MUSCLE (3.8) multiple sequence alignment

TPHA0D01540        MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLY--PELTCLKRV
Kpol_1039.33       MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPA--TNIACLKRV
TBLA0B06940        MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV
CAGL0J03432g       MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLG--TNMAVLKRV
KLTH0G10318g       MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSP--AKIACLKRV
Kwal_27.11542      MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSI--GNVACLKRV
KNAG0A05430        MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN--SNIACLKRV
ADL217W            MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQG--S-LACLKRV
TBLA0B05930        MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPING--MNLACLKRV
ZYRO0A01848g       MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTG--TNKVCLKRV
Ecym_3323          MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV---KDVACLKRV
Kpol_1003.35       MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTG--SDIVCLKRL
TPHA0C03380        MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSG--SNIACLKRV
KLLA0E08405g       MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCP--DNVACLKRV
SAKL0E07722g       MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS---SSIACLKRV
CAGL0G02607g       MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNG--SNVACLKRV
Suva_14.327        MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTN--SNVACLKRV
Smik_14.311        MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTN--TNVACLKRV
Skud_14.309        MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSH--SNIACLKRV
YNL020C            MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSN--SSVACLKRV
NDAI0B03560        MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSK--SNVACLKRV
KNAG0H02020        MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSG--TNIACLKRV
NCAS0B06260        MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNN--SQTACLKRV
KAFR0J01370        MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN--SNIACLKRV
NDAI0G00640        MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFIN--SSIVCLKRV
Smik_9.84          MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN--ANIACLKRV
YIL095W            MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANIACLKRV
Skud_9.78          MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANTACLKRV
Suva_9.104         MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSS--ANIACLKRV
TDEL0G02150        MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFID--SNVACLKRV
NCAS0G03810        MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTN--TNVACLKRV
KAFR0H03330        MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCD--SNIACLKRV
                   *.         .  : :. *   : .*::.**:*::*   :             . ***:

TPHA0D01540        IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRL----QNSEDSYVVLLLMEYCSG
Kpol_1039.33       VVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKH----SGHTGSYEVFVLMEYCSG
TBLA0B06940        IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRS----ELKQGEYEVFLLMEYCSR
CAGL0J03432g       IVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKS----QYMDGTYEVFLIMEYCSR
KLTH0G10318g       LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKS----GVHDGSYEVFLLMEYCSG
Kwal_27.11542      LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKS----GAQDGSYEVFLLMEYCSA
KNAG0A05430        IVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKS----EFGNGSYEVFLLMEYCER
ADL217W            HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKS----PRHDGTYEVYLLMEYCLR
TBLA0B05930        IVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARS----ISNDGTYEVLQLMEFCPG
ZYRO0A01848g       IIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARS----LLQNGTYEVFLLMEFCTA
Ecym_3323          HVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKS----VLNNGSYEVVLLMEYCSR
Kpol_1003.35       IVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKS----GLHNGAYEVLLLMEFCAE
TPHA0C03380        IVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSG
KLLA0E08405g       VVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKS----PVNVGMYEVYLLMEYCSG
SAKL0E07722g       LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKS----SLNNGSYEVFLLMEYCAR
CAGL0G02607g       KVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRS----PTNDGTYEVFLLMEYCEG
Suva_14.327        IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKA----TLHNGSYEVFVLMEYCER
Smik_14.311        IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKA----ILQNGSYEVFVLMEYCER
Skud_14.309        IVPDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKA----MLHNGSYEVFVLMEYCER
YNL020C            IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKA----MLHNGSYEVFVLMEYCER
NDAI0B03560        IVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKS----AFNNGSYEVLLLMEYCEG
KNAG0H02020        IVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKS----SFQNGTYEVFLLMEYCEN
NCAS0B06260        IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARS----TVLAGAYEVFLLMEYCKG
KAFR0J01370        IVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKS----AIYNGAYEVFVLMEFCER
NDAI0G00640        IVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKF----DTNIGSYEVFLLMEYCDR
Smik_9.84          IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEFCER
YIL095W            IVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-----VNGIAYEVFVLMEFCER
Skud_9.78          IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGIAYEVFVLMEFCER
Suva_9.104         IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEYCER
TDEL0G02150        IVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKS----SFPNGSYEVFLLMEYCAG
NCAS0G03810        IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKF----NPNEGSYEVFLLMEYCDM
KAFR0H03330        IVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKS----NFNNGSYEVFLLMEYCER
                    :* *  **  *:**:::. *     :* ****:* .           * *  :**:*  

TPHA0D01540        AGLLDFMNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFK
Kpol_1039.33       GSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYK
TBLA0B06940        GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK
CAGL0J03432g       GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK
KLTH0G10318g       GGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK
Kwal_27.11542      GGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK
KNAG0A05430        GSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFK
ADL217W            GGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFK
TBLA0B05930        GGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK
ZYRO0A01848g       GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK
Ecym_3323          GGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCK
Kpol_1003.35       GGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYK
TPHA0C03380        KGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK
KLLA0E08405g       GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK
SAKL0E07722g       GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK
CAGL0G02607g       GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK
Suva_14.327        GGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK
Smik_14.311        GGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK
Skud_14.309        GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK
YNL020C            GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK
NDAI0B03560        GGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFK
KNAG0H02020        GGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFK
NCAS0B06260        GGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK
KAFR0J01370        GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK
NDAI0G00640        GGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK
Smik_9.84          GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK
YIL095W            GGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYK
Skud_9.78          GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK
Suva_9.104         GGLIDFMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYK
TDEL0G02150        GGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK
NCAS0G03810        GGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK
KAFR0H03330        GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK
                    .::.*:* .*  ** * *:: *      *:  ** * * *:********:* :     *

TPHA0D01540        LCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKS---DIWA
Kpol_1039.33       VCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKS---DIWA
TBLA0B06940        ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKS---DIWA
CAGL0J03432g       LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS---DIWA
KLTH0G10318g       VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKS---DIWA
Kwal_27.11542      VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKS---DIWA
KNAG0A05430        VCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWC
ADL217W            VCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKS---DIWA
TBLA0B05930        VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS---DIWA
ZYRO0A01848g       VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS---DIWA
Ecym_3323          VCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKS---DIWA
Kpol_1003.35       LCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKS---DIWA
TPHA0C03380        LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS---DIWA
KLLA0E08405g       LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKS---DIWA
SAKL0E07722g       VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKS---DIWA
CAGL0G02607g       VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKA---DIWA
Suva_14.327        LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKS---DIWA
Smik_14.311        LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKS---DIWA
Skud_14.309        LCDFGSVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKS---DIWA
YNL020C            LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKS---DIWA
NDAI0B03560        LCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKS---DIWA
KNAG0H02020        LCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKS---DIWA
NCAS0B06260        ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKS---DIWA
KAFR0J01370        VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKS---DIWA
NDAI0G00640        LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKS---DIWA
Smik_9.84          VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWA
YIL095W            VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWA
Skud_9.78          VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS---DIWA
Suva_9.104         VCDFGSVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWA
TDEL0G02150        VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS---DIWA
NCAS0G03810        VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKS---DIWA
KAFR0H03330        ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKS---DIWA
                   :*****... :* * .  *   :  *:: .******.***:.      :: *    . *.

TPHA0D01540        LGILLYKLCYYTTPFEEH-GSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNIC
Kpol_1039.33       LGVFLFKLCYYTTPFEKE-GEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNIC
TBLA0B06940        LGVFLYKLCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC
CAGL0J03432g       LGVFLYKLCYYTTPFEQT-GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF
KLTH0G10318g       LGVFLYKLCYYTTPFEKV-GEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNIC
Kwal_27.11542      LGVFLYKLCYYTTPFEKV-GDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNIC
KNAG0A05430        VALQIMLLHY---TFRED-REVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNIC
ADL217W            LGVFLYKVCYFTTPFEKV-GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNIC
TBLA0B05930        LGVFLYKICYYTTPFENG-GERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVC
ZYRO0A01848g       LGIFLYKLCYYTTPFEKG-GDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNIC
Ecym_3323          LGVFLYKLCYYTTPFEKT-GEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSC
Kpol_1003.35       LGVFLYKLCYYTTPFEKA-GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC
TPHA0C03380        LGVFLYKVCYYTTPFEKE-GENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNIC
KLLA0E08405g       LGVFLYKTCYYTTPFEKN-GESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNIC
SAKL0E07722g       LGVFLYKLCYYTTPFEKA-GEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNIC
CAGL0G02607g       LGVFLYKLCYYTTPFEKL-GEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVC
Suva_14.327        LGIFLYKLCYYTTPFEKG-GEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF
Smik_14.311        LGIFLYKLCYYTTPFEKG-GEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF
Skud_14.309        LGIFLYKLCYYTTPFEKG-GEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVY
YNL020C            LGIFLYKLCYYTTPFEKG-GDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVY
NDAI0B03560        LGVFLYKLCYYTTPFEKT-GENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNIC
KNAG0H02020        LGVFLYKICYYTTPFEKS-GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIY
NCAS0B06260        LGVFLYKLCYYTTPFEKG-GEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC
KAFR0J01370        LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC
NDAI0G00640        LGVFLYKLCYYTTPFEKT-GENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIY
Smik_9.84          LGIFLYKICYYTTPFEKS-GEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC
YIL095W            LGVFLYKICYYTTPFEKS-GEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNIC
Skud_9.78          LGVFLYKICYYTTPFEKS-GEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC
Suva_9.104         LGVFLYKICYYTTPFEKT-GEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNIC
TDEL0G02150        LGVFLYKLCYYTTPFEKG-GELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVC
NCAS0G03810        LGVFLYKLCYYTTPFEKN-GEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSY
KAFR0H03330        IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIY
                   :.: :    *   .* :   . .*:     :   * *:. :. ::   *   *  **.  

