNSANDSTNDFDDDEM--EEGYEEPTDEELNTLKRVGGKIPLRC
KNAG0C06570       -------------DDLASQYEDDI----------PEGYEVPTEEELRTLKHVGGHIPMRC
Suva_11.329       ---------SDDAANSTERFNLSPSPE-------DNEFEAPTDEELRSLRHVGGKIPMRC
Skud_11.331       ------------------------------------------------------------
Smik_11.356       ---------SDDVANSTEQYNLSHSPE-------DEDFEAPTEEETKTLRHVGGKIPMRC
YKR093W           ---------SDDVANSTERYNLSPSPE-------DEDFEGPTEEEMQTLRHVGGKIPMRC
                                                                              

KAFR0H00240       FLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPI
TBLA0A09120       WLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPV
KLLA0E12915g      WLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPL
ZYRO0G06688g      WLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPV
TDEL0B02230       WLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPI
Kpol_529.28       WLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPI
NCAS0A03220       WLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPV
CAGL0G02453g      WLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPV
SAKL0E14828g      WLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPL
NDAI0E05020       WLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPV
KNAG0C06570       WLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPI
Suva_11.329       WLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPV
Skud_11.331       ------------------------------------------------------------
Smik_11.356       WLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPV
YKR093W           WLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPV
                                                                              

KAFR0H00240       FGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFATG
TBLA0A09120       FAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATG
KLLA0E12915g      LGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTG
ZYRO0G06688g      FGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATG
TDEL0B02230       FGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIILIGIATG
Kpol_529.28       FGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATG
NCAS0A03220       FGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGIATG
CAGL0G02453g      FGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGFIAAIILIGIATG
SAKL0E14828g      LGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATG
NDAI0E05020       FGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTG
KNAG0C06570       FGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATG
Suva_11.329       FGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATG
Skud_11.331       ------------------------------------------------------------
Smik_11.356       FGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATG
YKR093W           FGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATG
                                                                              

KAFR0H00240       LIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATT
TBLA0A09120       MIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATT
KLLA0E12915g      FIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATT
ZYRO0G06688g      MIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATT
TDEL0B02230       MIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATT
Kpol_529.28       MIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATT
NCAS0A03220       MIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATT
CAGL0G02453g      MIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATT
SAKL0E14828g      MIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATT
NDAI0E05020       FIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATT
KNAG0C06570       MIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATS
Suva_11.329       MIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATT
Skud_11.331       MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT
Smik_11.356       MIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT
YKR093W           MIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT
                  :**:*:**:**:*:*  .  :   * * .*: * ::* **:** **: :*:**:*::**:

KAFR0H00240       ELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDI
TBLA0A09120       ELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNP
KLLA0E12915g      HLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNL
ZYRO0G06688g      ELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDY
TDEL0B02230       ELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNF
Kpol_529.28       ELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNF
NCAS0A03220       ELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDL
CAGL0G02453g      ELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNA
SAKL0E14828g      EMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRF
NDAI0E05020       ELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDY
KNAG0C06570       ELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNF
Suva_11.329       ELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF
Skud_11.331       ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF
Smik_11.356       ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDF
YKR093W           ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF
                   :*   .****:**.****::.:  :  *.. *:     :. : ..*.:      : :  

KAFR0H00240       TSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLH
TBLA0A09120       DSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELH
KLLA0E12915g      NRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELH
ZYRO0G06688g      EAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLH
TDEL0B02230       EAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELH
Kpol_529.28       DAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELH
NCAS0A03220       TSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELH
CAGL0G02453g      EAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELH
SAKL0E14828g      DAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELH
NDAI0E05020       NAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELH
KNAG0C06570       DAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELH
Suva_11.329       NAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH
Skud_11.331       NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH
Smik_11.356       NAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH
YKR093W           NAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH
                      *:  *   :** * *::*  *:: ***** ***:**  ** * . *:: .. *:**

