MUSCLE (3.8) multiple sequence alignment

Suva_9.107      --------MVNKSKFNGG-----NGNAPSSRNNKKKYNNYRKKSVASSVRCENFGIARTD
Skud_9.81       --------MVNKSKTNGGNDTITNGKTLPLRINKGTCRSRRKKSVVSSIKCKNFGLAKPA
YIL092W         MVQMRSKNMAYESGTNNYSDTIANGNTLPPR-SKKGHSGRRKRSETLPIACNNFCVTRQI
Smik_9.87       --------MADKSSTNDGDSLVTNGHILSQRGSKKAYNKCKKKNVAPSIRWKNFGVARQA
                        *. :*  *.      **:  . * .*      .*.. . .:  :** ::.  

Suva_9.107      DDEKQVSMIFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALT
Skud_9.81       DDEEQVSKILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALS
YIL092W         DDDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALS
Smik_9.87       DDEQQASLILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALS
                **::*.  ::**:.******:::.**:.:**** ***:: * **  ** **********:

Suva_9.107      GRAKKWFDSTTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSL
Skud_9.81       GRAKKWFDLTTEGIDDHLMKTYTLENFLALLSGEFDGARFLRRERFSELLNLPIDSETSL
YIL092W         GRAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSL
Smik_9.87       GRAKEWFDSTLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSL
                **** *** * *****: :.:*::*:****** ****.. **** *::** *.*:**.**

Suva_9.107      EKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGT
Skud_9.81       EKFANISGLLTPYYLSSSATLDLLLTKLGPCLQKQLKSSAFPMTLDVALLMAACEFAKGA
YIL092W         EAFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRA
Smik_9.87       ETFSYISEHLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRA
                * *:  *  *******:.*:***:**** * :**:* ...*****::***::****** :

Suva_9.107      SEERKDKNAENNNNNNDSNPIDLDP-STRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGK
Skud_9.81       SIERNDIN---------DNIISSGATSSKKKKSTFKDSKKYKAKTTKGTTDIDFEKDVRK
YIL092W         SNHKKYRY---------KNTRDSDI-CTPKSKNTAIVSKLSNTKTISKN--KVIEKSDKK
Smik_9.87       SSHRKDRK---------KNTSDFDI-GTSKKRAT-NLNKKCKTKIIREN--NTNRKSNRK
                *  .:            .*  . .   : *.. *   .*  : *    .      *.  *

Suva_9.107      KNVNEEELQVLHPKRRRQNESGKQISLPTAALADILPLNQNISNINASNK-QFNASSSLD
Skud_9.81       GYNNEMEPQIPSCKRRKQSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLD
YIL092W         NYFDKNSQHIPDPKRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLS---D
Smik_9.87       KCFSEKELLIPDLKRRKQSECGIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPD
                   .: .  :   ***.*.*   .: *      :  .  :   *   ..: . . .   *

Suva_9.107      SYTSLKSNSFQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIP
Skud_9.81       SFAPLKSNKHQSYVVNAIATLDSDRTF--TSTTSTALADDKSEYTRDKTIFYDKPTDEPS
YIL092W         LHTNLKNSKSQQCAVEPISILNSGSLV--TGTINIDLINDEVLGTKEETTTYDERMDGNS
Smik_9.87       FHAYLKDTKSQQYADSATSNLINNRLI--SCTATDKLIGGKVVTMKNENTAYNEPTDGRP
                 .: **... *    .  . * ..  .  : .    *  .:    .::.  :::  :  .

Suva_9.107      LSLASSNDFVKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHS
Skud_9.81       LSSSGGNYAARRDTLHSMTSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRS
YIL092W         RSLNERCCAVKKNSLQPITSNIFQKNAEIQGTKIGSVLDSGISNSF----SSTEYMFPPT
Smik_9.87       SSLENRNRAVKENTLQFMSSNSFKECGKIHDSRTRSISGGNMTISS----SQTMHMFSRP
                 *       .. .    :: . :.    : ...  ..  .. :         : :: . .

Suva_9.107      NIFKPAQTACYDSNKTNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKP
Skud_9.81       ALVVNDQTV----KKTQFIKSNQIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNEL
YIL092W         SSATVSNPV----KKNEISKSSQVKDIAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRL
Smik_9.87       GSLAIDHQA----RNNEVSMSNRIKVVDNYNPFTAN-----LKVSKSSKNVPASMRMDDL
                      : .    .:.:.  ...:  : : ***  *      .  :. :.  .*: ::  

Suva_9.107      SYFIDLEK-PQSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIH
Skud_9.81       SCFVDLEK-PRSANIENKRSELLTQKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIR
YIL092W         SRIAGLRNIPGNIYEDSKMLNLKTRKCYPLHNFAVRTRSAHFNDRPSNYISPHETINATL
Smik_9.87       SGTVGLKNALRTTYEENESYQLSSKKSYPLNNFAVRTRNAHFNDRPSNYTSAHAITSVTY
                *   .* :   .   :.    * :.* ***:*******.*.*.:***** *.*   .   

