MUSCLE (3.8) multiple sequence alignment

KLLA0F01661g      -------------MLLFNTEDLKAIFQEVSLNP-----SDRLVC--NNSNTIYLWQ--DN
CAGL0J05214g      -------------MSIPNILKNSEAFTG--------NAAQRFLFSSSDGTKIVSIAD-RG
AEL168C           -----------------MTGELHPIFNADALGA----SHRLHAHTHGDGTKIVGYY--NK
Ecym_6290         -----------------MTGDPHPIFQVPPFRT----LSKLHVHVCKNATQIVTCF--DK
TBLA0F01310       -----MTTSIESTYLEGHNPTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQ--DG
Kpol_1035.24      -----------------MSFELNPIFKRPSVSR---ELTKRFFFSANNGTRIILFQ--DS
TPHA0O01460       ----------------MVSPQLHTIFNRFSVGK---VSSKRSSITVDNGLKIILYQ--NN
SAKL0D06930g      -----------------MSAEDHPIFQNISVGK---ESYPKKLLTTQDGCRVVVIQ--GD
KLTH0H10692g      -----------------MLPEAHPIFQARSLGE---SRSERLCLHTKDLSRTILLE--GN
Kwal_14.2580      -----------------MIPESHPIFDTKTNSS---GKSRRFVFNIGIASKYGVLQ--GN
KNAG0C05840       MNFSACVTSSVGDGSVSQLMGQRPILQPTAGLPS--DLSSRYVFTTDKGTKYVYLDKTNG
KAFR0A01720       ----MAQSNEVSVSEVSKLLENRPIFKTSLSSSL--LNSERSFSLPILAQDSSIYK--KN
NDAI0G05750       ------------MSDNFSPIASHPIFGTSIITN---EDSQRFFFTSHQGTRMVLLQ--GC
NCAS0A09210       -------------MSNIDSIASHPIFQGLDCTQ---DAAPRFLFTSHHGTRMVVLQ--GG
Smik_10.179       -------------MSQSKSLASLPIFQASLSAS----QSPRYIFTSQNGTRIVFIQ--DN
YJL061W           -------------MSQSSRLSALPIFQASLSAS----QSPRYIFSSQNGTRIVFIQ--DN
Skud_10.158       -------------MSKSNSLVALPIFQASLSAS----QSPSYIFSSHNGTRVVFIQ--DN
Suva_6.137        -------------MPQSDSLAALPIFQASLSAN----QSPRYIFSSHNGTRLVVIQ--DD
TDEL0D01880       -----------------MTVETHPIFRPSLTAQ---SGSDRFFLTTSDGGRAVVVQ--DS
ZYRO0G20680g      -----------------MSIGSHSIFKRASGSS------KRFLCTSQDGSKVVIYQ--DS
                                           :                                  

KLLA0F01661g      ILRVQSD-HET-QYRSYNVELPFV------PEQMVISPSGGLVAFHANSELYVMEV----
CAGL0J05214g      HLRWCHS-TST-TYKSLDFDL-QFEGK---VEGAVSSTTADYVCIYNRDELHVLEVPWMY
AEL168C           HLRLGRF-TEQ-TYKSWHAE----VDA---KASSILNGSGSLLAFYGDHIIEVVDREGKK
Ecym_6290         NLRYARV-TEH-TFKSKHLD----IKH---SEHSILNNSGTLIAFYGSNDVELFDMDGKK
TBLA0F01310       SIRWCYT-FSQ-NYHSYTIASRNFD-----IKDSLISNSGSFVCYYSDTDISIMEIPWSH
Kpol_1035.24      TIRWSFSSDND-HYQSMALRD--SDMD---VTGAIISDPGDYLCLYNSHQIRVIEIPWGL
TPHA0O01460       TVRYGFVNDADGNFKSITLEK--EMIG---DVSIIADQIGNYLCLFNEFEIRVIELPWKL
SAKL0D06930g      TIRLCSS-GNS-QYQIIECG----INT---VAGAALNNSGTLLCAYNETELQVIVLPSPF
KLTH0H10692g      SLKWCLM-DAP-NYEYMELNA---ISN---YTSAVLNDSGTLLCLNNVDEIQVLALSWDQ
Kwal_14.2580      TLRWCSA-GGH-EYQYLEFEP---RID---YTSVVINESGSLLCLYNSKQVQILAVSWDE
KNAG0C05840       LLRWGSV-SED-EYNSMPLKISNFADK---SVNVILSDSGEFLCVYSKDCVTVIEVPWRY
KAFR0A01720       QLRWGSV-ASS-QYHSLPL---LFFDD-SAYENVIISNSGQFLCLYDKKSLSLIEIPWGY
NDAI0G05750       ILKWCNV-IDT-TYHSMKVKS--IFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGY
NCAS0A09210       LLRWCSV-TAS-SFNSMTIDF--FQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGY
Smik_10.179       IIRWYNVLTDP-CYHSLSLSRHLVLDD---TFHVISSTSGDLLCFFNDQEIFVMEVPWGY
YJL061W           IIRWYNVLTDS-LYHSLNFSRHLVLDD---TFHVISSTSGDLLCLFNDNEIFVMEVPWGY
Skud_10.158       IIRWCNSLTES-SYQSLDFSRHLILDD---TFRVISSASGDLLGFFNVQEIFVMEVPWGY
Suva_6.137        IIRWCSLLTDP-SYHSLNFSRHLVLDD---TFHAISSASGDLLCFYSDQEIFVMEIPWGY
TDEL0D01880       CIRWCNV-SEP-GYHSMTLER--AFKD---VKHVVMSNSGEFLCLYNDDELRIIEVPWAY
ZYRO0G20680g      SIRWCNA-FDS-KYEFMLLEP--TIED---VEHVVLSPTGTLLLLYNSREVRIVEIPWGY
                   :.          :                      .  .  :       : :.      