KAFR0H00240       GLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQ
TBLA0A09120       GLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQ
KLLA0E12915g      GLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQ
ZYRO0G06688g      GLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQ
TDEL0B02230       GLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQ
Kpol_529.28       NLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQ
NCAS0A03220       GLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQ
CAGL0G02453g      NLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQ
SAKL0E14828g      GLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQ
NDAI0E05020       GIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQ
KNAG0C06570       GLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQ
Suva_11.329       GIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
Skud_11.331       GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
Smik_11.356       GIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ
YKR093W           GIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ
                  .:***::* ::*:::*:***: *   **::*.:**:.*:*.*  **     .* ::.***

KAFR0H00240       HFIYSTGPNYNRPLEL------GANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPA
TBLA0A09120       HFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPA
KLLA0E12915g      HFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPA
ZYRO0G06688g      HFIYKTGPCYDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPT
TDEL0B02230       HFIYKSGPWYKYPMAE-----NTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPV
Kpol_529.28       SFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPA
NCAS0A03220       SFIYKAGPYYDHPLNG-----GGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPM
CAGL0G02453g      HFIYTKGPWYDHPLDH-----DTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPE
SAKL0E14828g      HFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPV
NDAI0E05020       HFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPP
KNAG0C06570       SYIYKAGPHYKWPLEH-----DGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPA
Suva_11.329       SFVYKAGPWYSEPLGH-----NTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
Skud_11.331       SFIYKAGPWYDEPLGH-----NTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
Smik_11.356       SFVYKAGPWYNEPLGH-----NTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
YKR093W           SFVYKAGPWYNEPLGH-----NTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
                   ::*. .* *  *          .* :*:  *:*** ::::***:**:********:** 

KAFR0H00240       NMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNK
TBLA0A09120       SMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYND
KLLA0E12915g      TMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNK
ZYRO0G06688g      SMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLND
TDEL0B02230       TMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYND
Kpol_529.28       SMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNN
NCAS0A03220       SMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYND
CAGL0G02453g      SMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLND
SAKL0E14828g      SMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYND
NDAI0E05020       SMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNA
KNAG0C06570       SMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYND
Suva_11.329       NMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
Skud_11.331       SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND
Smik_11.356       SMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
YKR093W           SMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
                  .*.:*:*::**. .* *: :* *:*..  :*.: * : .*. :.   * :**  :   * 

KAFR0H00240       IEDEMNALDFTDSEED---EILIRRAEDEDVAS-----------------LKA-------
TBLA0A09120       MEEELNNLDFEEGDDM----LETKHAGDIEMIQ-PISS------------RRSSLKSNEL
KLLA0E12915g      DEEALNALDYKTEEQEQMLSGVGVTGEGAALY--SVSS------------VRSRVQQQQK
ZYRO0G06688g      TEEEMNAMDYEENQEK-IDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRHDGELGEE
TDEL0B02230       TEEAMNALDYDEDPTM-----LKHSKDGIE----ECAD------------FSKA------
Kpol_529.28       TEDAMNDIDFMDDDDDKIMP-TAGEKTSIEVME-PITS------------FRSIKSL---
NCAS0A03220       TEEEMNAMDYEDEEDL--REMESAGANDLELNSTQSLT------------QRRTGESSEE
CAGL0G02453g      EEEAMNALDYEHDEFM-----YKHHSDDEEAAE-HVRS------------IKSEKS----
SAKL0E14828g      TEEAMNAIDYEEDDVL---NYGVSIHYDLE----PIAS------------VNSDKRIT--
NDAI0E05020       TEEEMNAMDYDAEIDEQSKRHLSSGADDLEILPGPDNN------------NWRTSSLSHS
KNAG0C06570       IEEEMNAMDYEVDATM-----LKKVPIETDTVALEKGS------------SESVVSL---
Suva_11.329       TEEEMNAMDYEEEDEFDLNPISQPKANDIEILE-PMGS------------LKSTTKY---
Skud_11.331       TEEEMNAMDYEEEDEFDLNPISAPKANDIEILE-PMES------------LRSTAKY---
Smik_11.356       TEEEMNAMDYEEDDEFDLNSISAPKANDIEILE-PTES------------LRSTAKYS--
YKR093W           TEEEMNAMDYEEEDEFDLNPISAPKANDIEILE-PMES------------LRSTTKY---
                   *: :* :*:                                                  

