MUSCLE (3.8) multiple sequence alignment

ADL214C            -MHRSSATSLI--HKATY----ATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIR
Ecym_3326          -MLRVGRGQLS---TRTY----VTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVD
TPHA0C03410        -MLRRSVYNRQ--FQRTI-GNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLT
Kpol_1003.39       -MLRNGVYRAC--ARRTV--VNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSID
TBLA0B05940        -MLRTSVRQFSVSARNAS-----SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLA
SAKL0E07656g       -MLRSTVSQFA---RRSY---ASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLK
KLTH0G10384g       -MLRASFTQLA---RRSY---ASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLK
Kwal_27.11528      -MLRTSFNQLA---RRSY---TSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLK
KAFR0J01360        -MLRSVVTKSA--TIRHL-STKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLN
KLLA0E08339g       -MMRTRFIQLS---RRAY---ASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLS
CAGL0G02585g       -MLRGSATRLT--AMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLD
ZYRO0A01914g       -MFRSSVAKVA--ARRAY----SAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQ
KNAG0A05420        MMLRSAANKLA--GCRGL-ATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLN
TDEL0G02180        -MLRSAIGRLA--TRRAY---ASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLN
Suva_9.105         -MFRSVATRIS--ACRGL-ASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLS
Skud_9.79          -MFRSVATRVS--ACRGL-ATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLS
Smik_9.85          -MLRSVATRLS--TCRGL-ATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLS
YIL094C            -MFRSVATRLS--ACRGL-ASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLS
NDAI0B03550        -MLRTTASRLA--TCRGY-ATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLN
NCAS0B06250        -MLRTAASRFATSTCRTY-ATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLK
                    * *                     . : **********.**** *. :*: :. ...: 

ADL214C            FSYEHLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQ
Ecym_3326          FKYIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKA
TPHA0C03410        FNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKE
Kpol_1003.39       FKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQ
TBLA0B05940        FEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKE
SAKL0E07656g       FNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKK
KLTH0G10384g       FDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKK
Kwal_27.11528      FNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKK
KAFR0J01360        FNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKE
KLLA0E08339g       FKFIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKN
CAGL0G02585g       FKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKA
ZYRO0A01914g       FDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKE
KNAG0A05420        FDFIDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKA
TDEL0G02180        FDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE
Suva_9.105         FNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRRE
Skud_9.79          FNFIDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRRE
Smik_9.85          FNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRRE
YIL094C            FNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRRE
NDAI0B03550        FDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE
NCAS0B06250        FDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKE
                   *.:  * **: :* : * ***  *:. *.  *:*.*********..* .****** **. 

ADL214C            LGLYANIRPVKSVSGTG--QPVDLVIVRENTED-LYVQQERTYVDAATGKRVAEAIKRIS
Ecym_3326          LGLYANIRPVKSVDGTG-DRPVDLVIARENTED-LYIKSERTYIDKETGGRVAEAIKRIS
TPHA0C03410        LGLYANIRPVKSVDTPG-NKKVDMVIVRENTED-LYIKLEKTYIDEKTGTRVADATKRIS
Kpol_1003.39       LGLYANIRPVKSVSGTN-DRPVDMVIVRENTED-LYIKEERTYIDEATGTKVAEATKRIS
TBLA0B05940        LGLFANVRPVKTVEGTD-AKPIDLVIVRENTED-LYIKIEKTYTDPKDGSRIAEATKRIT
SAKL0E07656g       LGLYANVRPVKSVQGTN-DRPVDMIIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRIS
KLTH0G10384g       LGLYANVRPVKSVL-PQ-ERPVDMIIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRIS
Kwal_27.11528      LGLYANVRPVKSVL-SQ-EKPIDMVIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRIS
KAFR0J01360        LQLYANIRPVKSVAGAHSGKPVDMVIVRENTED-LYIKIEKSYKDQN-GMRVAEATKRIT
KLLA0E08339g       LGLFANVRPVKSVDGTK-DRKVDLVIVRENTED-LYIKLEKSYIDEATGTRVADATKRIT
CAGL0G02585g       MGLFANVRPVKAVEGTN-DRPVDMVIVRENTED-LYIKIEKTYTDPATGTRVAEATKRIS
ZYRO0A01914g       LGLYANVRPVKSVEKGN-DRNVDMIIVRENTED-LYIKTEKTYVDEATGTRVAEAIKRIS
KNAG0A05420        MGLYANIRPVKSVEGSN-ERPVDMIIVRENTED-LYIKIEKTYIDKATGTRVAEATKRIS
TDEL0G02180        LGLYANVRPVKSVEGTK-DRPVDMVIVRENTED-LYIKLEKTYVDKATGTRVAEATKRIS
Suva_9.105         MGLYANVRPVKSVEGTK-DKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADAIKRIS
Skud_9.79          MGLFANVRPVKSVEGSR-NKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRIS
Smik_9.85          MGLFANVRPVKSVEGGK-DKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRIS
YIL094C            MGLFANVRPVKSVEGEK-GKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRIS
NDAI0B03550        MGLYANVRPVKSVEGTT-DKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRIS
NCAS0B06250        MGLFANVRPVKSVSGTK-DRPVDMVIVRENTED-LYIKIEKTYIDKATGTRVAEATKRIS
                   : *:**:****:*      . :*::*.****   : :: *.:* *   * .:*:* ***:

ADL214C            EPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS
Ecym_3326          EHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FAN
TPHA0C03410        EVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD
Kpol_1003.39       EVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGN
TBLA0B05940        ETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSG
SAKL0E07656g       ETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGA
KLTH0G10384g       ETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGS
Kwal_27.11528      EVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGS
KAFR0J01360        EVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAG
KLLA0E08339g       EIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGG
CAGL0G02585g       EVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGK
ZYRO0A01914g       EVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE
KNAG0A05420        EIATQRIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAG
TDEL0G02180        EVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ
Suva_9.105         EVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ
Skud_9.79          EIATRRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQ
Smik_9.85          EIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ
YIL094C            EIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ
NDAI0B03550        EIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ
NCAS0B06250        EIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGS
                   * **  **  :: :: :*    *   ************:****.*:*.. :: *:  :. 

ADL214C            IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIII
Ecym_3326          VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVI
TPHA0C03410        IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVI
Kpol_1003.39       VSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIII
TBLA0B05940        VAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVI
SAKL0E07656g       IGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIV
KLTH0G10384g       IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV
Kwal_27.11528      INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV
KAFR0J01360        INYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVM
KLLA0E08339g       VQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVI
CAGL0G02585g       IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
ZYRO0A01914g       VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
KNAG0A05420        ITYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
TDEL0G02180        VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
Suva_9.105         IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVI
Skud_9.79          IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
Smik_9.85          IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
YIL094C            IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
NDAI0B03550        INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
NCAS0B06250        ITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
                   : *****:******:*.**  ***:********:*************:***.***  :::

ADL214C            GEPCHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDL
Ecym_3326          GEPCHGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDL
TPHA0C03410        GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDL
Kpol_1003.39       GEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDL
TBLA0B05940        GEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADL
SAKL0E07656g       GEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDL
KLTH0G10384g       GEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDL
Kwal_27.11528      GEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDL
KAFR0J01360        GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDL
KLLA0E08339g       GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDL
CAGL0G02585g       GEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDL
ZYRO0A01914g       GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDL
KNAG0A05420        GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADL
TDEL0G02180        GEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDL
Suva_9.105         GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDL
Skud_9.79          GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDL
Smik_9.85          GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDL
YIL094C            GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDL
NDAI0B03550        GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDL
NCAS0B06250        GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDL
                   *********** *.**:**:*****.. :*:::*   .*  *  .*  *: .    :.**

ADL214C            GGKNTTQEVLDDILARI--
Ecym_3326          GGNSTGEQVANDILSRI--
TPHA0C03410        GGKNSTSDVVNDVIRRL--
Kpol_1003.39       GGDSSTTEVTDDILSKL--
TBLA0B05940        GGDSTTQQVIDDILGKL--
SAKL0E07656g       GGKSTTQQVVDDILSKM--
KLTH0G10384g       GGKSTTQQVVEDVLSRM--
Kwal_27.11528      GGKSTTQQVVDDVLSRM--
KAFR0J01360        GGNSSTQNVVDDVLEKLAK
KLLA0E08339g       GGNSTTQQVLEDVLSKLD-
CAGL0G02585g       GGKSTTQQVVDDILSKI--
ZYRO0A01914g       GGKATTQQVVDDILSKI--
KNAG0A05420        GGNATTQNVVDDILARL--
TDEL0G02180        GGNSTTQQVVEDILSKL--
Suva_9.105         GGKASTQQVVDDVLSRL--
Skud_9.79          GGKASTQQVVDDVLSRL--
Smik_9.85          GGKASTQQVVEDVLSRL--
YIL094C            GGKASTQQVVDDVLSRL--
NDAI0B03550        GGKSTTQEVTEDVLARL--
NCAS0B06250        GGNSTTQQVTEDVLARL--
                   **. :  :* :*:: .:  