KLLA0F01661g      ---------NEQSRLRKHFN----------TSLGIKKLLWHPLATYGLSFVILHDDSTIR
CAGL0J05214g      SGEEN----GLKHLCHIYSHKFD-------ENHSIKQVLFHPKSYLDSTILVLTNDDSIF
AEL168C           ITLT--------------------------VNGGIKQVLWHPLAYLDSCLVVLTGQETIE
Ecym_6290         SCLR--------------------------VELGIKQVLWHPLAYLDSCLVVLTKENTIE
TBLA0F01310       SNSVNA---SSSHCIQKYRYSFKK------YSLTVKQVLFHPLATLESCLVVLLSDDTIV
Kpol_1035.24      TNVDEISN-SMASSLQERVYNFNE------DKLSVKQVLFHPLSKSSPFLVVLFSGSQIA
TPHA0O01460       WDAKEDSSFQLDNMVQIRSYDLKS------FGTTIQKILFHPLGLAYPCLVVLLKNSNIC
SAKL0D06930g      VS-------SHGGILKPHTYNIT-------VKSPIKQVQWHPRGKLDSVPVVLHKDDTIA
KLTH0H10692g      TRPE--------------SYRIK-------VPAGVKQVLWHPRGRLDSCLTVLNKRDEIL
Kwal_14.2580      SKSD--------------TILIS-------PPAGIKQALWHPRGRLGSCLAVLTTQDEIC
KNAG0C05840       RNPE-----EMSYVFQTSFKEIR-------KDSFIKKVLFHPRAIKKTCMVILFEDDTIY
KAFR0A01720       DGAVT----SIKSSFQRVFRDVN-------KSSDIKKILFHPKAADDGCVVILFENDVIC
NDAI0G05750       EKIPD----ELLSKFQPFHYDISSSTSALSSPSDIKQVLFHPKSYHETCLVILYEDSIIQ
NCAS0A09210       VTPSP----SMVSKFQLFSYNNKDDD----GYSPIKQVLFHPEAYKDSCLVVLYDNGTIS
Smik_10.179       SNVENI---SIQDAFQVFHYSVDETE--LGPKSLIKKVLFHPKSYHDSCIVVLKENDTII
YJL061W           SNVEDV---SIQDAFQIFHYSIDEEE--VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTIT
Skud_10.158       NNIEEA---SVQDAFQLFHYSVGQVE--NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTIT
Suva_6.137        LNLGDV---SIQDAFQVFHYSVDELE--LGSNSPIKKVLFHPKSYNDSCIVVLKNDDTIT
TDEL0D01880       TEVS-----SMANAFQLFRFVSD--------EARIKQVLFHPLAYQQETVVILKDDDSIT
ZYRO0G20680g      SQVS-------YEGFQKFRYSVDSR-----QDPLIKKVLFHPLAYREHCIVILKTDNTIH
                                                    :::  :** .       :*     * 

KLLA0F01661g      I---YDLEDLE-PESITVFNRKS-RSFGLSDHVESVCDIAFDP-TGLTLYLLSSFNYCDI
CAGL0J05214g      M---INTDDNRSDKNMINLNSKN-SALGLYDRINDIQKIIFSQ-DGLSLLILSAEEGCDI
AEL168C           I---YELNEPRYEKPTLVLNEPT-SQLGISSRVIDITNIAFAP-DGLSLYLFSTSEGGDV
Ecym_6290         L---YELAKANFMYPTVVLNEKL-PQLGISSHVSEICSMAFSP-DGLTLYLLSLEEGGDV
TBLA0F01310       FIDFSKSFDLL--SSDYILNKKS-KSIGLSSQISDIQSLTFSQ-DGLTLYALSSSAATDV
Kpol_1035.24      FVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQYVVFAD-DCLSLYSLTDT---DV
TPHA0O01460       SIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIIDISFSS-DKLSLYALTET---DI
SAKL0D06930g      M---YELYNEDFQQPTAVLNTMQ-NQLGVTSHITDIESMCFSK-DGLALYLLNSSEGGDV
KLTH0H10692g      L---YELLSEDFSAPTTVLNAST-NELGMGSSVKDIESVCFSA-DGLTLYLMSVSEGADV
Kwal_14.2580      L---YELLTEDYTEPTTILNTCT-KELGMGSVVKDITSMSFSS-DGLTLYLLSTSEGADI
KNAG0C05840       L---FDVED----NNKIALNVPS-GNIGIEDRITSIADIEFSQ-DGLTLYVLSAEDCGDV
KAFR0A01720       L---FDLRK----SEKLFLNKTA-NKLGIETRVTDIEDMEFSQ-DGLTLYMLSVTDGGDI
NDAI0G05750       L------IDTTASTETITINQPT-GTLGVETRVIDIESICFDKTTGLILYALSISDGGDI
NCAS0A09210       L------MDVTQITKTITLNKRV-ATFGIDTQITDIESICFSK-DGWTLYALSISDGGDI
Smik_10.179       M---FDILNQQ--EKPIILNKPN-NSFGLDARLNDITDLVFSK-DGLTLYCLNTTEGGDI
YJL061W           M---FDILNSQ--EKPIVLNKPN-NSFGLDARVNDITDLEFSK-DGLTLYCLNTTEGGDI
Skud_10.158       M---FDILNQQ--HKPIVLNKRS-NSFGLDARVNDITDLAFSR-DGLTLYCLNTTEGGDV
Suva_6.137        M---FDILNQQ--EAPIILNKRN-SSFGLDARVNDITDFAFSK-DGLTLYCLNTTEGGDI
TDEL0D01880       IMNWQDFGD----SKPDVLNLSN-GTYSLDSSITDVECITFSQ-DGLTLYVLSVSEGADI
ZYRO0G20680g      LLDRYYPYDKQ--PKLLVLNQHD-GAFGMEGLVTDIESITFSQ-DGLTLYALSVAEGCDI
                                     .       .:   : .:  . *       *  :.     *:

KLLA0F01661g      YAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVE
CAGL0J05214g      FTIYPCLPRRWDISLHE-------------VDTLFAKSLLLYNNMNV------NTTPQE-
AEL168C           HVICPLLPSRIKADRAK-------------WARQWNKATALYSTLTK------DTPDDA-
Ecym_6290         YALHPLLPSRLRIKRSF-------------WESQWYKATALYESIDK------DTPNEK-
TBLA0F01310       YAFYPCLPPSAQFSLEQ-------------LENLVNKSVVQYEELRE------DDPTAL-
Kpol_1035.24      YCFYPCLPPVASLSKNR-------------VDELINKSIVLYENLGI------DADDIV-
TPHA0O01460       YLFYPFLIPTISVTKNE-------------IDQLFQKSIILFENLEN------DSSEAV-
SAKL0D06930g      YALYPFLPSVLVIPEQH-------------LEMCFYKSCINYENLSS------DDSPTV-
KLTH0H10692g      FSIYPCMPSELSITRKA-------------LKYNFNKALLQYQELSE------GDSPEL-
Kwal_14.2580      YSIYPCLPSEMEISGAL-------------LKSVFNKALLQYQDLND------NDSPDL-
KNAG0C05840       YAIYPCLPPILAMSQKE-------------LKSLMNRSVLLYDSLTE------TTPSAV-
KAFR0A01720       YAFYPCLPPKLSLKKSV-------------LEDLFNKSRILYDSLDS------TVSIEV-
NDAI0G05750       YALYPCLPTRLDVSKKE-------------VDLLLQKSIVLYDSLKE------NMSNDV-
NCAS0A09210       YAFYPCLPQQLEVKREK-------------ITSLLHESVLLYESLKL------DTDRDV-
Smik_10.179       FAFYPFLPSALLLNEND-------------LSWILNKSLVMYESLDP------TTDVTV-
YJL061W           FAFYPFLPSVLLLNEKD-------------LNLILNKSLVMYESLDS------TTDVIV-
Skud_10.158       FAFYPLLPPVLLLGEKD-------------LGWILNKSLVMYESLDS------TTDITV-
Suva_6.137        FAFYPFLPSVLSLSEKD-------------LGWILNKSLVMYESLNA------TTDYKV-
TDEL0D01880       YAFYPCLAPRMQFDKQG-------------LDRLMYKSLIQYDVLNV------GTDSEV-
ZYRO0G20680g      YAFYPCLPCSIEIDSHK-------------LDLLMHKSLVQYENLSV------ETPDAT-
                  . : * :                              :   :. :               