TPHA0D01540        QLLEELFRIQHKSSPLPNFYVQRAMSSLQMDTTQPHR-I---------------------
Kpol_1039.33       QLIEELSRLQGIVPPMKNFYLSRALETSSLMQPLQN------------------------
TBLA0B06940        QVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQCNSLS
CAGL0J03432g       QIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNT--------------------------
KLTH0G10318g       QVLEEVSRIQGTPCPLRNFYVTRAMQQQQQHQ------Q---------------------
Kwal_27.11542      QVLEEVSRIQNVPCPLRNFYLLRSMQQQQQQHQQQQQTF---------------------
KNAG0A05430        QLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSR---------------------
ADL217W            QVLEEVSRIQGVPCPLPNFYLERMKHGACTPVHHSASQP---------------------
TBLA0B05930        QVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNTNGSIY---------------------
ZYRO0A01848g       QVLEEVSRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPV---------------------
Ecym_3323          QVLEEVCRIQGQPCPVKNFYLERSLKQQIPSQLRHSVSQ---------------------
Kpol_1003.35       QVLEEVSRLQGIPCPIKNFYLERAIHRSTLMPHQQQNNH---------------------
TPHA0C03380        QVVEEVSRLQGVPCPLKNFYLERAIRQTAVQD----------------------------
KLLA0E08405g       QVVEEVSRIQGIPCPIKNFYLLRMMDKQEQPRVSPPPHV---------------------
SAKL0E07722g       QLLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQP---------------------
CAGL0G02607g       QVLEEVSRMQNVPCPIRNFYLLRAMEKVK-------------------------------
Suva_14.327        QLLKQITNMQNAPYPIRDV-----------------------------------------
Smik_14.311        QLLKRISIMQNVPCPINDI-----------------------------------------
Skud_14.309        QLLKRISIMQNVPCPISDI-----------------------------------------
YNL020C            QLLKRISIMQNVPCPINDI-----------------------------------------
NDAI0B03560        ELLEEISSIQGVPCPIQNFYLIRAQQLANQIQLQRQTTV---------------------
KNAG0H02020        DVVKELSDMKNISCPIINFYLKPNMTDAS-------------------------------
NCAS0B06260        QLLEEISRIQGIPCPINNFYLSRTINVQASLMNPIITPT---------------------
KAFR0J01370        QVLEEVSRLQGIPCPIRNFYLLRAMENNKRTIEQPVQNV---------------------
NDAI0G00640        QLLEEVSKIQNVPCPIPDFYLQRKLAQAQAQTQAQD------------------------
Smik_9.84          QVLEEVSRLQIKPCPIRNFYLLRAMSQTA--QLASEPPS---------------------
YIL095W            QVLEEVSRLQNKPCPIRNFYLLRAMNQNANTQLAGEPSS---------------------
Skud_9.78          QVLEEVSRLQNEPCPIRNFYLLRAMGQNA--QLASEPPS---------------------
Suva_9.104         QVLEEVSRLQNRPCPIRNFYLLRAMNQNA--QFGSESTS---------------------
TDEL0G02150        QVLEDVSRMQGIQCPVRNFYLLRAMEQQQ-------------------------------
NCAS0G03810        QVLEEVSSMQNVQCPIPNFYLMNNNVTQGQMA----------------------------
KAFR0H03330        QVIEEISKMQNVPCPIVNFYL---------------------------------------
                   :::  :  :     *: :.                                         

TPHA0D01540        ------------------------------------------------------------
Kpol_1039.33       ------------------------------------------------------------
TBLA0B06940        PTNSSTRRNSTFSDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKFIASASV
CAGL0J03432g       ------------------------------------------------------------
KLTH0G10318g       ------------------------------------------------------------
Kwal_27.11542      ------------------------------------------------------------
KNAG0A05430        ------------------------------------------------------------
ADL217W            ------------------------------------------------------------
TBLA0B05930        ------------------------------------------------------------
ZYRO0A01848g       ------------------------------------------------------------
Ecym_3323          ------------------------------------------------------------
Kpol_1003.35       ------------------------------------------------------------
TPHA0C03380        ------------------------------------------------------------
KLLA0E08405g       ------------------------------------------------------------
SAKL0E07722g       ------------------------------------------------------------
CAGL0G02607g       ------------------------------------------------------------
Suva_14.327        ------------------------------------------------------------
Smik_14.311        ------------------------------------------------------------
Skud_14.309        ------------------------------------------------------------
YNL020C            ------------------------------------------------------------
NDAI0B03560        ------------------------------------------------------------
KNAG0H02020        ------------------------------------------------------------
NCAS0B06260        ------------------------------------------------------------
KAFR0J01370        ------------------------------------------------------------
NDAI0G00640        ------------------------------------------------------------
Smik_9.84          ------------------------------------------------------------
YIL095W            ------------------------------------------------------------
Skud_9.78          ------------------------------------------------------------
Suva_9.104         ------------------------------------------------------------
TDEL0G02150        ------------------------------------------------------------
NCAS0G03810        ------------------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ------------------------------------------------------------
Kpol_1039.33       ------------------------------------------------------------
TBLA0B06940        SPNNINSSSPISNSYIPSISSIPNLNLSESPITLNSLPFSTSPLSLAPVPINGPNTKGQS
CAGL0J03432g       ------------------------------------------------------------
KLTH0G10318g       ------------------------------------------------------------
Kwal_27.11542      ------------------------------------------------------------
KNAG0A05430        ------------------------------------------------------------
ADL217W            ------------------------------------------------------------
TBLA0B05930        ------------------------------------------------------------
ZYRO0A01848g       ------------------------------------------------------------
Ecym_3323          ------------------------------------------------------------
Kpol_1003.35       ------------------------------------------------------------
TPHA0C03380        ------------------------------------------------------------
KLLA0E08405g       ------------------------------------------------------------
SAKL0E07722g       ------------------------------------------------------------
CAGL0G02607g       ------------------------------------------------------------
Suva_14.327        ------------------------------------------------------------
Smik_14.311        ------------------------------------------------------------
Skud_14.309        ------------------------------------------------------------
YNL020C            ------------------------------------------------------------
NDAI0B03560        ------------------------------------------------------------
KNAG0H02020        ------------------------------------------------------------
NCAS0B06260        ------------------------------------------------------------
KAFR0J01370        ------------------------------------------------------------
NDAI0G00640        ------------------------------------------------------------
Smik_9.84          ------------------------------------------------------------
YIL095W            ------------------------------------------------------------
Skud_9.78          ------------------------------------------------------------
Suva_9.104         ------------------------------------------------------------
TDEL0G02150        ------------------------------------------------------------
NCAS0G03810        ------------------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        -------PILKY---------------------TQMSKPVISSQSSPSKHCQTFSQKDYP
Kpol_1039.33       ---------------------------------NSYKVPISDIQDKHKRQIPNI--QSSP
TBLA0B06940        PTNSYISPTLTPIPGTLTKNTLPLPLPNSPTLNLSLPQPIPEIKVSPLYNSASMPNTNLT
CAGL0J03432g       ---------------------------------GNMSINGYYKPMNQN------------
KLTH0G10318g       -------PKIKFDHSASQPK-------------LDSANNIINVPFKMSHNQPLR--STQT
Kwal_27.11542      -------PSVEVHHSLSQPR-------------MDLKNGPVLTPFKHAQSSALR--TSKT
KNAG0A05430        -------ANTTQFTDQSAKET------------TAIRVGKEISPLKPQLSPIKS---SYG
ADL217W            -------ALPLATHQFSTSTPMV----------THPQPPANQMSPLPHGIQPIT--SNMV
TBLA0B05930        -------PIPTQNTMM-----------------NQMPPPMNMMNNSQIAAQHSS--NMMP
ZYRO0A01848g       -------SMVNTN--------------------TFMAPPAQVAPLTPAQSLGAN------
Ecym_3323          -------PMIAMNP-------------------QQAKIPIVIPQVQNSVLPSNT--MNMG
Kpol_1003.35       -------HHHQQQQQQQLQQQQ-----------QQIQQQQQQIQQQFHIHQEQI--RGLH
TPHA0C03380        ---------------------------------NHFNHQMEQFPPLHLQHSISS------
KLLA0E08405g       -------PQMTVPATVPTSVSTQHLPPQVV---SNVQTPSKTASIQHLPYLHVS--KSQP
SAKL0E07722g       -------LRHSV---------------------SQPQMEAITLPITLQPHPQKV--LASA
CAGL0G02607g       ---------------------------------LSTEIDYPQLQLQKLRNAQAD------
Suva_14.327        ---------------------------------QTVQRPSNHLNLMELHQNSAT------
Smik_14.311        ---------------------------------QTVQAPSSHLNLTELHQLSAT------
Skud_14.309        ---------------------------------QVPQAPDSHLNLTELHQLSAT------
YNL020C            ---------------------------------QVVQAPSSHLNLTELHQLSAT--QNI-
NDAI0B03560        -------PKIATAQPI-----------------QQLNARTQTMPIINTKANTSL------
KNAG0H02020        ---------------------------------NNIQHLHSIMNNTNTSTVQIQ------
NCAS0B06260        -------QQTALKHSQSS---------------ATISDQSYAVPLASSRSSTTT--GNKP
KAFR0J01370        ---------YMPTTLSQPSTQMNLASLNDTLPTAALKFNQTTIPPTNQHSPHLLHTQTLP
NDAI0G00640        ---------------------------------VVMNVPIPSYPVAIPAITNNN--GSYN
Smik_9.84          -------MKYVPTQKFLPAQGL-----------QSMKPISNMIPVSHVRTTPNL--STLP
YIL095W            -------TTYVPTQKFIPVQSL-----------QSINQPPNMMPVTHVSTTPNL--GTFP
Skud_9.78          -------VTYVSAQQLLPAQTL-----------QGIKHLQSMVPVTHVRTTPNL--GTLT
Suva_9.104         -------MTYTPAQQLVSPQSF-----------QNIQAMPNIVPLSNIKTTPNL--DSAS
TDEL0G02150        ---------------------------------QSTQNQLRYSRTQPVLNVPII------
NCAS0G03810        ---------------------------------MQTQPQNNGAMMASPNMQPYVPNNNFV
KAFR0H03330        ---------------------------------VTQQQKHKMVQLQPIPVNTLN------
                                                                               

TPHA0D01540        YIQPNLSNSARAKDYYLGGSSSTDTLESSLSKQLSEDR----------------------
Kpol_1039.33       EKLPSIQSTSNGMTTNKILTRQTSPDIENLKSKSSSNY-------------------YKS
TBLA0B06940        KPMPFSLPPNIDLSSKNLNLPELPSLNSTLSSPSHSPQLSTVADTPYLANIGSASPTTSI
CAGL0J03432g       ---------------------------SGISTPHSAGK----------------------
KLTH0G10318g       FAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIE---------------GN--KAL
Kwal_27.11542      FDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSID---------------RR--TVL
KNAG0A05430        PVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSL----------------------
ADL217W            YMMHNTTPNIKD---------------IPRENPAATIQ---------------KN---AL
TBLA0B05930        ---------------------------QSIPQPLYTNY----------------------
ZYRO0A01848g       ---------------------GMPVGVTPQPMPIMAKT----------------------
Ecym_3323          YVTGAFQPASQPNEVR-----------GDTALRVSKAK---------------LL--STA
Kpol_1003.35       QSLSF----------------------PSLNSPLHNAQ---------------NI-----
TPHA0C03380        ------------------------PALSTVNNNIGLSN----------------------
KLLA0E08405g       MVTQQDLLSQKQPAGKTVP---QTVSNYTSSDPFSKID---------------RS--ALL
SAKL0E07722g       QVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLD---------------------K
CAGL0G02607g       ----------------------------NLSNPMIKPM---------------PI-----
Suva_14.327        ------------------------QNIQSLNSHSINEN----------------------
Smik_14.311        ------------------------QNIQSLNSHLVMGN----------------------