FASTA FORMAT for MUSCLE Version 3.6

>ADL214C
-MHRSSATSLI--HKATY----ATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIR
FSYEHLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQ
LGLYANIRPVKSVSGTG--QPVDLVIVRENTED-LYVQQERTYVDAATGKRVAEAIKRIS
EPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS
IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIII
GEPCHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDL
GGKNTTQEVLDDILARI--
>Ecym_3326
-MLRVGRGQLS---TRTY----VTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVD
FKYIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKA
LGLYANIRPVKSVDGTG-DRPVDLVIARENTED-LYIKSERTYIDKETGGRVAEAIKRIS
EHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FAN
VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVI
GEPCHGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDL
GGNSTGEQVANDILSRI--
>TPHA0C03410
-MLRRSVYNRQ--FQRTI-GNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLT
FNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKE
LGLYANIRPVKSVDTPG-NKKVDMVIVRENTED-LYIKLEKTYIDEKTGTRVADATKRIS
EVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD
IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVI
GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDL
GGKNSTSDVVNDVIRRL--
>Kpol_1003.39
-MLRNGVYRAC--ARRTV--VNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSID
FKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQ
LGLYANIRPVKSVSGTN-DRPVDMVIVRENTED-LYIKEERTYIDEATGTKVAEATKRIS
EVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGN
VSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIII
GEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDL
GGDSSTTEVTDDILSKL--
>TBLA0B05940
-MLRTSVRQFSVSARNAS-----SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLA
FEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKE
LGLFANVRPVKTVEGTD-AKPIDLVIVRENTED-LYIKIEKTYTDPKDGSRIAEATKRIT
ETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSG
VAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVI
GEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADL
GGDSTTQQVIDDILGKL--
>SAKL0E07656g
-MLRSTVSQFA---RRSY---ASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLK
FNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKK
LGLYANVRPVKSVQGTN-DRPVDMIIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRIS
ETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGA
IGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIV
GEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDL
GGKSTTQQVVDDILSKM--
>KLTH0G10384g
-MLRASFTQLA---RRSY---ASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLK
FDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKK
LGLYANVRPVKSVL-PQ-ERPVDMIIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRIS
ETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGS
IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV
GEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDL
GGKSTTQQVVEDVLSRM--
>Kwal_27.11528
-MLRTSFNQLA---RRSY---TSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLK
FNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKK
LGLYANVRPVKSVL-SQ-EKPIDMVIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRIS
EVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGS
INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV
GEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDL
GGKSTTQQVVDDVLSRM--
>KAFR0J01360
-MLRSVVTKSA--TIRHL-STKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLN
FNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKE
LQLYANIRPVKSVAGAHSGKPVDMVIVRENTED-LYIKIEKSYKDQN-GMRVAEATKRIT
EVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAG
INYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVM
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDL
GGNSSTQNVVDDVLEKLAK
>KLLA0E08339g
-MMRTRFIQLS---RRAY---ASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLS
FKFIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKN
LGLFANVRPVKSVDGTK-DRKVDLVIVRENTED-LYIKLEKSYIDEATGTRVADATKRIT
EIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGG
VQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVI
GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDL
GGNSTTQQVLEDVLSKLD-
>CAGL0G02585g
-MLRGSATRLT--AMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLD
FKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKA
MGLFANVRPVKAVEGTN-DRPVDMVIVRENTED-LYIKIEKTYTDPATGTRVAEATKRIS
EVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGK
IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDL
GGKSTTQQVVDDILSKI--
>ZYRO0A01914g
-MFRSSVAKVA--ARRAY----SAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQ
FDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKE
LGLYANVRPVKSVEKGN-DRNVDMIIVRENTED-LYIKTEKTYVDEATGTRVAEAIKRIS
EVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE
VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDL
GGKATTQQVVDDILSKI--
>KNAG0A05420
MMLRSAANKLA--GCRGL-ATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLN
FDFIDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKA
MGLYANIRPVKSVEGSN-ERPVDMIIVRENTED-LYIKIEKTYIDKATGTRVAEATKRIS
EIATQRIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAG
ITYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADL
GGNATTQNVVDDILARL--
>TDEL0G02180
-MLRSAIGRLA--TRRAY---ASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLN
FDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE
LGLYANVRPVKSVEGTK-DRPVDMVIVRENTED-LYIKLEKTYVDKATGTRVAEATKRIS
EVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ
VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDL
GGNSTTQQVVEDILSKL--
>Suva_9.105
-MFRSVATRIS--ACRGL-ASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLS
FNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRRE
MGLYANVRPVKSVEGTK-DKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADAIKRIS
EVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ
IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVI
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDL
GGKASTQQVVDDVLSRL--
>Skud_9.79
-MFRSVATRVS--ACRGL-ATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLS
FNFIDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRRE
MGLFANVRPVKSVEGSR-NKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRIS
EIATRRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQ
IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDL
GGKASTQQVVDDVLSRL--
>Smik_9.85
-MLRSVATRLS--TCRGL-ATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLS
FNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRRE
MGLFANVRPVKSVEGGK-DKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRIS
EIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ
IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDL
GGKASTQQVVEDVLSRL--
>YIL094C
-MFRSVATRLS--ACRGL-ASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLS
FNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRRE
MGLFANVRPVKSVEGEK-GKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRIS
EIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ
IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDL
GGKASTQQVVDDVLSRL--
>NDAI0B03550
-MLRTTASRLA--TCRGY-ATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLN
FDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE
MGLYANVRPVKSVEGTT-DKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRIS
EIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ
INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDL
GGKSTTQEVTEDVLARL--
>NCAS0B06250
-MLRTAASRFATSTCRTY-ATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLK
FDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKE
MGLFANVRPVKSVSGTK-DRPVDMVIVRENTED-LYIKIEKTYIDKATGTRVAEATKRIS
EIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGS
ITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI
GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDL
GGNSTTQQVTEDVLARL--