KLLA0F01661g      SDYLTLKHDLLKQIQFFDNYKKNDGI--------------------DTFTSKAIRNSVPQ
CAGL0J05214g      ------KRNIVKQLNFMEKIRGQKTAFRNDKK--------------PLILEDAYLNAQPQ
AEL168C           ------KVATIEYLEFVTQLLQAIEKNGSDG---------------ELVIPEHRRRTISQ
Ecym_6290         ------KIAMIEHFDFVSKIYKMIDKDSEFF---------------DVNIPEHKRMVTPR
TBLA0F01310       ------KINIIKQLKFTSDLYKKGKRALEEDTDSKTW---------KYDVPLEYRLIRPQ
Kpol_1035.24      ------RKNVIKQLQLASSLRKKIEEFENANGEVEV----------NVEIDLEFRQTKAQ
TPHA0O01460       ------RRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIY------NIDINTEYRSVNAQ
SAKL0D06930g      ------KRNVIKQLQFVSRLHKQYKSETVDKARNGDL---------VFNIQESYRNAKIQ
KLTH0H10692g      ------KLKATRQLHFMSSLYNQPHDADDSQTNLLQ----------TFHIRKAYRNARAQ
Kwal_14.2580      ------RRKVTKQLQFVSKLQKKNDYKDTESH--------------VVTISKAHRSPRAQ
KNAG0C05840       ------KKGVIKQVEFISQLQNISHGKEEISN--------------VLEIDTIYRLAKPQ
KAFR0A01720       ------RKNVLKQIKFIASLRDSSSDETKNS---------------CLEISNDFRQVKAQ
NDAI0G05750       ------KRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQ
NCAS0A09210       ------KRNVIRQVQFVNKLNGLLTENEKNSNED------------FIEIEQEYRLIRGQ
Smik_10.179       ------KRNIIKQLQFVSKLHENWDSKLN-----------------KVDIDSEYRLVKVQ
YJL061W           ------KRNVIKQLQFVSKLHENWNSRFG-----------------KVDIQKEYRLAKVQ
Skud_10.158       ------KRNIIKQLQLVSKLHENLDSQLG-----------------KVEIDEEYRLVKMQ
Suva_6.137        ------KRNITKQLQFVSKLHKNWDSKLA-----------------KVKIDDEYRLVKMQ
TDEL0D01880       ------KRNTIKQLKFVSGLHKQQNSQR------------------ILEIPEAQRQVRGQ
ZYRO0G20680g      ------KRNTIKQFQFISKLRQGLENDQT-----------------KIDIPMDWLRVRGQ
                        .      . :                                           .

KLLA0F01661g      GPFIIKKFPTALNAKEVTGLTIIPV-GERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSN
CAGL0J05214g      GPFSMTPYPNELYDFMATDINIIQI-TQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRF
AEL168C           GPYNIHGFPEKLYSAVGTKLTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSW-TKDL
Ecym_6290         GPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSW-SRSL
TBLA0F01310       GPFTISPFPDSLYYSSPTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNF
Kpol_1035.24      GYFSISPYPESLYTCTGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDY
TPHA0O01460       GSFSIAPFPEELYKQSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDY
SAKL0D06930g      GPFTINPFAEKLYSATATQITTMPI-DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDS
KLTH0H10692g      GPFTISPFPEKLYLATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGS
Kwal_14.2580      GPFTINPFPDNLYLATGRQVEVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGF
KNAG0C05840       GPFTIAPFPEKLYSATATEICPLNI-GGGNEILCIAYDNGTALFLFKDLELSMAWDVGGI
KAFR0A01720       GPFTVAPYPEKLYEATAKEIYTLDI-GNNNELFAITFDNGTVTLLLKDLELSMSWNADNY
NDAI0G05750       GPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIANY
NCAS0A09210       GPFTIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNY
Smik_10.179       GPFTINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNY
YJL061W           GPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNY
Skud_10.158       GPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNY
Suva_6.137        GPFTINPFPNELYDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNY
TDEL0D01880       GPFTIAPFPKQIYSSTGTGIASLPI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARY
ZYRO0G20680g      GPFTIAPFPDRYYDRTAVQLKILPI-GANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGY
                  * : :  :.             : :      :  :   :..      .    * *     

KLLA0F01661g      TTFNNLSVITMFNAKGQCQLLNSSEPK----------------------------LVFTG
CAGL0J05214g      PGSNSLALLEQIKLEITDNAKFLSIPG-----------------------TYGKFVVTDN
AEL168C           KNAYTLMLVEEFTATGTAFA------------------------------TCDGVAVL-G
Ecym_6290         NNACSFVLIEKFRAGGEIFA------------------------------IESGVAIL-E
TBLA0F01310       NENNSLVLLELIKTKEQNIRKLTTYAH-----------------------QYGTFYIL-G
Kpol_1035.24      SFNNSFTLVEIIKFKPEELSNMVVLQG-----------------------ELGKFVVS-G
TPHA0O01460       TFNNSFILLEKLKFNPDETKSILDIPF-----------------------KNGIFAIA-G
SAKL0D06930g      SSNNSLVVLESLDILSGQIICL----------------------------TPHKFAVL-G
KLTH0H10692g      SEKNSLISVGSLKLPGSISL------------------------------IYGSCFVLIS
Kwal_14.2580      CENNSLIVLGSVNIGGEIAL------------------------------VNGYTFVVLS
KNAG0C05840       YYNNSLVLMEEFDLQTESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQ-Q
KAFR0A01720       VYNNSFVLIESVEMGPESIK-LLKSSS-----------------------LTGQMFISQN
NDAI0G05750       IHDNSFALVELIKLKPTDIGRLIIYQD-----------------------NFGKFFLL-S
NCAS0A09210       VHNNSFSLVELMQLKDTDVKRIVSYPD-----------------------TYGQFFIF-G
Smik_10.179       VYNDSLVLIERVKMQ-KEIESLITLPE-----------------------QMGKLYVF-S
YJL061W           VYNNSLVLIERVKLQ-REIKSLITLPE-----------------------QLGKLYVI-S
Skud_10.158       VHNNSLVLIERIKIQETDIKSLKTLPE-----------------------ELGKLYVF-S
Suva_6.137        VYNNSLILIERIKLQQKEMKSLTALPD-----------------------QLGKLYVT-L
TDEL0D01880       NYNNSFALVELITLGSQEIQQIVVGDH-----------------------KYGQFSVM-T
ZYRO0G20680g      SYNNSLVLVESIRL---ERGELVLKQG-----------------------TLSQFFVLGG
                      .:  :  .                                            :   