Skud_14.309        ------------------------QNIRSLNSHSTIER----------------------
YNL020C            ---------------------------LSLNSPTTMEN----------------------
NDAI0B03560        --------------------------VTPITVPVLSEN---------------TRLPALE
KNAG0H02020        --------------------------QQQLQLQLRQQQ----------------------
NCAS0B06260        ILIETEIPDMSQGSDDV----------YSRIHPFQKSQ----------------------
KAFR0J01370        LPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTSNK-------------------NVI
NDAI0G00640        YNMSIASATINPQNAN---------NNNTNNNPYTVAS----------------------
Smik_9.84          RSIDDNNMTDVTKQISLQF-VGD----SNVDTPLKKTK---------------SV--PLS
YIL095W            ISINDNNKTEVTAHAGLQV-GSH----SNLTSPLMKTK---------------SV--PLS
Skud_9.78          KAITNNNQTESILPVRTQP-ESD----LNLGNPLMKTK---------------SV--PLS
Suva_9.104         NFVNNNNKMEAMLQLRTQKLETG----PNFSIPLTKTK---------------SV--PLS
TDEL0G02150        --------------------------SQPVGFPMHQIS----------------------
NCAS0G03810        YNTPNAVSMNDIQMMNAINLKVNSTHNTGMIPPTMATN----------------------
KAFR0H03330        ---------------------------VSQTHPILQDG----------------------
                                                                               

TPHA0D01540        -VYDVNVNTMDSHCTYRRKLTPNYDHALKKGSSPSINDNSTLNNMT--SLKHEHSFNSRE
Kpol_1039.33       GKNYGSEAITSGSIEKDSQFNNSNLYSEKPNLYYRSKDQLDTSNRENSTINDVPGQIEKY
TBLA0B06940        SNRLQFFTTSRHGSISSKIAHHNNNTINTSHLQPSPQMSPPLSPQLLTYMPLPLSPQISP
CAGL0J03432g       ---------------------------MLAGFQNDMPKPSTKLGKQ--ELFSRSKTVPND
KLTH0G10318g       QSKQTPHFQPPISHDFNRLGR-SQTFTPTSTLASRSSVSPPLAGRG--DISKIISANPTN
Kwal_27.11542      QEKIPLQPASADFQRLSRAQT----FVPVTKSPKRSSASPSFGGRG--DISMIVSANPTN
KNAG0A05430        -------------EDGNNGLENHYLSSSVPAISYLANQHANDNIRN--TTKLNIPAQNST
ADL217W            YSMSGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIPRN--EIQKFLSGTPPT
TBLA0B05930        ---------SNNSMNANMNMSPNYAYPTSPIMSQGLFTGPTLHHNLTSPISQPKSKSENT
ZYRO0A01848g       ----------------------------RSGISTGGNIFPGAANPM--VVPTQLGPAQVA
Ecym_3323          CDWDKTQNFVPGSNYNSKASVESGHLPTSSLPTPRSSVSPVRSGRG--NINKIIAANPIN
Kpol_1003.35       -----------------------------TPNNVILTGVPLSAHAS--NDPAVVNNSFNV
TPHA0C03380        ---------------INFLQNVNNSAIQTANTTSRINNNPYSL-----HNSSTLQNTPQT
KLLA0E08405g       STSATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRG--AISSILASNRTS
SAKL0E07722g       SNLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRG--DISKILKSNPTS
CAGL0G02607g       ------------------------------------AQRPTFSGNG----MVNNNRTLPT
Suva_14.327        -----------------------------------SMSNQNFQFRM--PANVITAQSLPT
Smik_14.311        -------------------------------------SIPTTAFQFSTPVNMATAQTLPI
Skud_14.309        ---------------------------PIPNAAFQSSMPDAATQ----TLFSRKKSQTSD
YNL020C            ---------------------------TMPNATFQISMADNTTTAQ--MHPNRKPSQIAY
NDAI0B03560        LDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASVSPIRR-----YISRSPSRDNTN
KNAG0H02020        ------------------------------------------------QVKVCRQQTPSQ
NCAS0B06260        -----------------------------TLRTPSRSSSPIKYTGT--LLQKSTSSNSNT
KAFR0J01370        DTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQ--KSWKSINDNYDV
NDAI0G00640        ---------------------------NNVTGILQSINAPLLNVPL--QPNRPISSQKKH
Smik_9.84          DDFASLYYRELHPFQKSQTFK----SVENFQSPQRRSMPPSSLPPA--NSIILDKT--PT
YIL095W            DEFASLYYKELHPFQKSQTFK----SVESFQSPQRKSMPPLSLTPV--NNDIFDRV--SA
Skud_9.78          DDFASLYYRELHPFQKSQTFK----SVESFQSPQRKLSTPSSSSPV--NSKNNDRASTST
Suva_9.104         DDFTSLYYKELHPFQKPHTFK----SVEGSQSPQRK-SIPFSPTPV--NSNNYDRV--ST
TDEL0G02150        ---------------------------GAPLGSSTSHIVPSNSVPI--LAARPRSAGSNG
NCAS0G03810        -----------------------MARTIPMQPVQKSQTLPVSSIPT--NLQNTNKSSPFN
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        AYIHPDF-----------------------------------------------------
Kpol_1039.33       GDWSSVY-----------------------------------------------------
TBLA0B06940        QSIPPALPPKLPIDNTLTLQQQFHTYQQQKQAQKITKLPNVSDSVTIGHSGNLGKIFKDS
CAGL0J03432g       IGGLNER-----------------------------------------------------
KLTH0G10318g       VEPSPIY-----------------------------------------------------
Kwal_27.11542      VDPTPIY-----------------------------------------------------
KNAG0A05430        GSKNKTY-----------------------------------------------------
ADL217W            SAKKPTY-----------------------------------------------------
TBLA0B05930        TGNDDPF-----------------------------------------------------
ZYRO0A01848g       GPVP--------------------------------------------------------
Ecym_3323          IKRP-VY-----------------------------------------------------
Kpol_1003.35       AATAKLQ-----------------------------------------------------
TPHA0C03380        IAADRRYPV---------------------------------------------------
KLLA0E08405g       LDRP-KY-----------------------------------------------------
SAKL0E07722g       VDRLSSY-----------------------------------------------------
CAGL0G02607g       VMVSNNV-----------------------------------------------------
Suva_14.327        RENSQAF-----------------------------------------------------
Smik_14.311        KEESNIF-----------------------------------------------------
Skud_14.309        NTTLNYS-----------------------------------------------------
YNL020C            DASFSNS-----------------------------------------------------
NDAI0B03560        YDIQRRR-----------------------------------------------------
KNAG0H02020        IEAPQLY-----------------------------------------------------
NCAS0B06260        SGNKSHY-----------------------------------------------------
KAFR0J01370        SKRPTNY-----------------------------------------------------
NDAI0G00640        IQKSQTMP----------------------------------------------------
Smik_9.84          MNRPNNY-----------------------------------------------------
YIL095W            INRPNNY-----------------------------------------------------
Skud_9.78          VDRPNNY-----------------------------------------------------
Suva_9.104         INRPNNY-----------------------------------------------------
TDEL0G02150        TGRSFQT-----------------------------------------------------
NCAS0G03810        LKSTTTY-----------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ------------------------------------------------------------
Kpol_1039.33       ------------------------------------------------------------
TBLA0B06940        LFDDNSAIDDSITVENTIQKDFTESCNSSNLINLDSNSASTPHLKLILTHDSLNNDSTID
CAGL0J03432g       ------------------------------------------------------------
KLTH0G10318g       ------------------------------------------------------------
Kwal_27.11542      ------------------------------------------------------------
KNAG0A05430        ------------------------------------------------------------
ADL217W            ------------------------------------------------------------
TBLA0B05930        ------------------------------------------------------------
ZYRO0A01848g       ------------------------------------------------------------
Ecym_3323          ------------------------------------------------------------
Kpol_1003.35       ------------------------------------------------------------
TPHA0C03380        ------------------------------------------------------------
KLLA0E08405g       ------------------------------------------------------------
SAKL0E07722g       ------------------------------------------------------------
CAGL0G02607g       ------------------------------------------------------------
Suva_14.327        ------------------------------------------------------------
Smik_14.311        ------------------------------------------------------------
Skud_14.309        ------------------------------------------------------------
YNL020C            ------------------------------------------------------------
NDAI0B03560        ------------------------------------------------------------
KNAG0H02020        ------------------------------------------------------------
NCAS0B06260        ------------------------------------------------------------
KAFR0J01370        ------------------------------------------------------------
NDAI0G00640        ------------------------------------------------------------
Smik_9.84          ------------------------------------------------------------
YIL095W            ------------------------------------------------------------
Skud_9.78          ------------------------------------------------------------
Suva_9.104         ------------------------------------------------------------
TDEL0G02150        ------------------------------------------------------------
NCAS0G03810        ------------------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ------------SGSKHFITSNDALNLNCRTPRSRDSSINSNSSVDSISRNSTGGSLIKS
Kpol_1039.33       ------------RKTRNSTLHIGRSRSSSLDSTSSSSLSVESYTAEPLSKNSTGISLVRT
TBLA0B06940        DTFAKKHDNLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQF
CAGL0J03432g       ------------SDISAFLLRKKAELEATPNPLESSKYIDDDSS----------------
KLTH0G10318g       ------------LSSGTQTDDGFASSH--ALKLERTKSIASLSSSESVESQHTGGSATRR
Kwal_27.11542      ------------LNSSVQTDNPGSDLYLSKQNTRLSESSTS--SSESIETQSTGGSFSRT
KNAG0A05430        ------------VDSETQTLEEPSLQHTRILPHISTDRTDN-----------TGNSIVSR
ADL217W            ------------VDSETQTGD-IITSNKSGSRPFAMSLSPL-SSPELFSEQSTGNSLLGR
TBLA0B05930        ------------AKLKDQALFNKVNANNTNTSVNDHSFNMYSTKQQNMANNFNNNN----
ZYRO0A01848g       ------------MGSQDMSSGILPPFNRASTLPTDGFSTGPGKDGGVITSA---------
Ecym_3323          ------------VDSEMQTTD-LASLKKANSRPLSLSLSSL-PSQESFSLHYTGISAVE-
Kpol_1003.35       ------------QIHIGTTDKNANILTNQRSRTMPDDQMSD----YIGRTTSAG------
TPHA0C03380        ------------STAPKQQHNIPAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRG
KLLA0E08405g       ------------VDSETQTSDHPSELGLSRSLSRKSVASSL-SSAESLEATSTGGSLTRK
SAKL0E07722g       ------------VDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRR
CAGL0G02607g       ------------IGNGSQVWDN----SKPPEPQPIPQSRSFVKSSTLI------------
Suva_14.327        ------------INATSSSLTGSPSIFETGVCNTLNIFNQPNTNP---------------
Smik_14.311        ------------YDPTSCNFAKDSQSRLNNALSRSPFELEAVSDLNNVKDEANS------
Skud_14.309        ------------AENPQTSLDKSESVSHVLDPLLFESGMSNTSKSLNRAKVSS-------
YNL020C            ------------AKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELKANS-------
NDAI0B03560        ------------TSQYDHDQNQSNYMGRSLSRTSSIKSTSALSFEGNLQGNNTGDSFAQK
KNAG0H02020        ------------MVTGSGDPLSNESLEGADMPVLSRSRSSGALKPMALNSH---------
NCAS0B06260        ------------VDSETQTFS---TSSRRLSRSSSVRSASS-RSSDQLKEHRTGGSITQF
KAFR0J01370        ------------VDEETQTYTGQSTFLRRTSSNRSNRSISS--QYSGVQENTTGSSLVRK
NDAI0G00640        ------------MPSMDANLKKSTCQLGHTTLSIPNKNNDVIQKRASVSSSRSSPLLQER
Smik_9.84          ------------VDSETQTTDIITMSGSKLSPALTNKPVNS-QKEFIAPENVSGGNIVRS
YIL095W            ------------VDSETQTIDNMAVPNLKLSPTITSKSLSS-TKEIAAPDNINGSKIVRS
Skud_9.78          ------------VDSVTQTIDNMAALNLNQSSVAINKPSGP-PKESIVPENVTGGSIVRS
Suva_9.104         ------------VDSETQTLDSIATLKLKPSPTISNKTTGF-SKESTVPENVTGGKIVRS
TDEL0G02150        ------------PSTSSLSAKSSQTFHRAASRSPVSTHLSTSPVRHG-------------
NCAS0G03810        ------------VDSETQTETPKQTLNKAISSNTEGFSLINEKN----------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        L-G-----------------TKIKLTTTGGKRSQSPIKSRQNT-GDSIRSAFNKVRQGIN
Kpol_1039.33       L-S-----------------KKLKNVITGEKRSVSPVRSRQNT-GGSSRSVFTVLHEGFT
TBLA0B06940        SSSEASAKVSSSKLNYKNQNTKIKVSTDSFSSTASPLSSRQNT-GDSIKSAFSKLRRSLS
CAGL0J03432g       --S-----------------TTSEDSFDDHASFISKTQSAHSV------STVDRFNAYLK
KLTH0G10318g       F-G-----------------QKLK-VFTGERRSISPIKSRQNT-GDSVRSAFATLRRGFS
Kwal_27.11542      F-G-----------------RRLKKVFTGEKRSISPIKSRQNT-GESVKSAFATLRRGFS