KAFR0H00240       ------------
TBLA0A09120       VDEGSIHSTNRS
KLLA0E12915g      QQNLEHQLSRSA
ZYRO0G06688g      GELSPYMSPKSL
TDEL0B02230       ------------
Kpol_529.28       ------------
NCAS0A03220       KNI---------
CAGL0G02453g      ------------
SAKL0E14828g      ------------
NDAI0E05020       DM----------
KNAG0C06570       ------------
Suva_11.329       ------------
Skud_11.331       ------------
Smik_11.356       ------------
YKR093W           ------------
                              

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0H00240
--------------------MSTHIATNDDPSSINTSMEKNYIE--LKNTKVSSSDGEHK
--------------DTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRC
FLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPI
FGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFATG
LIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATT
ELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDI
TSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLH
GLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQ
HFIYSTGPNYNRPLEL------GANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPA
NMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNK
IEDEMNALDFTDSEED---EILIRRAEDEDVAS-----------------LKA-------
------------
>TBLA0A09120
-----------------MFNLKKNKSTESFETENEQVNDVTTIDVTDNNQNVVQMVNGGG
-DIDYIPTQDEKRDQKFETFQEDSSIINDENEVITEDFEEPTEEELRTLKHVGGKIPLRC
WLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPV
FAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATG
MIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATT
ELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNP
DSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELH
GLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQ
HFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPA
SMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYND
MEEELNNLDFEEGDDM----LETKHAGDIEMIQ-PISS------------RRSSLKSNEL
VDEGSIHSTNRS
>KLLA0E12915g
MSAAEKDFLTDDKISDDIINNNNNNNNNNNNNSQALNVDSTVSS--DDEFTGEKKDEKFK
NNTDIKVYISKDHHASSDKIDFIGAVDEDDNQ--NENGREPTEEELSTLRHVSERIPFTC
WLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPL
LGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTG
FIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATT
HLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNL
NRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELH
GLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQ
HFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPA
TMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNK
DEEALNALDYKTEEQEQMLSGVGVTGEGAALY--SVSS------------VRSRVQQQQK
QQNLEHQLSRSA
>ZYRO0G06688g
-------------------------MNSASPSITGPEKNKVIIE--DKSLEVSGSHERGE
--------------LDFDEYE-------------VPNDDEPTEEELRSLRHVGGHIPFRC
WLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPV
FGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATG
MIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATT
ELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDY
EAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLH
GLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQ
HFIYKTGPCYDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPT
SMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLND
TEEEMNAMDYEENQEK-IDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRHDGELGEE
GELSPYMSPKSL
>TDEL0B02230
-------------------MKRTETSSTDGVDSVEKQKAVEVVD--DKLVEVISSHNGLE
----------------VESYD-----------------DEPTEEEMKTLKHVAGTIPFRC
WLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPI
FGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIILIGIATG
MIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATT
ELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNF
EAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELH
GLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQ
HFIYKSGPWYKYPMAE-----NTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPV
TMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYND
TEEAMNALDYDEDPTM-----LKHSKDGIE----ECAD------------FSKA------
------------
>Kpol_529.28
------------------MSDSLTRRTSGELEDDSFASHIDSKQ--DHEVKIVSKFDSTS
-------------LQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRC
WLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPI
FGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATG
MIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATT
ELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNF
DAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELH
NLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQ
SFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPA
SMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNN
TEDAMNDIDFMDDDDDKIMP-TAGEKTSIEVME-PITS------------FRSIKSL---
------------
>NCAS0A03220
-----------------MFFHREHEKDGADVVTEKETVDISEKA--QEKTQEITLKETTG
--------SSEEVHDELETYH----IHHDEEC--EPGYEIPTEEDMETLRHVSGKIPLRC
WLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPV
FGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGIATG
MIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATT
ELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDL
TSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELH
GLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQ
SFIYKAGPYYDHPLNG-----GGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPM
SMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYND
TEEEMNAMDYEDEEDL--REMESAGANDLELNSTQSLT------------QRRTGESSEE
KNI---------
>CAGL0G02453g
-------------------MLNRFSKRNDEKNAVEVQKDVSSID--DNSSKEVYEIEDQE
-----------IHHLDRDKSNAESNFALGE----DDDFEAPTEEELKTLRHVAGHIPLRC
WLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPV
FGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGFIAAIILIGIATG
MIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATT
ELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNA
EAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELH
NLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQ
HFIYTKGPWYDHPLDH-----DTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPE
SMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLND
EEEAMNALDYEHDEFM-----YKHHSDDEEAAE-HVRS------------IKSEKS----
------------
>SAKL0E14828g
-----------------------MSTIKNLWNKTETEVVVTSSP--ENSVEKIARPESFV
--------------DVLDKNQYINAD--------SDHGREPTDEEMKTLRHVSEQIPVRC
WLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPL
LGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATG
MIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATT
EMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRF
DAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELH
GLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQ
HFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPV
SMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYND
TEEAMNAIDYEEDDVL---NYGVSIHYDLE----PIAS------------VNSDKRIT--
------------
>NDAI0E05020
--------------MTRDVQSINTPEIRDIVLKDEKIEEITTTK--KETNATTSSTEEKL
--------HDVETYNLSNSANDSTNDFDDDEM--EEGYEEPTDEELNTLKRVGGKIPLRC
WLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPV
FGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTG
FIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATT
ELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDY
NAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELH
GIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQ
HFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPP
SMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNA
TEEEMNAMDYDAEIDEQSKRHLSSGADDLEILPGPDNN------------NWRTSSLSHS
DM----------
>KNAG0C06570
-------------------MTLRQVNTFSEDDSLDKKNDLVLTK---ENSHTIEEDSRIV
-------------DDLASQYEDDI----------PEGYEVPTEEELRTLKHVGGHIPMRC
WLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPI
FGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATG
MIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATS
ELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNF
DAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELH
GLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQ
SYIYKAGPHYKWPLEH-----DGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPA
SMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYND
IEEEMNAMDYEVDATM-----LKKVPIETDTVALEKGS------------SESVVSL---
------------
>Suva_11.329
--------------------MLNHLSQGSDDIQDEKQGEFPVVE--EEKNQTVTLKDSYV
---------SDDAANSTERFNLSPSPE-------DNEFEAPTDEELRSLRHVGGKIPMRC
WLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPV
FGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATG
MIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATT
ELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF
NAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH
GIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
SFVYKAGPWYSEPLGH-----NTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
NMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
TEEEMNAMDYEEEDEFDLNPISQPKANDIEILE-PMGS------------LKSTTKY---
------------
>Skud_11.331
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT
ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF
NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH
GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
SFIYKAGPWYDEPLGH-----NTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND
TEEEMNAMDYEEEDEFDLNPISAPKANDIEILE-PMES------------LRSTAKY---
------------
>Smik_11.356
--------------------MLNHPSRSSDEVQDEKQGDFPVIE--EEKTHAVTLKDSYV
---------SDDVANSTEQYNLSHSPE-------DEDFEAPTEEETKTLRHVGGKIPMRC
WLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPV
FGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATG
MIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT
ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDF
NAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH
GIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ
SFVYKAGPWYNEPLGH-----NTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
SMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
TEEEMNAMDYEEDDEFDLNSISAPKANDIEILE-PTES------------LRSTAKYS--
------------
>YKR093W
--------------------MLNHPSQGSDDAQDEKQGDFPVIE--EEKTQAVTLKDSYV
---------SDDVANSTERYNLSPSPE-------DEDFEGPTEEEMQTLRHVGGKIPMRC
WLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPV
FGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATG
MIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT
ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF
NAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH
GIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ
SFVYKAGPWYNEPLGH-----NTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
SMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
TEEEMNAMDYEEEDEFDLNPISAPKANDIEILE-PMES------------LRSTTKY---
------------