KLLA0F01661g      DSSTTIMEM-PWLEPLAQCIRLHDFSIIDDVKFENK---IRTVSGTFLGVL----STLSG
CAGL0J05214g      VKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISC
AEL168C           IDSAQRVEI-PYLQALEDCIRDCNLAALQDINFTSS---ICKIPGKFHSVARFNAPGNKG
Ecym_6290         KNNAHIVRF-PYLKALGECIKEGDIAPMVDVKLTSD---ITPLAGSYHTVVTWNEPSTKG
TBLA0F01310       SVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISS
Kpol_1035.24      EKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST-ITHINSDMQINSCGIWNSGEAKS
TPHA0O01460       DQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESH-KQTINTLEEPNSCILWNEHNKKE
SAKL0D06930g      PKS-FVVDSSEWTKALSECINFSNLEVLSQINIKST---ITPVNGAFTQAGLWESNGEKQ
KLTH0H10692g      AEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEE---ITEKKGTFQSAGLWPESGMQK
Kwal_14.2580      SAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEE---VVEKNGRFCSAIICASSEKSC
KNAG0C05840       SSMIRCVDTKAWSSVVSDCIDRHDINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEG
KAFR0A01720       HSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSK-ISDLDIKENVDCYGVWSLRGERG
NDAI0G05750       DDVIMLVHTNSWSDKLAKAIDDSNLNILSEIGFESE-ITWFDVMGKFNNCTPCKYHGKES
NCAS0A09210       DSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSK-LDFFETTNGITKCSPCKWRGRDV
Smik_10.179       KNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESK-IENIATVEGMPNLAHIYWNNTSN
YJL061W           DNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK-LEDIATIERIPNLAYINWNDQSN
Skud_10.158       ENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESK-LENIVTIEHPSNLAYISWNDTSN
Suva_6.137        ESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSK-FEDIATIHQLSNFAYINWNDKSS
TDEL0D01880       PEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESE-VTFTELKDSPKSVAWWN-TTPQS
ZYRO0G20680g      TSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSE-ISKIEGVSQIDSYAMWKKDTEPK
                        :        :   :   :   :    . .                         

KLLA0F01661g      DILYNGNSFKVIESND--------------KSTTQKPINRTDEVK-YTY-KPSLPT--SG
CAGL0J05214g      NYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKN-GLY-EVKFAR--PL
AEL168C           IILVGDHHAKIVPSTE---A---------AKSDTETELDSQPGKE-PTY-TVCFPN--SL
Ecym_6290         ILFIGNSVIRSIPDDV-------------GLSSFKPRVDPAISQN-GKY-TVCFPS--TM
TBLA0F01310       LLFINKSTVIELNEKP---KLLLSDDTTHLLTSELAQKYIPPLED-KIF-KIELPMGILI
Kpol_1035.24      LLLVDTNVVVGYQLFK-------------KEVEFKPESAEEISTELENFTLDKFTV--PE
TPHA0O01460       LLFITETKLISSDILE---SNNESA----EKLPVPAINDIKKIEK-LQL--KNYSQ--PI
SAKL0D06930g      LIFMSDKSVKSITLPE---P---------NKTKDAVSKTVQPVTE-VKY-EPVFSQ--PI
KLTH0H10692g      IVLLSEKEITSIDISS-------------MQTPASSTTEKIEKSE-TNR-QRPYSQ--PL
Kwal_14.2580      VALLSETTTSHIDIPF---S---------LDAPKMRTALGTAKTD-VEQ-YRPYGQ--PL
KNAG0C05840       VTWITNKSVTCKELKK-------------QVSWKPEQSTSSEKKK-QAFPKPEFSV--PI
KAFR0A01720       ILFVSNSSVISRTLPE---SDSSFVI---KLDEMSRSKNIEDPVT-KKY-EVSFTQ--PI
NDAI0G05750       IIFVSSDNVFVENLTK---KHSMN-----NIKGSSTSNSNEETAE-SEY-KVTFKQ--PI
NCAS0A09210       ILFITKEDVYMHPVEM---RKSGI-----LGNNKPVLVNNEELKH-QEY-KTSFKQ--PV
Smik_10.179       LALASNKELTFQTVSV---DQKMQS----TETETDIGTEESGLAK-CRY-ELRFTQ--PL
YJL061W           LALMSNKTLTFQNISS---DMKPQS----TAAETSISTEKSDTVG-DGF-KMSFTQ--PI
Skud_10.158       LVLTARGKLTFQNISN---DKELQT----TKFDANNKSDRIDAGK--HY-EMSFTQ--PI
Suva_6.137        LALISKEKLTIQNISN---HKKEQSLNAPAELDTNVNSDKSDTGK-RGY-EISFTQ--PI
TDEL0D01880       VVKVSNREVKSKQVSE-------------GVSKQDDDITGSRQEP-EKY-NAHYSQ--PI
ZYRO0G20680g      DVFVSKDTVFVKSTAV-------------NDQPSTVKDEKKANVDIPRY-EVALNQ--PM
                                                                              

KLLA0F01661g      KELDMLLTKYKTEAN-GFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMI
CAGL0J05214g      TEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTL
AEL168C           EEILNTNKELQRRKHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSA
Ecym_6290         EELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSL
TBLA0F01310       SDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSL
Kpol_1035.24      NELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSKIVQGQSL
TPHA0O01460       KEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQEIGSKILQGQTI
SAKL0D06930g      GEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTL
KLTH0H10692g      SEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTL
Kwal_14.2580      NEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTL
KNAG0C05840       SELNALNINYQDTCRIGFHDIISPLDRQKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGL
KAFR0A01720       SEIMNLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSL
NDAI0G05750       DELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTL
NCAS0A09210       EELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEVISKIGQGQNL
Smik_10.179       SEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSL
YJL061W           NEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTL
Skud_10.158       NEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQSL
Suva_6.137        NEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEFLRKIIKAQSL
TDEL0D01880       AEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTL
ZYRO0G20680g      SEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQAL
                   ::                  :        : .   * :*  ..         :  .*  

KLLA0F01661g      LFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKL
CAGL0J05214g      GYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSL
AEL168C           GLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCML
Ecym_6290         GYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKL
TBLA0F01310       GFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIM
Kpol_1035.24      GLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHLEKILLKM
TPHA0O01460       ALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITERNTKLNERTSKL
SAKL0D06930g      GLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKL
KLTH0H10692g      GLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESL
Kwal_14.2580      ALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQI
KNAG0C05840       GMTLYNRLLEQQLELTKQLQCSNKILMKQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSL
KAFR0A01720       GLVLRNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNAL
NDAI0G05750       GFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNL
NCAS0A09210       ALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKRLQDL
Smik_10.179       GVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFSKL
YJL061W           GVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKL
Skud_10.158       GFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKKL
Suva_6.137        GVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQAELMTRFGKL
TDEL0D01880       GVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKF
ZYRO0G20680g      GFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSL
                        .   .   .  ::            .                .   :      :

KLLA0F01661g      KETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLR--
CAGL0J05214g      YDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQI
AEL168C           QSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESL
Ecym_6290         QQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELI
TBLA0F01310       NEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRI
Kpol_1035.24      ESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFLKKELQKI
TPHA0O01460       IEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNNI
SAKL0D06930g      QSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTA
KLTH0H10692g      HRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSLEYV
Kwal_14.2580      SSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYV
KNAG0C05840       QQKLAAIDKTKKSTDLVITDEESVWFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTF
KAFR0A01720       NGNLAKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRI
NDAI0G05750       NEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRI
NCAS0A09210       DAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLKKDLARI
Smik_10.179       TENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELTRI
YJL061W           SKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTRI
Skud_10.158       TENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTRI
Suva_6.137        TENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDLSYLKRELIRI
TDEL0D01880       KDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRI
ZYRO0G20680g      SEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENI
                     .             :   *   * .:. .   **  *       : :  :       