KNAG0A05430        L-G-----------------VQLRNVITNDSSASSSIDTVQET-GNSIKSAIESLKNSVS
ADL217W            L-S-----------------RKTIRSPTSD-KGSNPLKSKSSV-GDDLASLLSSPSRNLS
TBLA0B05930        --S-----------------NNMNPLMKQRSDRTRIFDMPQNKTPAMTQNSVNYLLPGHS
ZYRO0A01848g       --V-----------------NTGPETIKDRPFNYVDSETQTSD-AGSITTSKPYLHPSAV
Ecym_3323          --S-----------------SQQFQGPVTFDKNNLLVNSKSNT-GDSKSSSPELINRTLR
Kpol_1003.35       --R-----------------GDISKIVASNPTLFD------KT-SKSEVNSTGSLAENIA
TPHA0C03380        LHL-----------------SELQKSVTALNNDMNHIYSQKQEGGRGKISSILNSNPNSL
KLLA0E08405g       I-G-----------------SKMKKVITGEKRGFSTIRSAQNT-GESVKSAFNALRKGIS
SAKL0E07722g       I-G-----------------DKLKRIISNEPRNTSPIRSRQNT-GGSTRSAFSTLRRG-T
CAGL0G02607g       --G-----------------APLSKSWGHNEFNFGSISNSPSVFQGAIVPAANQLQNKDS
Suva_14.327        --T-----------------TKLKQAIDSEAHSFRK--------SDPINLSLPNIIPQDN
Smik_14.311        --T-----------------TRLKQTIVSEAHNFRQ--------NNSLNLSLPNMIPHND
Skud_14.309        --T-----------------TKLKQVIDSEAHNFRH--------NYTMNLPLRNIIPQDD
YNL020C            --A-----------------TKLKQAIVSEAHTFRQ--------NNSIDFPLQNIIPQYE
NDAI0B03560        F-T-----------------NKIKRVVTGESRNASPIRSRQDT-GGSVRSAFGAIRGAFT
KNAG0H02020        --R-----------------KYYEHNLNNQPQTPALPEKSQRQ-VLNKPIVLEDIDLSSS
NCAS0B06260        F-T-----------------STLKRVVTGESRNTSPIRSRQNT-GGSIRSAFDALRSGIT
KAFR0J01370        L-S-----------------VKLKNVLTGES-----IKSRQNT-GDSIRSAMNSIRSGFT
NDAI0G00640        IIS-----------------TDMSFSSDDDKDDDSSIHTDEQN----VKIDTQPLTHTIS
Smik_9.84          L-S-----------------SKLKKVITGESRGSSPIKSRQNT-GDSTRSALGMLRHGFT
YIL095W            L-S-----------------SKLKKVITGESRGNSPIKSRQNT-GDSIRSAFGKLRHGFT
Skud_9.78          L-S-----------------SKLKKVITGESRSSSPIKSRQNT-GDSIRSAFGMLRHGLT
Suva_9.104         L-S-----------------SKLKRVITGESRNGSPIKSRQNT-GDSIRSAFGMLRHGFT
TDEL0G02150        --R-----------------GNISQIVESNRTSFDRPRYVDSV-TQTSDTEEEPLKVASK
NCAS0G03810        --P-----------------NSVPMLSPSFSTSSSSSSSDENDSVDLRNKAYSPIRTPLK
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        LRSSRISS------------------NDSVVRNSEQFGGIPELS----------------
Kpol_1039.33       GGNSRISSSEH---------------TIRGPSSSSHKSRVSSST----------------
TBLA0B06940        SSNPSRIISSDTSSTRKNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESD
CAGL0J03432g       ANDSISEEDS----------------DESFMPGASHLNRFRSDT----------------
KLTH0G10318g       GGSFKSELPNKRNSL-----------DISSTSSHSNGFKFRVSS----------------
Kwal_27.11542      SGSHKGEQLSKKNTV-----------DVTTNGSSSNGYKFRVTS----------------
KNAG0A05430        GMANNVKALSVENARNHLERLG----SSYSIGSNNNIAKPNSAP----------------
ADL217W            FPAQSSKSSKRNSADL----------SSRKSPVLNK-------S----------------
TBLA0B05930        SEQ-----------------------SIRKSTSSTSLRNIQNGG----------------
ZYRO0A01848g       SSTRSLPAQNAD--------------HDSRPRSSSLDFKSAARK----------------
Ecym_3323          YSYHAPEPASWESSEMS---------SKKLPYLNAILKTPKSLS----------------
Kpol_1003.35       SIASEKISSLKNQNL-----------SQSSSTGSSHRSIIVNDG----------------
TPHA0C03380        DQSPTRAENNALSTKSSRVDLSVFN-DNDQPPYIKNVLPVEDDA----------------
KLLA0E08405g       SMQFTGDSSSRKSSL-----------EARKYRSTSGKSIPENTS----------------
SAKL0E07722g       SSNFSSDRSKRNSVDFS---------VRRLGSGGNKVRVSSSKS----------------
CAGL0G02607g       SHQPKPSGMMKKNEQLQVTSTFA---SSPNTRTRTNSQGSSLYI----------------
Suva_14.327        DSSSSSDESYTGDVDEL---------KKTRSLGSYSTHENAKGG----------------
Smik_14.311        DSSSSSDESYPGDTDEL---------KKTQSLSSYSTRSNTKRD----------------
Skud_14.309        DSSSSSDELYPEDVDK----------LEKTQSLGSYISRDNKKG----------------
YNL020C            DSSSSSDESYSGDVDEL---------KKTRSLGSYSTRGNIKKN----------------
NDAI0B03560        GSMRAPSLDNNTNNSMHNNSN-----NNTSRNSSYGRHNIITNP----------------
KNAG0H02020        SEDDDTEGSSIDDNIIN---------SINLPPNANKRLG---------------------
NCAS0B06260        GNTNSRVSSLAS--------------SVRNVSSSSKHSKHSDAD----------------
KAFR0J01370        GNNNNTRSASYDN-------------GKRLSSVNLHMHSAILEQ----------------
NDAI0G00640        K-------------------------TKSLFDNNDNVEHGRSLN----------------
Smik_9.84          GSSMNNNRSASFDSNNGSSNNNSV--NRRLGSSSTS-SLSVFNP----------------
YIL095W            GNSVNNSRSASFDNNNVNGNGNNT--NRRLVSSSTS-SFPKFNS----------------
Skud_9.78          GSSVSNNRTISFDSNNGNGNGNSV--NRRLASSSS--SSSNFNF----------------
Suva_9.104         GSSINNSRSTSFDNN----NANSV--NRRLTSSSSNPSSSNLNS----------------
TDEL0G02150        SSVSLPARESHAVAD-----------KSSVVRSSSLRSKSTSSE----------------
NCAS0G03810        SQLQDNDERIKKVIQVA---------KEGLSRSRTSLESEPTFK----------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ------------------------------------------------------------
Kpol_1039.33       ------------------------------------------------------------
TBLA0B06940        SSVYFSANSGSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLN
CAGL0J03432g       ------------------------------------------------------------
KLTH0G10318g       ------------------------------------------------------------
Kwal_27.11542      ------------------------------------------------------------
KNAG0A05430        ------------------------------------------------------------
ADL217W            ------------------------------------------------------------
TBLA0B05930        ------------------------------------------------------------
ZYRO0A01848g       ------------------------------------------------------------
Ecym_3323          ------------------------------------------------------------
Kpol_1003.35       ------------------------------------------------------------
TPHA0C03380        ------------------------------------------------------------
KLLA0E08405g       ------------------------------------------------------------
SAKL0E07722g       ------------------------------------------------------------
CAGL0G02607g       ------------------------------------------------------------
Suva_14.327        ------------------------------------------------------------
Smik_14.311        ------------------------------------------------------------
Skud_14.309        ------------------------------------------------------------
YNL020C            ------------------------------------------------------------
NDAI0B03560        ------------------------------------------------------------
KNAG0H02020        ------------------------------------------------------------
NCAS0B06260        ------------------------------------------------------------
KAFR0J01370        ------------------------------------------------------------
NDAI0G00640        ------------------------------------------------------------
Smik_9.84          ------------------------------------------------------------
YIL095W            ------------------------------------------------------------
Skud_9.78          ------------------------------------------------------------
Suva_9.104         ------------------------------------------------------------
TDEL0G02150        ------------------------------------------------------------
NCAS0G03810        ------------------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ------------------------------------------------------------
Kpol_1039.33       ------------------------------------------------------------
TBLA0B06940        SSLPKMSSVTDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVN
CAGL0J03432g       ------------------------------------------------------------
KLTH0G10318g       ------------------------------------------------------------
Kwal_27.11542      ------------------------------------------------------------
KNAG0A05430        ------------------------------------------------------------
ADL217W            ------------------------------------------------------------
TBLA0B05930        ------------------------------------------------------------
ZYRO0A01848g       ------------------------------------------------------------
Ecym_3323          ------------------------------------------------------------
Kpol_1003.35       ------------------------------------------------------------
TPHA0C03380        ------------------------------------------------------------
KLLA0E08405g       ------------------------------------------------------------
SAKL0E07722g       ------------------------------------------------------------
CAGL0G02607g       ------------------------------------------------------------
Suva_14.327        ------------------------------------------------------------
Smik_14.311        ------------------------------------------------------------
Skud_14.309        ------------------------------------------------------------
YNL020C            ------------------------------------------------------------
NDAI0B03560        ------------------------------------------------------------
KNAG0H02020        ------------------------------------------------------------
NCAS0B06260        ------------------------------------------------------------
KAFR0J01370        ------------------------------------------------------------
NDAI0G00640        ------------------------------------------------------------
Smik_9.84          ------------------------------------------------------------
YIL095W            ------------------------------------------------------------
Skud_9.78          ------------------------------------------------------------
Suva_9.104         ------------------------------------------------------------
TDEL0G02150        ------------------------------------------------------------
NCAS0G03810        ------------------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ---------------------NDNKYQFDTTSK-----NRHEYNSLSRKLSLSSQK----
Kpol_1039.33       ---------------------KNFEEGFIRKHV---------------------------
TBLA0B06940        ILQRIDHEISQPVNETEFIEEDDSKEHTNPFTR-DYSAKRDSFNTINSQRLSSLSSNSTR
CAGL0J03432g       ---------------------QETSNKRQTKDE-----ILLKRRSLPFTN----------
KLTH0G10318g       ---------------------SESIEEENVYPR-----FSHSRSSSSASIVSDLDQLQQD
Kwal_27.11542      ---------------------SDSIEEENSGFI-----YSHSRKASSTSIVSDLDSLQDD
KNAG0A05430        ---------------------IIPAVVTTHTSN-----SLKTAVSSPTHSELSDENELYD
ADL217W            ---------------------RIAMSYSGPEKS-----SATGLESSSSSLFGSQNGEHRP
TBLA0B05930        ---------------------NQVLSQIMFNNN-----KTGERTSSTSSVSAPSLSKNMV
ZYRO0A01848g       ---------------------KPADEEILENLI-----ALSNRRDDPNKRNSFNSFNSSP
Ecym_3323          ---------------------AAEVSESRRSEL-----ERDSLANVPINNEYAVD-----
Kpol_1003.35       ---------------------DLTKLEKVQTSK-----EFEADSPIP---VSKAKHHSLP
TPHA0C03380        ---------------------DDDIYTTKPFNSKLTDISLTSLQKEITELKMELSKNDSK
KLLA0E08405g       ---------------------SNTKSHRRSTSS---------FSFVPENNDYEL------
SAKL0E07722g       ---------------------IEEKGNTNKFEN-----KGHNRSVSTSSITSDLNKYEGK
CAGL0G02607g       ---------------------PTSSEYRTRHVH-----TGDNNSLKSSKLDSDKLDIAVQ
Suva_14.327        ---------------------ESVKGESVKASLTTSSSPGSSSALKPAKIESKRQSLPET
Smik_14.311        ---------------------QPVEEYLTSSSL-----PGSSFTAVHTKVNLDHKSSSFK
Skud_14.309        ---------------------ESVKESLTSSSL-----PGSSLTATPTKLDLKLETLPNS
YNL020C            ---------------------QSVKESLTSSSL-----PGTSFTPTSTKVNLKHENSPFK
NDAI0B03560        ---------------------IKEEDSRNMTKA-----KLAKRHTMPPGMLYDLENLEIE
KNAG0H02020        --------------------------------------GRRSVSIFNPKNDTDLKHIT--
NCAS0B06260        ---------------------DEPNKIKIRMKK-------AHRRSVPPNLYSDFYAN---
KAFR0J01370        ---------------------DDSDEFEMPRYN-----------SVSSNTLKDVEEHERR
NDAI0G00640        ---------------------KHATKREKHRSL-----PPLQRNTLKNNFDQMYD-----
Smik_9.84          ---------------------DTKRQEEIDKKQ-----KLENRRSMPSSILSDFDQHERI
YIL095W            ---------------------DTKRKEESDKNQ-----RLEKRRSMPPSILSDFDQHERN
Skud_9.78          ---------------------DTKRQDDLDKKQ-----KLENRRSMPPSILSDFDKHERN
Suva_9.104         ---------------------DTKRKEELDKKR-----KLEHRRSMPPSILSDFDQHERN
