MUSCLE (3.8) multiple sequence alignment

NDAI0D00100      ----------------------MVAISQLLVFFLVVRTVLAVTIRNGI-------IDSPL
NCAS0B00320      MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATYTDINLSEFSAMVEPM
                                         ::..:*  :  : :.  .:  ..*       : .*:

NDAI0D00100      P----RDNTTLVDALNLMR--CAQVWGMPN--DTIVATDRTETLILF---------NNRT
NCAS0B00320      PMYTVRVSEQLVQAVASVERTYTTPFSLPTPYTTTIGDGTLSEVISYISTNVNGNAETRT
                 *    * .  **:*:  :    :  :.:*.   * :. .  . :* :         :.**

NDAI0D00100      TTNT---------THMKEIANHCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRN---
NCAS0B00320      TTSTLPPPFSLPEPYTTTVVNDG-TTISEVISFISTNINGSPATETSISVIPPPYSQPTA
                 **.*         .: . :.*   : :. .::*   * :  *.  * *..:  .  :   

NDAI0D00100      ------WD---------LLPTFARNEL--------IAETQRGPTSTSTFISHKDTSEYYF
NCAS0B00320      YNTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDRTHTFTATEIDIETSTTTVT
                       :*         : *. * * *        :  .:*  * *:* *. : ::    

NDAI0D00100      MVMAVLFLVIIYSLLMRATAKSVPSMATK-
NCAS0B00320      DAAATTYRTVWTTTTAAVTVKAQTTITVYV
                  . *. : .:  :    .*.*: .:::.  

FASTA FORMAT for MUSCLE Version 3.6

>NDAI0D00100
----------------------MVAISQLLVFFLVVRTVLAVTIRNGI-------IDSPL
P----RDNTTLVDALNLMR--CAQVWGMPN--DTIVATDRTETLILF---------NNRT
TTNT---------THMKEIANHCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRN---
------WD---------LLPTFARNEL--------IAETQRGPTSTSTFISHKDTSEYYF
MVMAVLFLVIIYSLLMRATAKSVPSMATK-
>NCAS0B00320
MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATYTDINLSEFSAMVEPM
PMYTVRVSEQLVQAVASVERTYTTPFSLPTPYTTTIGDGTLSEVISYISTNVNGNAETRT
TTSTLPPPFSLPEPYTTTVVNDG-TTISEVISFISTNINGSPATETSISVIPPPYSQPTA
YNTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDRTHTFTATEIDIETSTTTVT
DAAATTYRTVWTTTTAAVTVKAQTTITVYV