KLLA0F01661g      --STTKGDD---FFSELE-------FSSLQQMLLNDKKVINSCMNELSASIEDLAV----
CAGL0J05214g      ANQKPDI-S---SENGKE-------WNDLQQLLRTDLKIISEFEKKCDTAVNGINQLKI-
AEL168C           PEHRQHDRQ---EEEPFD-------FRRLQELLKLDSKIITECTDNLSAAARELERKLCI
Ecym_6290         ESNHGNI-P---NEELFN-------FEKLQDLLTLDSKMIGDCNDQLLAAAKDLENKLYI
TBLA0F01310       KGENAIV-D---ENDFKQ-------WDRLRDMLHDDATTIETCTESIKNINFDLDRALKK
Kpol_1035.24      IDISRSESS---KGMLNE-------WEELRQILADDAKIIKECNEQLTQISKELDTKNTV
TPHA0O01460       IEQPAQSHDAIIDSDEDE-------WNELCDLLNRDAKIIEDCNAELSSASGLI------
SAKL0D06930g      GERRVS------KEDVFD-------WAELQELLSVDSEIIKECNEGLVEAAKELDEKI--
KLTH0H10692g      RVDSAEAAS---RSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQELDS----
Kwal_14.2580      HVESKEGKS---GSSSADNKDEVP-WDELRALLAKDLRIIGECQDSLQGVAKQLDS----
KNAG0C05840       VSDSQRL-P---GTANTE-------WHSLQEMLKHDSLLLRADKKDKKDASSQVSRRASS
KAFR0A01720       ESKVGQR-S---SHLTSE-------WAEFKKILETDTNIIKECNEELTKAHTQLDAEV--
NDAI0G05750       SNDVTSVVD---EKSKKE-------WEELRAILEQDSKIIKECNIELTKTTESMAGIGSK
NCAS0A09210       SKETSQLRD---EKSDKE-------WDELRDILKHDAQIIQECNKELLSTTEAL------
Smik_10.179       ETETIQV-D---KKSQSE-------WNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ-
YJL061W           EAETIKV-D---KKSQNE-------WDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ-
Skud_10.158       EAETIKT-D---EKTQNE-------WDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQS
Suva_6.137        ESETINA-D---KKSQNE-------WDELRKMLEVDSKIIKECNEELVHVSQQLTTKTQ-
TDEL0D01880       AQVTGDQ-N---SQARDE-------WHELRHMLEEDTIILQDCNNQLKSAARQVPAQP--
ZYRO0G20680g      SLEDKDV-G---EKSKSE-------WTELLSILESDTKIIKECNNQLAHASSEVGFST--
                                           :  :  :*  *   :             .      

KLLA0F01661g      -----
CAGL0J05214g      -----
AEL168C           -----
Ecym_6290         -----
TBLA0F01310       DSLSI
Kpol_1035.24      TNS--
TPHA0O01460       -----
SAKL0D06930g      -----
KLTH0H10692g      -----
Kwal_14.2580      -----
KNAG0C05840       KLFT-
KAFR0A01720       -----
NDAI0G05750       -----
NCAS0A09210       -----
Smik_10.179       -----
YJL061W           -----
Skud_10.158       KN---
Suva_6.137        -----
TDEL0D01880       -----
ZYRO0G20680g      -----
                       