TDEL0G02150        ---------------------RPAV-------------APKQQVAVPHTKLEHIYAAKIP
NCAS0G03810        ---------------------KEKKNKVYNATL-----EKAKKHRSLPVMETTIKPDSTK
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ----QNSLNDSTSNDP---IILITN-----------------------------------
Kpol_1039.33       ----DIVEESAEPKVG---IKLKTT-----------------------------------
TBLA0B06940        KESVTANTSPEREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYSRDSIINNSNS
CAGL0J03432g       ----NEARRNQSTDSE---LDTLSK-----------------------------------
KLTH0G10318g       D---TGAKNYYKSHSP---VKVSAT-----------------------------------
Kwal_27.11542      SG--TNAKKYYRSHSP---VKLSGS-----------------------------------
KNAG0A05430        TLHLPDPKTSFQSPSP---LKYAVD-----------------------------------
ADL217W            PSS-TDRHKSNSTSFR---LVPT-------------------------------------
TBLA0B05930        PY--IPPNSFTSTNNA---MVFREN-----------------------------------
ZYRO0A01848g       IGQRSPTGGANVPTTPDSLARIKSN-----------------------------------
Ecym_3323          ----PDSGGYHPSSGG---LVSLLST----------------------------------
Kpol_1003.35       SNF-SSSIKIGNGEGT---LTTSDSN----------------------------------
TPHA0C03380        NAV-DSRSSFNSNAEP---SSELTNK----------------------------------
KLLA0E08405g       ----IEDIQKEKPKSS---LRRSSS-----------------------------------
SAKL0E07722g       AG--SVSRGYNQAHSP---IKMSAN-----------------------------------
CAGL0G02607g       RSP-SSRSDGSDFRLP---LNPN-------------------------------------
Suva_14.327        AF--VGVVDSGKDSLP---SDPKSNRPVKDSVSVSK------------------------
Smik_14.311        PTS-TNTVDGLKNNTL---SLSKNNLPAYDYVGGSK------------------------
Skud_14.309        TF--VNTVDNSKNSFR---NFSKSNPLAYDDVSVSR------------------------
YNL020C            STF-VNTIDNSKDDLN---KPSYEDLDVSK------------------------------
NDAI0B03560        NEG-YHASEYYRSHSP---TKPFVT-----------------------------------
KNAG0H02020        ----KANEKSKESSGP---KK---------------------------------------
NCAS0B06260        ----EDTPKLYSSNSP---VKLKSL-----------------------------------
KAFR0J01370        TVN-TSSREYYRSQSP---VRMSVN-----------------------------------
NDAI0G00640        ----DTTQSNSKSSTP---EKSILSN----------------------------------
Smik_9.84          NSR-TGSRDYYRSHSP---VKKIQTTSKSAPKPITKPVIG--------------------
YIL095W            NSR-TGSRDYYRSHSP---VKKTQASAKTTSKPTLIPDNG--------------------
Skud_9.78          NSR-TGSRDYYRSHSP---VKKNQTTPKTASRTTLKSDSS--------------------
Suva_9.104         NSR-TGSRDYYRSHSP---VKKTQTTPTTTTRPSLKSSNS--------------------
TDEL0G02150        TGR-QSLRQESEIEIP---LTSVRS-----------------------------------
NCAS0G03810        PIASKSEISFAEPAVK---SNSKSN-----------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        -------------LEAKKSIKDRVQALMKSSS-DNHVI--ISAHGYGKYT----------
Kpol_1039.33       -------------REAKDSIKRRVRELLLVSE-DEQYH--RTASGYGKYTDVQEIVTN--
TBLA0B06940        SKGDISSLRLVSNPDAKDLIKKRVMELLKNSETDNGVT--RTAHGYGKYTDKPNTSQNKA
CAGL0J03432g       -------------AEKKEQLRQRMMSALNASE-DVIKK-TKSRDGSVSNDNNYLLKSKLH
KLTH0G10318g       -------------QGSRSSIQKRVQDLLKNSQ-DSPVK--KTAHGYGMLSPGDEAAELAS
Kwal_27.11542      -------------SDARSSIQKRVQNLLKSSQ-DSPVK--KSAHGYGEVSEKEDKESPEQ
KNAG0A05430        -------------RKMKASIEKRVLNLLKNAE-DSPVK--KTAAGYGKYTKRPKMVSPTN
ADL217W            -------------KKGQTSIQERVHKLLATSA-QEDVS--KKASKKTTNSATSAKLEHQK
TBLA0B05930        -------------ESSKASIKLRVQNLLKTSN-SGNND--NSLRRTTSDTQNGS------
ZYRO0A01848g       -------------PDTKESIQKKVQSLLKAAE-DSPKN--KSTSEIVNIRTTTSS-----
Ecym_3323          -------------KNGQVSIQKRVHLLLANSD-AQELY--SSTNSEAVNSGNISVGNEEL
Kpol_1003.35       -------------QSDNNSIQDRMKNLIDNAD-NIPIN--KIASDYGKYTKSSDNFGKDS
TPHA0C03380        -------------TVKKNSITDRYLNSVGDNG-VTSVK--KTAEGYGKYTKVSDKEGSL-
KLLA0E08405g       -------------LKTSSSIQKRVKDLI-NAD-DIPNR--SSATGYGKYTDIGRKTDISD
SAKL0E07722g       -------------RESRNSIQKRVHDLLKNSQ-DSPVR--KTAPDFGEFSSFPQDHAADH
CAGL0G02607g       -------------SEKRKSIQLRVQHLLDNMS-SNEVK--KSAQGYGKYTDELSSTGTNI
Suva_14.327        -------------QDLKNSIQQRMINLLNSSE-ESFNA--RKKSRAKATEDEG-------
Smik_14.311        -------------QDLKNSIQQRMLEKLNSSE-ESFNA--RKISNVKEGGQEG-------
Skud_14.309        -------------QDLKNSIRQRMLDKLNSSE-ESFNA--RKMPKAKAS-----------
YNL020C            -------------QNLKNSIQQRMIDKLNSSE-ESFNA--RKMSKVKL------------
NDAI0B03560        -------------KTTRDNIQQRVQNLLSESE-QPMERNNIDTHHTNAVSHSMIPRNLNS
KNAG0H02020        -------------VFSKEEVRKRMMEKLKEKD-KGKN-----------------------
NCAS0B06260        -------------STQRESIQNRVKALLETFE-EEPST-IKTASGYGKYTDSEFITSPV-
KAFR0J01370        -------------REMKNSIQKRVQDLLKNAE-ENTTATVRTASGYGKYTDYNKNKDEIS
NDAI0G00640        -------------QETKEQIKKKMLEKL--------------------------------
Smik_9.84          --------DININQEKKESIQRRVHNLLKSSE-DPLTY--KSASGYGKYTDTDT---ETS
YIL095W            --------NVNINQEKKESIQRRVHNLLKSSD-DPVTY--KSASGYGKYTDIGT---ETS
Skud_9.78          --------DIDVKQVNKESIQRRVHNLLNNSE-DPLAH--KSASGYGKYTDVNA---EAS
Suva_9.104         --------DINIDQEKKESIQRRVHNLLNNSE-DSLSY--KSASGYGKYTDTEA---EST
TDEL0G02150        -------------REAKESIQRRVRDLLNSSE-DLPLS--KSEPKKDE------------
NCAS0G03810        -------------EETKILIKQKMLEKLNASQ-NQFKK--KSIP----------------
KAFR0H03330        --------------------KQRILEQHSSSP----------------------------
                                         .                                     

TPHA0D01540        --------------------DNKSSIKHFKSNIEHLT-----------------------
Kpol_1039.33       --------------------IMTPLVKSTQKTPIDSK-----------------------
TBLA0B06940        PQRTISMDFFEKQAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARH
CAGL0J03432g       --------------------GRRDNEQRFSSVVVNPL-----------------------
KLTH0G10318g       ----------------QL--TNETMLQNVHQSTASTP------KVLSPA-----------
Kwal_27.11542      ----------------FTGKPAVAEARPIKRTVVPPP------KRYSSV-----------
KNAG0A05430        --------------------PHYHLVRQNSVSQTPLILSARGSSGHPVV-----------
ADL217W            --------------------GDEQSISTGSMSKIDAI------SMD--------------
TBLA0B05930        --------------------QSNNSLRKVNTHQVDSN-----------------------
ZYRO0A01848g       --------------------FSENGLRKTTSNVENGK------STTRSI-----------
Ecym_3323          --------------------NSDDNIKPEKPPVMPVS------RSKSQF-----------
Kpol_1003.35       --------------------GEEMNDKENIKTANSGT------RNQP-------------
TPHA0C03380        --------------------TSVNTAKPLESGHKSEN-----------------------
KLLA0E08405g       --------------------HHKSNANRKSSTVITPV-----------------------
SAKL0E07722g       ----------------T---ISDKVIDVHNVTSSPVV-----QKATLDT-----------
CAGL0G02607g       --------------------PKVTPDSPVLADLIDFN-----------------------
Suva_14.327        --------------------PGKPIASILRTPVLKEK-----------------------
Smik_14.311        --------------------TNIPIILKSKASTLKDK-----------------------
Skud_14.309        --------------------EKESTGKPIALKPGIST-----------------------
YNL020C            --------------------HEKGEIDKPTMLKSSGP-----------------------
NDAI0B03560        --------------------REKDSLRYSSVVINPLE-----------------------
KNAG0H02020        --------------------TTEPVSRSISTTPRKAP-----------------------
NCAS0B06260        --------------------PERGGRIPTPTNKRYSS-----------------------
KAFR0J01370        --------------------PTKSRVAQFNQSTAALA-----------------------
NDAI0G00640        --------------------QRVKSITASTPTLPTTS-----------------------
Smik_9.84          --------------------NRHSSVRITPITEEKFK------SRNKNG-----------
YIL095W            --------------------NRHSSVRITPITEEKFK------KTLKDG-----------
Skud_9.78          --------------------NRHSSVRITPITEGKFN------KYYNSG-----------
Suva_9.104         --------------------NRQSSVRITPITEERFN------NYHSSN-----------
TDEL0G02150        --------------------PKRGQLSKTHHDEKPSV-----------------------
NCAS0G03810        --------------------DGDSIHKNDQ------------------------------
KAFR0H03330        --------------------MIDHQLKKI-------------------------------
                                                                               

TPHA0D01540        ---------AYGN-----MNGHLKTA--------HHLKAKPKVPTKPVF-----LRSP--
Kpol_1039.33       ---------NSSP-----RKKPILPA--------KPLHLRSQPKQQTAI-----LAGSK-
TBLA0B06940        TSVKIHTLKESSKKHGSFKSPPPLPPRISIDEKVKDQKLKEDTPKKHTHRTTRKLLVGRL
CAGL0J03432g       ---------DNSNNLPTKKTPPVKPP--------KPDHLKPKVPPKPAF-----LKT---
KLTH0G10318g       KRNSSVVIKAGQQVSKDAEEVPSSR---------KPAPPKPKRPKKPSH-----LKADK-
Kwal_27.11542      EFSSIVPTAKNT------TAKDIEQP--------IRVHHKPKRPTKPPH-----LKADR-
KNAG0A05430        VPALINRDNDNGKYPAKSKAPPVVPK--------KPDHLRPKPPKKPAH-----LSSLKI
ADL217W            ---------LSSI-----AAGNVSKF--------QFTSVENVLKAAANG---SVTAGKK-
TBLA0B05930        -------YTTSEK-----KKAPKPPP--------KPDYLRPKKPPKPAN-----LQGMKF
ZYRO0A01848g       KTPSSVNGKSESK-----SKPPPPPP--------KPEHLRPKKPPKPAF-----LSGKR-
Ecym_3323          NTPSVVKFSTKNQ-----KKPPEKPF--------KPVHLRPTPPPKPAH-----LKSPP-
Kpol_1003.35       ---------KKNK-----KEKPVPAK--------KPAHLRPQKPPKPTF-----LAGKR-
TPHA0C03380        ------------------TNKYIKGN--------TKQKVPPKLPTKPSY-----LGGKR-
KLLA0E08405g       ---------HEAP-----KSKPAPPP--------KPAHLKPNLPPKPKH-----LKAKS-
SAKL0E07722g       THQSNTVVSPTRKHFTRTREKPVPPP--------KPVRLRPKPPPKPFH-----LKVKNL
CAGL0G02607g       DVPTIRIPSDKNQLSKSGKIKPAPPP--------KPKKLRSNKKISTLS-----ALRLE-
Suva_14.327        ------------------KAKPIPPP--------KPFHLKPKPPPKPSF-----LAGQKL
Smik_14.311        ------------------KIKPTPPP--------KPLHLKPKPPPKPLF-----LAGQKL
Skud_14.309        ---------SKDK-----KAKPIPPP--------KPLHLRPKPPPKPLF-----LAGQK-
YNL020C            --------ISKDK-----KTKPTPPP--------KPSHLKPKPPPKPLL-----LAGRKL
NDAI0B03560        -------DIGSSP-----KKAPPLPF--------KPHHLRPKPPPKPTY-----LS--K-
KNAG0H02020        ------------------KGPPVPH---------KPDRLRPVLPSKPAF-----LSGKR-
NCAS0B06260        ---VIINPVTEPI-----SIRPSPPP--------KPKHLRPIPPPKPTR-----LSK---
KAFR0J01370        --------SLSGK-----RKKPPVPY--------KRDSLKPTPPAKPAF-----LSSRP-
NDAI0G00640        ----------------------------------NDKEVAQKKKQNQLF-----L-----
Smik_9.84          LSNNKTKDNDRHK-----SRPPRPPP--------KPLHLRAEIQKVRSS---SRLHSGE-
YIL095W            VLDIKTKSNGKDK-----SRPPRPPP--------KPLHLRTEIQKIRNF---SRLQSKK-
Skud_9.78          TLKGETSRNDKHK-----SRPPRPPP--------KPLHLRTEIQNTRNF---SRLQSRQ-
Suva_9.104         TMNDHTSSKDKPK-----SRPPRPPP--------KPLHLRTKIHNTRCS---SNLQSRK-
TDEL0G02150        -------KEKSKQ-----KVRPRAPP--------KPAHLRPKPPPKPAF-----LSGKKM
NCAS0G03810        ------------------TPKPKVPS--------KPAHLRPKVPKKPAF-----LSSQK-
KAFR0H03330        ----------------------------------KRFH----------------------
                                                                               

TPHA0D01540        ------------------------------------------------------------
Kpol_1039.33       VGI---------------------------------------------------------
TBLA0B06940        RKSSQSESSKKKHSESSKESSKESSKKKHSEQSHKKIPEPLIELDRCSLEKPIPPPKPKK
CAGL0J03432g       ------------------------------------------------------------
KLTH0G10318g       IIKEAETSAYEHSVDISDIEIDELE-----KDFKRRFPSAV-------------------
Kwal_27.11542      IIKHGSSTT-ENPRHSSDLEIEELE-----KDFQRRFPSAV-------------------
KNAG0A05430        NKKHSTTVLNTPADLLSDTAVDELE-----KSFKQRYPSTVS------------------
ADL217W            PTTSETSKS-AVSASATN---------------SRKAPNCK-------------------
TBLA0B05930        MKSENVEQEIKERKENSKKQLQKME-----VDFSQRYPSV--------------------
ZYRO0A01848g       --KEPEVLLNEVKDAVMDSNVDTIETDV--------------------------------
Ecym_3323          VNKKRMPKDTKSAIEC--------------------------------------------
Kpol_1003.35       KLDKNKSDV-KTSSESMEPNLETLT-----EEFNKRFPNIS-------------------
TPHA0C03380        IESK--------------------------------------------------------
KLLA0E08405g       FRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL-------------------
SAKL0E07722g       VIPKKGRYSNRANTLSDEVDIDDLE-----EDFKKRYPSAI-------------------