Suva_9.107      PLSLKINNIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGR--SNSVENPF
Skud_9.81       PLSTNIQKIQSFSRSGSRKADTNTEVISSHMLVQHKRSVNS-ENREGNRT--FNDVTNPF
YIL092W         RSPASFDSIQCITRSKRVDAETNKAT----------GSAKS-ENIETKSR-KFPEVINPF
Smik_9.87       PSSSSISTIQCFTRPNSKEPSPKKVIISSCMVAQKKELANT-KSKEAKNRSSFNEVTNPF
                  . .:..**.::..   ....:.              .::    : .      .* ***

Suva_9.107      LGNTLNETKLNSYYI
Skud_9.81       LANTMSGRKQSNYYM
YIL092W         LVNTTNKKESD----
Smik_9.87       LVNVIEKNK------
                * *. .  :      

FASTA FORMAT for MUSCLE Version 3.6

>Suva_9.107
--------MVNKSKFNGG-----NGNAPSSRNNKKKYNNYRKKSVASSVRCENFGIARTD
DDEKQVSMIFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALT
GRAKKWFDSTTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSL
EKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGT
SEERKDKNAENNNNNNDSNPIDLDP-STRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGK
KNVNEEELQVLHPKRRRQNESGKQISLPTAALADILPLNQNISNINASNK-QFNASSSLD
SYTSLKSNSFQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIP
LSLASSNDFVKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHS
NIFKPAQTACYDSNKTNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKP
SYFIDLEK-PQSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIH
PLSLKINNIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGR--SNSVENPF
LGNTLNETKLNSYYI
>Skud_9.81
--------MVNKSKTNGGNDTITNGKTLPLRINKGTCRSRRKKSVVSSIKCKNFGLAKPA
DDEEQVSKILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALS
GRAKKWFDLTTEGIDDHLMKTYTLENFLALLSGEFDGARFLRRERFSELLNLPIDSETSL
EKFANISGLLTPYYLSSSATLDLLLTKLGPCLQKQLKSSAFPMTLDVALLMAACEFAKGA
SIERNDIN---------DNIISSGATSSKKKKSTFKDSKKYKAKTTKGTTDIDFEKDVRK
GYNNEMEPQIPSCKRRKQSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLD
SFAPLKSNKHQSYVVNAIATLDSDRTF--TSTTSTALADDKSEYTRDKTIFYDKPTDEPS
LSSSGGNYAARRDTLHSMTSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRS
ALVVNDQTV----KKTQFIKSNQIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNEL
SCFVDLEK-PRSANIENKRSELLTQKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIR
PLSTNIQKIQSFSRSGSRKADTNTEVISSHMLVQHKRSVNS-ENREGNRT--FNDVTNPF
LANTMSGRKQSNYYM
>YIL092W
MVQMRSKNMAYESGTNNYSDTIANGNTLPPR-SKKGHSGRRKRSETLPIACNNFCVTRQI
DDDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALS
GRAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSL
EAFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRA
SNHKKYRY---------KNTRDSDI-CTPKSKNTAIVSKLSNTKTISKN--KVIEKSDKK
NYFDKNSQHIPDPKRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLS---D
LHTNLKNSKSQQCAVEPISILNSGSLV--TGTINIDLINDEVLGTKEETTTYDERMDGNS
RSLNERCCAVKKNSLQPITSNIFQKNAEIQGTKIGSVLDSGISNSF----SSTEYMFPPT
SSATVSNPV----KKNEISKSSQVKDIAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRL
SRIAGLRNIPGNIYEDSKMLNLKTRKCYPLHNFAVRTRSAHFNDRPSNYISPHETINATL
RSPASFDSIQCITRSKRVDAETNKAT----------GSAKS-ENIETKSR-KFPEVINPF
LVNTTNKKESD----
>Smik_9.87
--------MADKSSTNDGDSLVTNGHILSQRGSKKAYNKCKKKNVAPSIRWKNFGVARQA
DDEQQASLILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALS
GRAKEWFDSTLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSL
ETFSYISEHLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRA
SSHRKDRK---------KNTSDFDI-GTSKKRAT-NLNKKCKTKIIREN--NTNRKSNRK
KCFSEKELLIPDLKRRKQSECGIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPD
FHAYLKDTKSQQYADSATSNLINNRLI--SCTATDKLIGGKVVTMKNENTAYNEPTDGRP
SSLENRNRAVKENTLQFMSSNSFKECGKIHDSRTRSISGGNMTISS----SQTMHMFSRP
GSLAIDHQA----RNNEVSMSNRIKVVDNYNPFTAN-----LKVSKSSKNVPASMRMDDL
SGTVGLKNALRTTYEENESYQLSSKKSYPLNNFAVRTRNAHFNDRPSNYTSAHAITSVTY
PSSSSISTIQCFTRPNSKEPSPKKVIISSCMVAQKKELANT-KSKEAKNRSSFNEVTNPF
LVNVIEKNK------