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0F01661g
-------------MLLFNTEDLKAIFQEVSLNP-----SDRLVC--NNSNTIYLWQ--DN
ILRVQSD-HET-QYRSYNVELPFV------PEQMVISPSGGLVAFHANSELYVMEV----
---------NEQSRLRKHFN----------TSLGIKKLLWHPLATYGLSFVILHDDSTIR
I---YDLEDLE-PESITVFNRKS-RSFGLSDHVESVCDIAFDP-TGLTLYLLSSFNYCDI
YAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVE
SDYLTLKHDLLKQIQFFDNYKKNDGI--------------------DTFTSKAIRNSVPQ
GPFIIKKFPTALNAKEVTGLTIIPV-GERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSN
TTFNNLSVITMFNAKGQCQLLNSSEPK----------------------------LVFTG
DSSTTIMEM-PWLEPLAQCIRLHDFSIIDDVKFENK---IRTVSGTFLGVL----STLSG
DILYNGNSFKVIESND--------------KSTTQKPINRTDEVK-YTY-KPSLPT--SG
KELDMLLTKYKTEAN-GFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMI
LFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKL
KETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLR--
--STTKGDD---FFSELE-------FSSLQQMLLNDKKVINSCMNELSASIEDLAV----
-----
>CAGL0J05214g
-------------MSIPNILKNSEAFTG--------NAAQRFLFSSSDGTKIVSIAD-RG
HLRWCHS-TST-TYKSLDFDL-QFEGK---VEGAVSSTTADYVCIYNRDELHVLEVPWMY
SGEEN----GLKHLCHIYSHKFD-------ENHSIKQVLFHPKSYLDSTILVLTNDDSIF
M---INTDDNRSDKNMINLNSKN-SALGLYDRINDIQKIIFSQ-DGLSLLILSAEEGCDI
FTIYPCLPRRWDISLHE-------------VDTLFAKSLLLYNNMNV------NTTPQE-
------KRNIVKQLNFMEKIRGQKTAFRNDKK--------------PLILEDAYLNAQPQ
GPFSMTPYPNELYDFMATDINIIQI-TQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRF
PGSNSLALLEQIKLEITDNAKFLSIPG-----------------------TYGKFVVTDN
VKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISC
NYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKN-GLY-EVKFAR--PL
TEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTL
GYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSL
YDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQI
ANQKPDI-S---SENGKE-------WNDLQQLLRTDLKIISEFEKKCDTAVNGINQLKI-
-----
>AEL168C
-----------------MTGELHPIFNADALGA----SHRLHAHTHGDGTKIVGYY--NK
HLRLGRF-TEQ-TYKSWHAE----VDA---KASSILNGSGSLLAFYGDHIIEVVDREGKK
ITLT--------------------------VNGGIKQVLWHPLAYLDSCLVVLTGQETIE
I---YELNEPRYEKPTLVLNEPT-SQLGISSRVIDITNIAFAP-DGLSLYLFSTSEGGDV
HVICPLLPSRIKADRAK-------------WARQWNKATALYSTLTK------DTPDDA-
------KVATIEYLEFVTQLLQAIEKNGSDG---------------ELVIPEHRRRTISQ
GPYNIHGFPEKLYSAVGTKLTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSW-TKDL
KNAYTLMLVEEFTATGTAFA------------------------------TCDGVAVL-G
IDSAQRVEI-PYLQALEDCIRDCNLAALQDINFTSS---ICKIPGKFHSVARFNAPGNKG
IILVGDHHAKIVPSTE---A---------AKSDTETELDSQPGKE-PTY-TVCFPN--SL
EEILNTNKELQRRKHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSA
GLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCML
QSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESL
PEHRQHDRQ---EEEPFD-------FRRLQELLKLDSKIITECTDNLSAAARELERKLCI
-----
>Ecym_6290
-----------------MTGDPHPIFQVPPFRT----LSKLHVHVCKNATQIVTCF--DK
NLRYARV-TEH-TFKSKHLD----IKH---SEHSILNNSGTLIAFYGSNDVELFDMDGKK
SCLR--------------------------VELGIKQVLWHPLAYLDSCLVVLTKENTIE
L---YELAKANFMYPTVVLNEKL-PQLGISSHVSEICSMAFSP-DGLTLYLLSLEEGGDV
YALHPLLPSRLRIKRSF-------------WESQWYKATALYESIDK------DTPNEK-
------KIAMIEHFDFVSKIYKMIDKDSEFF---------------DVNIPEHKRMVTPR
GPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSW-SRSL
NNACSFVLIEKFRAGGEIFA------------------------------IESGVAIL-E
KNNAHIVRF-PYLKALGECIKEGDIAPMVDVKLTSD---ITPLAGSYHTVVTWNEPSTKG
ILFIGNSVIRSIPDDV-------------GLSSFKPRVDPAISQN-GKY-TVCFPS--TM
EELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSL
GYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKL
QQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELI
ESNHGNI-P---NEELFN-------FEKLQDLLTLDSKMIGDCNDQLLAAAKDLENKLYI
-----
>TBLA0F01310
-----MTTSIESTYLEGHNPTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQ--DG
SIRWCYT-FSQ-NYHSYTIASRNFD-----IKDSLISNSGSFVCYYSDTDISIMEIPWSH
SNSVNA---SSSHCIQKYRYSFKK------YSLTVKQVLFHPLATLESCLVVLLSDDTIV
FIDFSKSFDLL--SSDYILNKKS-KSIGLSSQISDIQSLTFSQ-DGLTLYALSSSAATDV
YAFYPCLPPSAQFSLEQ-------------LENLVNKSVVQYEELRE------DDPTAL-
------KINIIKQLKFTSDLYKKGKRALEEDTDSKTW---------KYDVPLEYRLIRPQ
GPFTISPFPDSLYYSSPTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNF
NENNSLVLLELIKTKEQNIRKLTTYAH-----------------------QYGTFYIL-G
SVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISS
LLFINKSTVIELNEKP---KLLLSDDTTHLLTSELAQKYIPPLED-KIF-KIELPMGILI
SDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSL
GFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIM
NEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRI
KGENAIV-D---ENDFKQ-------WDRLRDMLHDDATTIETCTESIKNINFDLDRALKK
DSLSI
>Kpol_1035.24
-----------------MSFELNPIFKRPSVSR---ELTKRFFFSANNGTRIILFQ--DS
TIRWSFSSDND-HYQSMALRD--SDMD---VTGAIISDPGDYLCLYNSHQIRVIEIPWGL
TNVDEISN-SMASSLQERVYNFNE------DKLSVKQVLFHPLSKSSPFLVVLFSGSQIA
FVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQYVVFAD-DCLSLYSLTDT---DV
YCFYPCLPPVASLSKNR-------------VDELINKSIVLYENLGI------DADDIV-
------RKNVIKQLQLASSLRKKIEEFENANGEVEV----------NVEIDLEFRQTKAQ
GYFSISPYPESLYTCTGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDY
SFNNSFTLVEIIKFKPEELSNMVVLQG-----------------------ELGKFVVS-G
EKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST-ITHINSDMQINSCGIWNSGEAKS
LLLVDTNVVVGYQLFK-------------KEVEFKPESAEEISTELENFTLDKFTV--PE
NELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSKIVQGQSL
GLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHLEKILLKM
ESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFLKKELQKI
IDISRSESS---KGMLNE-------WEELRQILADDAKIIKECNEQLTQISKELDTKNTV
TNS--
>TPHA0O01460
----------------MVSPQLHTIFNRFSVGK---VSSKRSSITVDNGLKIILYQ--NN
TVRYGFVNDADGNFKSITLEK--EMIG---DVSIIADQIGNYLCLFNEFEIRVIELPWKL
WDAKEDSSFQLDNMVQIRSYDLKS------FGTTIQKILFHPLGLAYPCLVVLLKNSNIC
SIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIIDISFSS-DKLSLYALTET---DI
YLFYPFLIPTISVTKNE-------------IDQLFQKSIILFENLEN------DSSEAV-
------RRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIY------NIDINTEYRSVNAQ
GSFSIAPFPEELYKQSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDY
TFNNSFILLEKLKFNPDETKSILDIPF-----------------------KNGIFAIA-G
DQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESH-KQTINTLEEPNSCILWNEHNKKE