CAGL0G02607g       PKQNDRITS-DATDVLMHLNVDDLE-----EDFKRRFPSAV-------------------
Suva_14.327        CSEK--------------------------------------------------------
Smik_14.311        SLEK--------------------------------------------------------
Skud_14.309        LSEK--------------------------------------------------------
YNL020C            SLDK--------------------------------------------------------
NDAI0B03560        MFSKERISS-TATEQLVTLDVDTLE-----RDFRKRFPSTLENR----------------
KNAG0H02020        VQDISDAINSK-------------------------------------------------
NCAS0B06260        IYPDERISS-TATERIVNLDVESLE-----KDFKRRFPSRI-------------------
KAFR0J01370        --VASSRVSSNATDMLVDLSVDDIE-----KDIRRRFPSTVG------------------
NDAI0G00640        ------------------------------------------------------------
Smik_9.84          LSSE-RISS-DATETIVEVNVDDLE-----ADFRKRFPSKV-------------------
YIL095W            LPIE-RISS-EATETIVDVNVDDLE-----ADFRKRFPSKV-------------------
Skud_9.78          PQME-RISS-EATETIVDVNVDDLE-----ADFRKRFPSKV-------------------
Suva_9.104         PPME-RISS-EATETIVDVNVDELE-----ADFRKRFPSKV-------------------
TDEL0G02150        VDTEPS----EAGKAVIDAKVESLE-----RDLRKEVTGTL-------------------
NCAS0G03810        IK----------------------------------------------------------
KAFR0H03330        ------------------------------------------------------------
                                                                               

TPHA0D01540        ---------------
Kpol_1039.33       ---------------
TBLA0B06940        LRHKSKILSHIGVSK
CAGL0J03432g       ---------------
KLTH0G10318g       ---------------
Kwal_27.11542      ---------------
KNAG0A05430        ---------------
ADL217W            ---------------
TBLA0B05930        ---------------
ZYRO0A01848g       ---------------
Ecym_3323          ---------------
Kpol_1003.35       ---------------
TPHA0C03380        ---------------
KLLA0E08405g       ---------------
SAKL0E07722g       ---------------
CAGL0G02607g       ---------------
Suva_14.327        ---------------
Smik_14.311        ---------------
Skud_14.309        ---------------
YNL020C            ---------------
NDAI0B03560        ---------------
KNAG0H02020        ---------------
NCAS0B06260        ---------------
KAFR0J01370        ---------------
NDAI0G00640        ---------------
Smik_9.84          ---------------
YIL095W            ---------------
Skud_9.78          ---------------
Suva_9.104         ---------------
TDEL0G02150        ---------------
NCAS0G03810        ---------------
KAFR0H03330        ---------------
                                  

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0D01540
MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLY--PELTCLKRV
IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRL----QNSEDSYVVLLLMEYCSG
AGLLDFMNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFK
LCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKS---DIWA
LGILLYKLCYYTTPFEEH-GSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNIC
QLLEELFRIQHKSSPLPNFYVQRAMSSLQMDTTQPHR-I---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PILKY---------------------TQMSKPVISSQSSPSKHCQTFSQKDYP
YIQPNLSNSARAKDYYLGGSSSTDTLESSLSKQLSEDR----------------------
-VYDVNVNTMDSHCTYRRKLTPNYDHALKKGSSPSINDNSTLNNMT--SLKHEHSFNSRE
AYIHPDF-----------------------------------------------------
------------------------------------------------------------
------------SGSKHFITSNDALNLNCRTPRSRDSSINSNSSVDSISRNSTGGSLIKS
L-G-----------------TKIKLTTTGGKRSQSPIKSRQNT-GDSIRSAFNKVRQGIN
LRSSRISS------------------NDSVVRNSEQFGGIPELS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------NDNKYQFDTTSK-----NRHEYNSLSRKLSLSSQK----
----QNSLNDSTSNDP---IILITN-----------------------------------
-------------LEAKKSIKDRVQALMKSSS-DNHVI--ISAHGYGKYT----------
--------------------DNKSSIKHFKSNIEHLT-----------------------
---------AYGN-----MNGHLKTA--------HHLKAKPKVPTKPVF-----LRSP--
------------------------------------------------------------
---------------
>Kpol_1039.33
MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPA--TNIACLKRV
VVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKH----SGHTGSYEVFVLMEYCSG
GSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYK
VCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKS---DIWA
LGVFLFKLCYYTTPFEKE-GEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNIC
QLIEELSRLQGIVPPMKNFYLSRALETSSLMQPLQN------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------NSYKVPISDIQDKHKRQIPNI--QSSP
EKLPSIQSTSNGMTTNKILTRQTSPDIENLKSKSSSNY-------------------YKS
GKNYGSEAITSGSIEKDSQFNNSNLYSEKPNLYYRSKDQLDTSNRENSTINDVPGQIEKY
GDWSSVY-----------------------------------------------------
------------------------------------------------------------
------------RKTRNSTLHIGRSRSSSLDSTSSSSLSVESYTAEPLSKNSTGISLVRT
L-S-----------------KKLKNVITGEKRSVSPVRSRQNT-GGSSRSVFTVLHEGFT
GGNSRISSSEH---------------TIRGPSSSSHKSRVSSST----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KNFEEGFIRKHV---------------------------
----DIVEESAEPKVG---IKLKTT-----------------------------------
-------------REAKDSIKRRVRELLLVSE-DEQYH--RTASGYGKYTDVQEIVTN--
--------------------IMTPLVKSTQKTPIDSK-----------------------
---------NSSP-----RKKPILPA--------KPLHLRSQPKQQTAI-----LAGSK-
VGI---------------------------------------------------------
---------------
>TBLA0B06940
MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV
IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRS----ELKQGEYEVFLLMEYCSR
GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK
ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKS---DIWA
LGVFLYKLCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC
QVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQCNSLS
PTNSSTRRNSTFSDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKFIASASV
SPNNINSSSPISNSYIPSISSIPNLNLSESPITLNSLPFSTSPLSLAPVPINGPNTKGQS
PTNSYISPTLTPIPGTLTKNTLPLPLPNSPTLNLSLPQPIPEIKVSPLYNSASMPNTNLT
KPMPFSLPPNIDLSSKNLNLPELPSLNSTLSSPSHSPQLSTVADTPYLANIGSASPTTSI
SNRLQFFTTSRHGSISSKIAHHNNNTINTSHLQPSPQMSPPLSPQLLTYMPLPLSPQISP
QSIPPALPPKLPIDNTLTLQQQFHTYQQQKQAQKITKLPNVSDSVTIGHSGNLGKIFKDS
LFDDNSAIDDSITVENTIQKDFTESCNSSNLINLDSNSASTPHLKLILTHDSLNNDSTID
DTFAKKHDNLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQF
SSSEASAKVSSSKLNYKNQNTKIKVSTDSFSSTASPLSSRQNT-GDSIKSAFSKLRRSLS
SSNPSRIISSDTSSTRKNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESD
SSVYFSANSGSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLN
SSLPKMSSVTDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVN
ILQRIDHEISQPVNETEFIEEDDSKEHTNPFTR-DYSAKRDSFNTINSQRLSSLSSNSTR
KESVTANTSPEREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYSRDSIINNSNS
SKGDISSLRLVSNPDAKDLIKKRVMELLKNSETDNGVT--RTAHGYGKYTDKPNTSQNKA
PQRTISMDFFEKQAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARH
TSVKIHTLKESSKKHGSFKSPPPLPPRISIDEKVKDQKLKEDTPKKHTHRTTRKLLVGRL
RKSSQSESSKKKHSESSKESSKESSKKKHSEQSHKKIPEPLIELDRCSLEKPIPPPKPKK
LRHKSKILSHIGVSK
>CAGL0J03432g
MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLG--TNMAVLKRV
IVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKS----QYMDGTYEVFLIMEYCSR
GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK
LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS---DIWA
LGVFLYKLCYYTTPFEQT-GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF
QIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNT--------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------GNMSINGYYKPMNQN------------
---------------------------SGISTPHSAGK----------------------
---------------------------MLAGFQNDMPKPSTKLGKQ--ELFSRSKTVPND
IGGLNER-----------------------------------------------------
------------------------------------------------------------
------------SDISAFLLRKKAELEATPNPLESSKYIDDDSS----------------
--S-----------------TTSEDSFDDHASFISKTQSAHSV------STVDRFNAYLK
ANDSISEEDS----------------DESFMPGASHLNRFRSDT----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------QETSNKRQTKDE-----ILLKRRSLPFTN----------
----NEARRNQSTDSE---LDTLSK-----------------------------------
-------------AEKKEQLRQRMMSALNASE-DVIKK-TKSRDGSVSNDNNYLLKSKLH
--------------------GRRDNEQRFSSVVVNPL-----------------------
---------DNSNNLPTKKTPPVKPP--------KPDHLKPKVPPKPAF-----LKT---
------------------------------------------------------------
---------------
>KLTH0G10318g
MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSP--AKIACLKRV
LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKS----GVHDGSYEVFLLMEYCSG
GGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK
VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKS---DIWA
LGVFLYKLCYYTTPFEKV-GEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNIC
QVLEEVSRIQGTPCPLRNFYVTRAMQQQQQHQ------Q---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PKIKFDHSASQPK-------------LDSANNIINVPFKMSHNQPLR--STQT
FAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIE---------------GN--KAL
QSKQTPHFQPPISHDFNRLGR-SQTFTPTSTLASRSSVSPPLAGRG--DISKIISANPTN
VEPSPIY-----------------------------------------------------
------------------------------------------------------------
------------LSSGTQTDDGFASSH--ALKLERTKSIASLSSSESVESQHTGGSATRR
F-G-----------------QKLK-VFTGERRSISPIKSRQNT-GDSVRSAFATLRRGFS
GGSFKSELPNKRNSL-----------DISSTSSHSNGFKFRVSS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------SESIEEENVYPR-----FSHSRSSSSASIVSDLDQLQQD
D---TGAKNYYKSHSP---VKVSAT-----------------------------------
-------------QGSRSSIQKRVQDLLKNSQ-DSPVK--KTAHGYGMLSPGDEAAELAS
----------------QL--TNETMLQNVHQSTASTP------KVLSPA-----------
KRNSSVVIKAGQQVSKDAEEVPSSR---------KPAPPKPKRPKKPSH-----LKADK-
IIKEAETSAYEHSVDISDIEIDELE-----KDFKRRFPSAV-------------------
---------------
>Kwal_27.11542
MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSI--GNVACLKRV
LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKS----GAQDGSYEVFLLMEYCSA
GGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK
VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKS---DIWA
LGVFLYKLCYYTTPFEKV-GDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNIC
QVLEEVSRIQNVPCPLRNFYLLRSMQQQQQQHQQQQQTF---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PSVEVHHSLSQPR-------------MDLKNGPVLTPFKHAQSSALR--TSKT
FDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSID---------------RR--TVL
QEKIPLQPASADFQRLSRAQT----FVPVTKSPKRSSASPSFGGRG--DISMIVSANPTN
VDPTPIY-----------------------------------------------------
------------------------------------------------------------
------------LNSSVQTDNPGSDLYLSKQNTRLSESSTS--SSESIETQSTGGSFSRT
F-G-----------------RRLKKVFTGEKRSISPIKSRQNT-GESVKSAFATLRRGFS
SGSHKGEQLSKKNTV-----------DVTTNGSSSNGYKFRVTS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------SDSIEEENSGFI-----YSHSRKASSTSIVSDLDSLQDD
SG--TNAKKYYRSHSP---VKLSGS-----------------------------------
-------------SDARSSIQKRVQNLLKSSQ-DSPVK--KSAHGYGEVSEKEDKESPEQ
----------------FTGKPAVAEARPIKRTVVPPP------KRYSSV-----------
EFSSIVPTAKNT------TAKDIEQP--------IRVHHKPKRPTKPPH-----LKADR-
IIKHGSSTT-ENPRHSSDLEIEELE-----KDFQRRFPSAV-------------------
---------------
>KNAG0A05430
MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN--SNIACLKRV
IVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKS----EFGNGSYEVFLLMEYCER
GSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFK
VCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWC
VALQIMLLHY---TFRED-REVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNIC
QLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSR---------------------
------------------------------------------------------------
------------------------------------------------------------
-------ANTTQFTDQSAKET------------TAIRVGKEISPLKPQLSPIKS---SYG
PVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSL----------------------
-------------EDGNNGLENHYLSSSVPAISYLANQHANDNIRN--TTKLNIPAQNST
GSKNKTY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTLEEPSLQHTRILPHISTDRTDN-----------TGNSIVSR