LLFITETKLISSDILE---SNNESA----EKLPVPAINDIKKIEK-LQL--KNYSQ--PI
KEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQEIGSKILQGQTI
ALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITERNTKLNERTSKL
IEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNNI
IEQPAQSHDAIIDSDEDE-------WNELCDLLNRDAKIIEDCNAELSSASGLI------
-----
>SAKL0D06930g
-----------------MSAEDHPIFQNISVGK---ESYPKKLLTTQDGCRVVVIQ--GD
TIRLCSS-GNS-QYQIIECG----INT---VAGAALNNSGTLLCAYNETELQVIVLPSPF
VS-------SHGGILKPHTYNIT-------VKSPIKQVQWHPRGKLDSVPVVLHKDDTIA
M---YELYNEDFQQPTAVLNTMQ-NQLGVTSHITDIESMCFSK-DGLALYLLNSSEGGDV
YALYPFLPSVLVIPEQH-------------LEMCFYKSCINYENLSS------DDSPTV-
------KRNVIKQLQFVSRLHKQYKSETVDKARNGDL---------VFNIQESYRNAKIQ
GPFTINPFAEKLYSATATQITTMPI-DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDS
SSNNSLVVLESLDILSGQIICL----------------------------TPHKFAVL-G
PKS-FVVDSSEWTKALSECINFSNLEVLSQINIKST---ITPVNGAFTQAGLWESNGEKQ
LIFMSDKSVKSITLPE---P---------NKTKDAVSKTVQPVTE-VKY-EPVFSQ--PI
GEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTL
GLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKL
QSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTA
GERRVS------KEDVFD-------WAELQELLSVDSEIIKECNEGLVEAAKELDEKI--
-----
>KLTH0H10692g
-----------------MLPEAHPIFQARSLGE---SRSERLCLHTKDLSRTILLE--GN
SLKWCLM-DAP-NYEYMELNA---ISN---YTSAVLNDSGTLLCLNNVDEIQVLALSWDQ
TRPE--------------SYRIK-------VPAGVKQVLWHPRGRLDSCLTVLNKRDEIL
L---YELLSEDFSAPTTVLNAST-NELGMGSSVKDIESVCFSA-DGLTLYLMSVSEGADV
FSIYPCMPSELSITRKA-------------LKYNFNKALLQYQELSE------GDSPEL-
------KLKATRQLHFMSSLYNQPHDADDSQTNLLQ----------TFHIRKAYRNARAQ
GPFTISPFPEKLYLATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGS
SEKNSLISVGSLKLPGSISL------------------------------IYGSCFVLIS
AEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEE---ITEKKGTFQSAGLWPESGMQK
IVLLSEKEITSIDISS-------------MQTPASSTTEKIEKSE-TNR-QRPYSQ--PL
SEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTL
GLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESL
HRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSLEYV
RVDSAEAAS---RSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQELDS----
-----
>Kwal_14.2580
-----------------MIPESHPIFDTKTNSS---GKSRRFVFNIGIASKYGVLQ--GN
TLRWCSA-GGH-EYQYLEFEP---RID---YTSVVINESGSLLCLYNSKQVQILAVSWDE
SKSD--------------TILIS-------PPAGIKQALWHPRGRLGSCLAVLTTQDEIC
L---YELLTEDYTEPTTILNTCT-KELGMGSVVKDITSMSFSS-DGLTLYLLSTSEGADI
YSIYPCLPSEMEISGAL-------------LKSVFNKALLQYQDLND------NDSPDL-
------RRKVTKQLQFVSKLQKKNDYKDTESH--------------VVTISKAHRSPRAQ
GPFTINPFPDNLYLATGRQVEVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGF
CENNSLIVLGSVNIGGEIAL------------------------------VNGYTFVVLS
SAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEE---VVEKNGRFCSAIICASSEKSC
VALLSETTTSHIDIPF---S---------LDAPKMRTALGTAKTD-VEQ-YRPYGQ--PL
NEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTL
ALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQI
SSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYV
HVESKEGKS---GSSSADNKDEVP-WDELRALLAKDLRIIGECQDSLQGVAKQLDS----
-----
>KNAG0C05840
MNFSACVTSSVGDGSVSQLMGQRPILQPTAGLPS--DLSSRYVFTTDKGTKYVYLDKTNG
LLRWGSV-SED-EYNSMPLKISNFADK---SVNVILSDSGEFLCVYSKDCVTVIEVPWRY
RNPE-----EMSYVFQTSFKEIR-------KDSFIKKVLFHPRAIKKTCMVILFEDDTIY
L---FDVED----NNKIALNVPS-GNIGIEDRITSIADIEFSQ-DGLTLYVLSAEDCGDV
YAIYPCLPPILAMSQKE-------------LKSLMNRSVLLYDSLTE------TTPSAV-
------KKGVIKQVEFISQLQNISHGKEEISN--------------VLEIDTIYRLAKPQ
GPFTIAPFPEKLYSATATEICPLNI-GGGNEILCIAYDNGTALFLFKDLELSMAWDVGGI
YYNNSLVLMEEFDLQTESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQ-Q
SSMIRCVDTKAWSSVVSDCIDRHDINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEG
VTWITNKSVTCKELKK-------------QVSWKPEQSTSSEKKK-QAFPKPEFSV--PI
SELNALNINYQDTCRIGFHDIISPLDRQKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGL
GMTLYNRLLEQQLELTKQLQCSNKILMKQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSL
QQKLAAIDKTKKSTDLVITDEESVWFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTF
VSDSQRL-P---GTANTE-------WHSLQEMLKHDSLLLRADKKDKKDASSQVSRRASS
KLFT-
>KAFR0A01720
----MAQSNEVSVSEVSKLLENRPIFKTSLSSSL--LNSERSFSLPILAQDSSIYK--KN
QLRWGSV-ASS-QYHSLPL---LFFDD-SAYENVIISNSGQFLCLYDKKSLSLIEIPWGY
DGAVT----SIKSSFQRVFRDVN-------KSSDIKKILFHPKAADDGCVVILFENDVIC
L---FDLRK----SEKLFLNKTA-NKLGIETRVTDIEDMEFSQ-DGLTLYMLSVTDGGDI
YAFYPCLPPKLSLKKSV-------------LEDLFNKSRILYDSLDS------TVSIEV-
------RKNVLKQIKFIASLRDSSSDETKNS---------------CLEISNDFRQVKAQ
GPFTVAPYPEKLYEATAKEIYTLDI-GNNNELFAITFDNGTVTLLLKDLELSMSWNADNY
VYNNSFVLIESVEMGPESIK-LLKSSS-----------------------LTGQMFISQN
HSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSK-ISDLDIKENVDCYGVWSLRGERG
ILFVSNSSVISRTLPE---SDSSFVI---KLDEMSRSKNIEDPVT-KKY-EVSFTQ--PI
SEIMNLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSL
GLVLRNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNAL
NGNLAKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRI
ESKVGQR-S---SHLTSE-------WAEFKKILETDTNIIKECNEELTKAHTQLDAEV--
-----
>NDAI0G05750
------------MSDNFSPIASHPIFGTSIITN---EDSQRFFFTSHQGTRMVLLQ--GC
ILKWCNV-IDT-TYHSMKVKS--IFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGY
EKIPD----ELLSKFQPFHYDISSSTSALSSPSDIKQVLFHPKSYHETCLVILYEDSIIQ
L------IDTTASTETITINQPT-GTLGVETRVIDIESICFDKTTGLILYALSISDGGDI
YALYPCLPTRLDVSKKE-------------VDLLLQKSIVLYDSLKE------NMSNDV-
------KRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQ
GPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIANY
IHDNSFALVELIKLKPTDIGRLIIYQD-----------------------NFGKFFLL-S
DDVIMLVHTNSWSDKLAKAIDDSNLNILSEIGFESE-ITWFDVMGKFNNCTPCKYHGKES
IIFVSSDNVFVENLTK---KHSMN-----NIKGSSTSNSNEETAE-SEY-KVTFKQ--PI
DELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTL
GFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNL
NEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRI
SNDVTSVVD---EKSKKE-------WEELRAILEQDSKIIKECNIELTKTTESMAGIGSK
-----
>NCAS0A09210
-------------MSNIDSIASHPIFQGLDCTQ---DAAPRFLFTSHHGTRMVVLQ--GG
LLRWCSV-TAS-SFNSMTIDF--FQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGY
VTPSP----SMVSKFQLFSYNNKDDD----GYSPIKQVLFHPEAYKDSCLVVLYDNGTIS
L------MDVTQITKTITLNKRV-ATFGIDTQITDIESICFSK-DGWTLYALSISDGGDI
YAFYPCLPQQLEVKREK-------------ITSLLHESVLLYESLKL------DTDRDV-
------KRNVIRQVQFVNKLNGLLTENEKNSNED------------FIEIEQEYRLIRGQ
GPFTIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNY
VHNNSFSLVELMQLKDTDVKRIVSYPD-----------------------TYGQFFIF-G
DSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSK-LDFFETTNGITKCSPCKWRGRDV
ILFITKEDVYMHPVEM---RKSGI-----LGNNKPVLVNNEELKH-QEY-KTSFKQ--PV
EELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEVISKIGQGQNL
ALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKRLQDL
DAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLKKDLARI
SKETSQLRD---EKSDKE-------WDELRDILKHDAQIIQECNKELLSTTEAL------
-----
>Smik_10.179
-------------MSQSKSLASLPIFQASLSAS----QSPRYIFTSQNGTRIVFIQ--DN
IIRWYNVLTDP-CYHSLSLSRHLVLDD---TFHVISSTSGDLLCFFNDQEIFVMEVPWGY
SNVENI---SIQDAFQVFHYSVDETE--LGPKSLIKKVLFHPKSYHDSCIVVLKENDTII
M---FDILNQQ--EKPIILNKPN-NSFGLDARLNDITDLVFSK-DGLTLYCLNTTEGGDI
FAFYPFLPSALLLNEND-------------LSWILNKSLVMYESLDP------TTDVTV-
------KRNIIKQLQFVSKLHENWDSKLN-----------------KVDIDSEYRLVKVQ
GPFTINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNY
VYNDSLVLIERVKMQ-KEIESLITLPE-----------------------QMGKLYVF-S
KNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESK-IENIATVEGMPNLAHIYWNNTSN
LALASNKELTFQTVSV---DQKMQS----TETETDIGTEESGLAK-CRY-ELRFTQ--PL
SEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSL
GVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFSKL
TENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELTRI
ETETIQV-D---KKSQSE-------WNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ-
-----
>YJL061W
-------------MSQSSRLSALPIFQASLSAS----QSPRYIFSSQNGTRIVFIQ--DN
IIRWYNVLTDS-LYHSLNFSRHLVLDD---TFHVISSTSGDLLCLFNDNEIFVMEVPWGY
SNVEDV---SIQDAFQIFHYSIDEEE--VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTIT
M---FDILNSQ--EKPIVLNKPN-NSFGLDARVNDITDLEFSK-DGLTLYCLNTTEGGDI
FAFYPFLPSVLLLNEKD-------------LNLILNKSLVMYESLDS------TTDVIV-
------KRNVIKQLQFVSKLHENWNSRFG-----------------KVDIQKEYRLAKVQ
GPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNY
VYNNSLVLIERVKLQ-REIKSLITLPE-----------------------QLGKLYVI-S
DNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK-LEDIATIERIPNLAYINWNDQSN
LALMSNKTLTFQNISS---DMKPQS----TAAETSISTEKSDTVG-DGF-KMSFTQ--PI
NEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTL
GVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKL
SKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTRI
EAETIKV-D---KKSQNE-------WDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ-
-----
>Skud_10.158
-------------MSKSNSLVALPIFQASLSAS----QSPSYIFSSHNGTRVVFIQ--DN
IIRWCNSLTES-SYQSLDFSRHLILDD---TFRVISSASGDLLGFFNVQEIFVMEVPWGY
NNIEEA---SVQDAFQLFHYSVGQVE--NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTIT
M---FDILNQQ--HKPIVLNKRS-NSFGLDARVNDITDLAFSR-DGLTLYCLNTTEGGDV
FAFYPLLPPVLLLGEKD-------------LGWILNKSLVMYESLDS------TTDITV-
------KRNIIKQLQLVSKLHENLDSQLG-----------------KVEIDEEYRLVKMQ
GPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNY
VHNNSLVLIERIKIQETDIKSLKTLPE-----------------------ELGKLYVF-S
ENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESK-LENIVTIEHPSNLAYISWNDTSN
LVLTARGKLTFQNISN---DKELQT----TKFDANNKSDRIDAGK--HY-EMSFTQ--PI
NEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQSL
GFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKKL
TENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTRI
EAETIKT-D---EKTQNE-------WDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQS
KN---
>Suva_6.137
-------------MPQSDSLAALPIFQASLSAN----QSPRYIFSSHNGTRLVVIQ--DD
IIRWCSLLTDP-SYHSLNFSRHLVLDD---TFHAISSASGDLLCFYSDQEIFVMEIPWGY
LNLGDV---SIQDAFQVFHYSVDELE--LGSNSPIKKVLFHPKSYNDSCIVVLKNDDTIT
M---FDILNQQ--EAPIILNKRN-SSFGLDARVNDITDFAFSK-DGLTLYCLNTTEGGDI
FAFYPFLPSVLSLSEKD-------------LGWILNKSLVMYESLNA------TTDYKV-
------KRNITKQLQFVSKLHKNWDSKLA-----------------KVKIDDEYRLVKMQ
GPFTINPFPNELYDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNY
VYNNSLILIERIKLQQKEMKSLTALPD-----------------------QLGKLYVT-L
ESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSK-FEDIATIHQLSNFAYINWNDKSS
LALISKEKLTIQNISN---HKKEQSLNAPAELDTNVNSDKSDTGK-RGY-EISFTQ--PI
NEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEFLRKIIKAQSL
GVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQAELMTRFGKL
TENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDLSYLKRELIRI
ESETINA-D---KKSQNE-------WDELRKMLEVDSKIIKECNEELVHVSQQLTTKTQ-
-----
>TDEL0D01880
-----------------MTVETHPIFRPSLTAQ---SGSDRFFLTTSDGGRAVVVQ--DS
CIRWCNV-SEP-GYHSMTLER--AFKD---VKHVVMSNSGEFLCLYNDDELRIIEVPWAY
TEVS-----SMANAFQLFRFVSD--------EARIKQVLFHPLAYQQETVVILKDDDSIT
IMNWQDFGD----SKPDVLNLSN-GTYSLDSSITDVECITFSQ-DGLTLYVLSVSEGADI
YAFYPCLAPRMQFDKQG-------------LDRLMYKSLIQYDVLNV------GTDSEV-
------KRNTIKQLKFVSGLHKQQNSQR------------------ILEIPEAQRQVRGQ
GPFTIAPFPKQIYSSTGTGIASLPI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARY
NYNNSFALVELITLGSQEIQQIVVGDH-----------------------KYGQFSVM-T
PEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESE-VTFTELKDSPKSVAWWN-TTPQS
VVKVSNREVKSKQVSE-------------GVSKQDDDITGSRQEP-EKY-NAHYSQ--PI
AEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTL
GVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKF
KDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRI
AQVTGDQ-N---SQARDE-------WHELRHMLEEDTIILQDCNNQLKSAARQVPAQP--
-----
>ZYRO0G20680g
-----------------MSIGSHSIFKRASGSS------KRFLCTSQDGSKVVIYQ--DS
SIRWCNA-FDS-KYEFMLLEP--TIED---VEHVVLSPTGTLLLLYNSREVRIVEIPWGY
SQVS-------YEGFQKFRYSVDSR-----QDPLIKKVLFHPLAYREHCIVILKTDNTIH
LLDRYYPYDKQ--PKLLVLNQHD-GAFGMEGLVTDIESITFSQ-DGLTLYALSVAEGCDI
YAFYPCLPCSIEIDSHK-------------LDLLMHKSLVQYENLSV------ETPDAT-
------KRNTIKQFQFISKLRQGLENDQT-----------------KIDIPMDWLRVRGQ
GPFTIAPFPDRYYDRTAVQLKILPI-GANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGY
SYNNSLVLVESIRL---ERGELVLKQG-----------------------TLSQFFVLGG
TSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSE-ISKIEGVSQIDSYAMWKKDTEPK
DVFVSKDTVFVKSTAV-------------NDQPSTVKDEKKANVDIPRY-EVALNQ--PM
SEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQAL
GFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSL
SEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENI
SLEDKDV-G---EKSKSE-------WTELLSILESDTKIIKECNNQLAHASSEVGFST--
-----