L-G-----------------VQLRNVITNDSSASSSIDTVQET-GNSIKSAIESLKNSVS
GMANNVKALSVENARNHLERLG----SSYSIGSNNNIAKPNSAP----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------IIPAVVTTHTSN-----SLKTAVSSPTHSELSDENELYD
TLHLPDPKTSFQSPSP---LKYAVD-----------------------------------
-------------RKMKASIEKRVLNLLKNAE-DSPVK--KTAAGYGKYTKRPKMVSPTN
--------------------PHYHLVRQNSVSQTPLILSARGSSGHPVV-----------
VPALINRDNDNGKYPAKSKAPPVVPK--------KPDHLRPKPPKKPAH-----LSSLKI
NKKHSTTVLNTPADLLSDTAVDELE-----KSFKQRYPSTVS------------------
---------------
>ADL217W
MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQG--S-LACLKRV
HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKS----PRHDGTYEVYLLMEYCLR
GGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFK
VCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKS---DIWA
LGVFLYKVCYFTTPFEKV-GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNIC
QVLEEVSRIQGVPCPLPNFYLERMKHGACTPVHHSASQP---------------------
------------------------------------------------------------
------------------------------------------------------------
-------ALPLATHQFSTSTPMV----------THPQPPANQMSPLPHGIQPIT--SNMV
YMMHNTTPNIKD---------------IPRENPAATIQ---------------KN---AL
YSMSGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIPRN--EIQKFLSGTPPT
SAKKPTY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTGD-IITSNKSGSRPFAMSLSPL-SSPELFSEQSTGNSLLGR
L-S-----------------RKTIRSPTSD-KGSNPLKSKSSV-GDDLASLLSSPSRNLS
FPAQSSKSSKRNSADL----------SSRKSPVLNK-------S----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------RIAMSYSGPEKS-----SATGLESSSSSLFGSQNGEHRP
PSS-TDRHKSNSTSFR---LVPT-------------------------------------
-------------KKGQTSIQERVHKLLATSA-QEDVS--KKASKKTTNSATSAKLEHQK
--------------------GDEQSISTGSMSKIDAI------SMD--------------
---------LSSI-----AAGNVSKF--------QFTSVENVLKAAANG---SVTAGKK-
PTTSETSKS-AVSASATN---------------SRKAPNCK-------------------
---------------
>TBLA0B05930
MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPING--MNLACLKRV
IVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARS----ISNDGTYEVLQLMEFCPG
GGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK
VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS---DIWA
LGVFLYKICYYTTPFENG-GERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVC
QVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNTNGSIY---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PIPTQNTMM-----------------NQMPPPMNMMNNSQIAAQHSS--NMMP
---------------------------QSIPQPLYTNY----------------------
---------SNNSMNANMNMSPNYAYPTSPIMSQGLFTGPTLHHNLTSPISQPKSKSENT
TGNDDPF-----------------------------------------------------
------------------------------------------------------------
------------AKLKDQALFNKVNANNTNTSVNDHSFNMYSTKQQNMANNFNNNN----
--S-----------------NNMNPLMKQRSDRTRIFDMPQNKTPAMTQNSVNYLLPGHS
SEQ-----------------------SIRKSTSSTSLRNIQNGG----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------NQVLSQIMFNNN-----KTGERTSSTSSVSAPSLSKNMV
PY--IPPNSFTSTNNA---MVFREN-----------------------------------
-------------ESSKASIKLRVQNLLKTSN-SGNND--NSLRRTTSDTQNGS------
--------------------QSNNSLRKVNTHQVDSN-----------------------
-------YTTSEK-----KKAPKPPP--------KPDYLRPKKPPKPAN-----LQGMKF
MKSENVEQEIKERKENSKKQLQKME-----VDFSQRYPSV--------------------
---------------
>ZYRO0A01848g
MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTG--TNKVCLKRV
IIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARS----LLQNGTYEVFLLMEFCTA
GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK
VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS---DIWA
LGIFLYKLCYYTTPFEKG-GDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNIC
QVLEEVSRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPV---------------------
------------------------------------------------------------
------------------------------------------------------------
-------SMVNTN--------------------TFMAPPAQVAPLTPAQSLGAN------
---------------------GMPVGVTPQPMPIMAKT----------------------
----------------------------RSGISTGGNIFPGAANPM--VVPTQLGPAQVA
GPVP--------------------------------------------------------
------------------------------------------------------------
------------MGSQDMSSGILPPFNRASTLPTDGFSTGPGKDGGVITSA---------
--V-----------------NTGPETIKDRPFNYVDSETQTSD-AGSITTSKPYLHPSAV
SSTRSLPAQNAD--------------HDSRPRSSSLDFKSAARK----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KPADEEILENLI-----ALSNRRDDPNKRNSFNSFNSSP
IGQRSPTGGANVPTTPDSLARIKSN-----------------------------------
-------------PDTKESIQKKVQSLLKAAE-DSPKN--KSTSEIVNIRTTTSS-----
--------------------FSENGLRKTTSNVENGK------STTRSI-----------
KTPSSVNGKSESK-----SKPPPPPP--------KPEHLRPKKPPKPAF-----LSGKR-
--KEPEVLLNEVKDAVMDSNVDTIETDV--------------------------------
---------------
>Ecym_3323
MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV---KDVACLKRV
HVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKS----VLNNGSYEVVLLMEYCSR
GGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCK
VCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKS---DIWA
LGVFLYKLCYYTTPFEKT-GEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSC
QVLEEVCRIQGQPCPVKNFYLERSLKQQIPSQLRHSVSQ---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PMIAMNP-------------------QQAKIPIVIPQVQNSVLPSNT--MNMG
YVTGAFQPASQPNEVR-----------GDTALRVSKAK---------------LL--STA
CDWDKTQNFVPGSNYNSKASVESGHLPTSSLPTPRSSVSPVRSGRG--NINKIIAANPIN
IKRP-VY-----------------------------------------------------
------------------------------------------------------------
------------VDSEMQTTD-LASLKKANSRPLSLSLSSL-PSQESFSLHYTGISAVE-
--S-----------------SQQFQGPVTFDKNNLLVNSKSNT-GDSKSSSPELINRTLR
YSYHAPEPASWESSEMS---------SKKLPYLNAILKTPKSLS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------AAEVSESRRSEL-----ERDSLANVPINNEYAVD-----
----PDSGGYHPSSGG---LVSLLST----------------------------------
-------------KNGQVSIQKRVHLLLANSD-AQELY--SSTNSEAVNSGNISVGNEEL
--------------------NSDDNIKPEKPPVMPVS------RSKSQF-----------
NTPSVVKFSTKNQ-----KKPPEKPF--------KPVHLRPTPPPKPAH-----LKSPP-
VNKKRMPKDTKSAIEC--------------------------------------------
---------------
>Kpol_1003.35
MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTG--SDIVCLKRL
IVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKS----GLHNGAYEVLLLMEFCAE
GGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYK
LCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKS---DIWA
LGVFLYKLCYYTTPFEKA-GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC
QVLEEVSRLQGIPCPIKNFYLERAIHRSTLMPHQQQNNH---------------------
------------------------------------------------------------
------------------------------------------------------------
-------HHHQQQQQQQLQQQQ-----------QQIQQQQQQIQQQFHIHQEQI--RGLH
QSLSF----------------------PSLNSPLHNAQ---------------NI-----
-----------------------------TPNNVILTGVPLSAHAS--NDPAVVNNSFNV
AATAKLQ-----------------------------------------------------
------------------------------------------------------------
------------QIHIGTTDKNANILTNQRSRTMPDDQMSD----YIGRTTSAG------
--R-----------------GDISKIVASNPTLFD------KT-SKSEVNSTGSLAENIA
SIASEKISSLKNQNL-----------SQSSSTGSSHRSIIVNDG----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DLTKLEKVQTSK-----EFEADSPIP---VSKAKHHSLP
SNF-SSSIKIGNGEGT---LTTSDSN----------------------------------
-------------QSDNNSIQDRMKNLIDNAD-NIPIN--KIASDYGKYTKSSDNFGKDS
--------------------GEEMNDKENIKTANSGT------RNQP-------------
---------KKNK-----KEKPVPAK--------KPAHLRPQKPPKPTF-----LAGKR-
KLDKNKSDV-KTSSESMEPNLETLT-----EEFNKRFPNIS-------------------
---------------
>TPHA0C03380
MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSG--SNIACLKRV
IVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSG
KGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK
LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS---DIWA
LGVFLYKVCYYTTPFEKE-GENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNIC
QVVEEVSRLQGVPCPLKNFYLERAIRQTAVQD----------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------NHFNHQMEQFPPLHLQHSISS------
------------------------PALSTVNNNIGLSN----------------------
---------------INFLQNVNNSAIQTANTTSRINNNPYSL-----HNSSTLQNTPQT
IAADRRYPV---------------------------------------------------
------------------------------------------------------------
------------STAPKQQHNIPAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRG
LHL-----------------SELQKSVTALNNDMNHIYSQKQEGGRGKISSILNSNPNSL
DQSPTRAENNALSTKSSRVDLSVFN-DNDQPPYIKNVLPVEDDA----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DDDIYTTKPFNSKLTDISLTSLQKEITELKMELSKNDSK
NAV-DSRSSFNSNAEP---SSELTNK----------------------------------
-------------TVKKNSITDRYLNSVGDNG-VTSVK--KTAEGYGKYTKVSDKEGSL-
--------------------TSVNTAKPLESGHKSEN-----------------------
------------------TNKYIKGN--------TKQKVPPKLPTKPSY-----LGGKR-
IESK--------------------------------------------------------
---------------
>KLLA0E08405g
MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCP--DNVACLKRV
VVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKS----PVNVGMYEVYLLMEYCSG
GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK
LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKS---DIWA
LGVFLYKTCYYTTPFEKN-GESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNIC
QVVEEVSRIQGIPCPIKNFYLLRMMDKQEQPRVSPPPHV---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PQMTVPATVPTSVSTQHLPPQVV---SNVQTPSKTASIQHLPYLHVS--KSQP
MVTQQDLLSQKQPAGKTVP---QTVSNYTSSDPFSKID---------------RS--ALL
STSATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRG--AISSILASNRTS
LDRP-KY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTSDHPSELGLSRSLSRKSVASSL-SSAESLEATSTGGSLTRK
I-G-----------------SKMKKVITGEKRGFSTIRSAQNT-GESVKSAFNALRKGIS
SMQFTGDSSSRKSSL-----------EARKYRSTSGKSIPENTS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------SNTKSHRRSTSS---------FSFVPENNDYEL------
----IEDIQKEKPKSS---LRRSSS-----------------------------------
-------------LKTSSSIQKRVKDLI-NAD-DIPNR--SSATGYGKYTDIGRKTDISD
--------------------HHKSNANRKSSTVITPV-----------------------
---------HEAP-----KSKPAPPP--------KPAHLKPNLPPKPKH-----LKAKS-
FRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL-------------------
---------------
>SAKL0E07722g
MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS---SSIACLKRV
LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKS----SLNNGSYEVFLLMEYCAR
GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK
VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKS---DIWA
LGVFLYKLCYYTTPFEKA-GEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNIC
QLLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQP---------------------
------------------------------------------------------------
------------------------------------------------------------
-------LRHSV---------------------SQPQMEAITLPITLQPHPQKV--LASA
QVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLD---------------------K
SNLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRG--DISKILKSNPTS
VDRLSSY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRR
I-G-----------------DKLKRIISNEPRNTSPIRSRQNT-GGSTRSAFSTLRRG-T
SSNFSSDRSKRNSVDFS---------VRRLGSGGNKVRVSSSKS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------IEEKGNTNKFEN-----KGHNRSVSTSSITSDLNKYEGK
AG--SVSRGYNQAHSP---IKMSAN-----------------------------------
-------------RESRNSIQKRVHDLLKNSQ-DSPVR--KTAPDFGEFSSFPQDHAADH
----------------T---ISDKVIDVHNVTSSPVV-----QKATLDT-----------
THQSNTVVSPTRKHFTRTREKPVPPP--------KPVRLRPKPPPKPFH-----LKVKNL
VIPKKGRYSNRANTLSDEVDIDDLE-----EDFKKRYPSAI-------------------
---------------
>CAGL0G02607g
MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNG--SNVACLKRV
KVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRS----PTNDGTYEVFLLMEYCEG
GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK
VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKA---DIWA
LGVFLYKLCYYTTPFEKL-GEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVC
QVLEEVSRMQNVPCPIRNFYLLRAMEKVK-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------LSTEIDYPQLQLQKLRNAQAD------
----------------------------NLSNPMIKPM---------------PI-----
------------------------------------AQRPTFSGNG----MVNNNRTLPT
VMVSNNV-----------------------------------------------------
------------------------------------------------------------
------------IGNGSQVWDN----SKPPEPQPIPQSRSFVKSSTLI------------
--G-----------------APLSKSWGHNEFNFGSISNSPSVFQGAIVPAANQLQNKDS
SHQPKPSGMMKKNEQLQVTSTFA---SSPNTRTRTNSQGSSLYI----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------PTSSEYRTRHVH-----TGDNNSLKSSKLDSDKLDIAVQ
RSP-SSRSDGSDFRLP---LNPN-------------------------------------
-------------SEKRKSIQLRVQHLLDNMS-SNEVK--KSAQGYGKYTDELSSTGTNI
--------------------PKVTPDSPVLADLIDFN-----------------------
DVPTIRIPSDKNQLSKSGKIKPAPPP--------KPKKLRSNKKISTLS-----ALRLE-
PKQNDRITS-DATDVLMHLNVDDLE-----EDFKRRFPSAV-------------------
---------------
>Suva_14.327
MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTN--SNVACLKRV
IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKA----TLHNGSYEVFVLMEYCER
GGLIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYK
LCDFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKS---DIWA
LGIFLYKLCYYTTPFEKG-GEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVF
QLLKQITNMQNAPYPIRDV-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------QTVQRPSNHLNLMELHQNSAT------
------------------------QNIQSLNSHSINEN----------------------
-----------------------------------SMSNQNFQFRM--PANVITAQSLPT
RENSQAF-----------------------------------------------------
------------------------------------------------------------
------------INATSSSLTGSPSIFETGVCNTLNIFNQPNTNP---------------
--T-----------------TKLKQAIDSEAHSFRK--------SDPINLSLPNIIPQDN
DSSSSSDESYTGDVDEL---------KKTRSLGSYSTHENAKGG----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------ESVKGESVKASLTTSSSPGSSSALKPAKIESKRQSLPET
AF--VGVVDSGKDSLP---SDPKSNRPVKDSVSVSK------------------------
-------------QDLKNSIQQRMINLLNSSE-ESFNA--RKKSRAKATEDEG-------
--------------------PGKPIASILRTPVLKEK-----------------------
------------------KAKPIPPP--------KPFHLKPKPPPKPSF-----LAGQKL
CSEK--------------------------------------------------------
---------------
>Smik_14.311
MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTN--TNVACLKRV
IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKA----ILQNGSYEVFVLMEYCER
GGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK
LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKS---DIWA
LGIFLYKLCYYTTPFEKG-GEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF
QLLKRISIMQNVPCPINDI-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------QTVQAPSSHLNLTELHQLSAT------
------------------------QNIQSLNSHLVMGN----------------------
-------------------------------------SIPTTAFQFSTPVNMATAQTLPI
KEESNIF-----------------------------------------------------
------------------------------------------------------------
------------YDPTSCNFAKDSQSRLNNALSRSPFELEAVSDLNNVKDEANS------
--T-----------------TRLKQTIVSEAHNFRQ--------NNSLNLSLPNMIPHND
DSSSSSDESYPGDTDEL---------KKTQSLSSYSTRSNTKRD----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------QPVEEYLTSSSL-----PGSSFTAVHTKVNLDHKSSSFK
PTS-TNTVDGLKNNTL---SLSKNNLPAYDYVGGSK------------------------
-------------QDLKNSIQQRMLEKLNSSE-ESFNA--RKISNVKEGGQEG-------
--------------------TNIPIILKSKASTLKDK-----------------------
------------------KIKPTPPP--------KPLHLKPKPPPKPLF-----LAGQKL
SLEK--------------------------------------------------------
---------------
>Skud_14.309
MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSH--SNIACLKRV
IVPDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKA----MLHNGSYEVFVLMEYCER
GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK
LCDFGSVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKS---DIWA
LGIFLYKLCYYTTPFEKG-GEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVY
QLLKRISIMQNVPCPISDI-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------QVPQAPDSHLNLTELHQLSAT------
------------------------QNIRSLNSHSTIER----------------------
---------------------------PIPNAAFQSSMPDAATQ----TLFSRKKSQTSD
NTTLNYS-----------------------------------------------------
------------------------------------------------------------
------------AENPQTSLDKSESVSHVLDPLLFESGMSNTSKSLNRAKVSS-------
--T-----------------TKLKQVIDSEAHNFRH--------NYTMNLPLRNIIPQDD
DSSSSSDELYPEDVDK----------LEKTQSLGSYISRDNKKG----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------ESVKESLTSSSL-----PGSSLTATPTKLDLKLETLPNS
TF--VNTVDNSKNSFR---NFSKSNPLAYDDVSVSR------------------------
-------------QDLKNSIRQRMLDKLNSSE-ESFNA--RKMPKAKAS-----------
--------------------EKESTGKPIALKPGIST-----------------------
---------SKDK-----KAKPIPPP--------KPLHLRPKPPPKPLF-----LAGQK-
LSEK--------------------------------------------------------
---------------
>YNL020C
MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSN--SSVACLKRV
IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKA----MLHNGSYEVFVLMEYCER
GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK
LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKS---DIWA
LGIFLYKLCYYTTPFEKG-GDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVY
QLLKRISIMQNVPCPINDI-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------QVVQAPSSHLNLTELHQLSAT--QNI-
---------------------------LSLNSPTTMEN----------------------
---------------------------TMPNATFQISMADNTTTAQ--MHPNRKPSQIAY
DASFSNS-----------------------------------------------------
------------------------------------------------------------
------------AKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELKANS-------
--A-----------------TKLKQAIVSEAHTFRQ--------NNSIDFPLQNIIPQYE
DSSSSSDESYSGDVDEL---------KKTRSLGSYSTRGNIKKN----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------QSVKESLTSSSL-----PGTSFTPTSTKVNLKHENSPFK
STF-VNTIDNSKDDLN---KPSYEDLDVSK------------------------------
-------------QNLKNSIQQRMIDKLNSSE-ESFNA--RKMSKVKL------------
--------------------HEKGEIDKPTMLKSSGP-----------------------
--------ISKDK-----KTKPTPPP--------KPSHLKPKPPPKPLL-----LAGRKL
SLDK--------------------------------------------------------
---------------
>NDAI0B03560
MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSK--SNVACLKRV
IVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKS----AFNNGSYEVLLLMEYCEG
GGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFK
LCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKS---DIWA
LGVFLYKLCYYTTPFEKT-GENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNIC
ELLEEISSIQGVPCPIQNFYLIRAQQLANQIQLQRQTTV---------------------
------------------------------------------------------------
------------------------------------------------------------
-------PKIATAQPI-----------------QQLNARTQTMPIINTKANTSL------
--------------------------VTPITVPVLSEN---------------TRLPALE
LDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASVSPIRR-----YISRSPSRDNTN
YDIQRRR-----------------------------------------------------
------------------------------------------------------------
------------TSQYDHDQNQSNYMGRSLSRTSSIKSTSALSFEGNLQGNNTGDSFAQK
F-T-----------------NKIKRVVTGESRNASPIRSRQDT-GGSVRSAFGAIRGAFT
GSMRAPSLDNNTNNSMHNNSN-----NNTSRNSSYGRHNIITNP----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------IKEEDSRNMTKA-----KLAKRHTMPPGMLYDLENLEIE
NEG-YHASEYYRSHSP---TKPFVT-----------------------------------
-------------KTTRDNIQQRVQNLLSESE-QPMERNNIDTHHTNAVSHSMIPRNLNS
--------------------REKDSLRYSSVVINPLE-----------------------
-------DIGSSP-----KKAPPLPF--------KPHHLRPKPPPKPTY-----LS--K-
MFSKERISS-TATEQLVTLDVDTLE-----RDFRKRFPSTLENR----------------
---------------
>KNAG0H02020
MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSG--TNIACLKRV
IVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKS----SFQNGTYEVFLLMEYCEN
GGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFK
LCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKS---DIWA
LGVFLYKICYYTTPFEKS-GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIY
DVVKELSDMKNISCPIINFYLKPNMTDAS-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------NNIQHLHSIMNNTNTSTVQIQ------
--------------------------QQQLQLQLRQQQ----------------------
------------------------------------------------QVKVCRQQTPSQ
IEAPQLY-----------------------------------------------------
------------------------------------------------------------
------------MVTGSGDPLSNESLEGADMPVLSRSRSSGALKPMALNSH---------
--R-----------------KYYEHNLNNQPQTPALPEKSQRQ-VLNKPIVLEDIDLSSS
SEDDDTEGSSIDDNIIN---------SINLPPNANKRLG---------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------GRRSVSIFNPKNDTDLKHIT--
----KANEKSKESSGP---KK---------------------------------------
-------------VFSKEEVRKRMMEKLKEKD-KGKN-----------------------
--------------------TTEPVSRSISTTPRKAP-----------------------
------------------KGPPVPH---------KPDRLRPVLPSKPAF-----LSGKR-
VQDISDAINSK-------------------------------------------------
---------------
>NCAS0B06260
MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNN--SQTACLKRV
IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARS----TVLAGAYEVFLLMEYCKG
GGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK
ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKS---DIWA
LGVFLYKLCYYTTPFEKG-GEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC
QLLEEISRIQGIPCPINNFYLSRTINVQASLMNPIITPT---------------------
------------------------------------------------------------
------------------------------------------------------------
-------QQTALKHSQSS---------------ATISDQSYAVPLASSRSSTTT--GNKP
ILIETEIPDMSQGSDDV----------YSRIHPFQKSQ----------------------
-----------------------------TLRTPSRSSSPIKYTGT--LLQKSTSSNSNT
SGNKSHY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTFS---TSSRRLSRSSSVRSASS-RSSDQLKEHRTGGSITQF
F-T-----------------STLKRVVTGESRNTSPIRSRQNT-GGSIRSAFDALRSGIT
GNTNSRVSSLAS--------------SVRNVSSSSKHSKHSDAD----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DEPNKIKIRMKK-------AHRRSVPPNLYSDFYAN---
----EDTPKLYSSNSP---VKLKSL-----------------------------------
-------------STQRESIQNRVKALLETFE-EEPST-IKTASGYGKYTDSEFITSPV-
--------------------PERGGRIPTPTNKRYSS-----------------------
---VIINPVTEPI-----SIRPSPPP--------KPKHLRPIPPPKPTR-----LSK---
IYPDERISS-TATERIVNLDVESLE-----KDFKRRFPSRI-------------------
---------------
>KAFR0J01370
MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN--SNIACLKRV
IVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKS----AIYNGAYEVFVLMEFCER
GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK
VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKS---DIWA
LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC
QVLEEVSRLQGIPCPIRNFYLLRAMENNKRTIEQPVQNV---------------------
------------------------------------------------------------
------------------------------------------------------------
---------YMPTTLSQPSTQMNLASLNDTLPTAALKFNQTTIPPTNQHSPHLLHTQTLP
LPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTSNK-------------------NVI
DTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQ--KSWKSINDNYDV
SKRPTNY-----------------------------------------------------
------------------------------------------------------------
------------VDEETQTYTGQSTFLRRTSSNRSNRSISS--QYSGVQENTTGSSLVRK
L-S-----------------VKLKNVLTGES-----IKSRQNT-GDSIRSAMNSIRSGFT
GNNNNTRSASYDN-------------GKRLSSVNLHMHSAILEQ----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DDSDEFEMPRYN-----------SVSSNTLKDVEEHERR
TVN-TSSREYYRSQSP---VRMSVN-----------------------------------
-------------REMKNSIQKRVQDLLKNAE-ENTTATVRTASGYGKYTDYNKNKDEIS
--------------------PTKSRVAQFNQSTAALA-----------------------
--------SLSGK-----RKKPPVPY--------KRDSLKPTPPAKPAF-----LSSRP-
--VASSRVSSNATDMLVDLSVDDIE-----KDIRRRFPSTVG------------------
---------------
>NDAI0G00640
MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFIN--SSIVCLKRV
IVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKF----DTNIGSYEVFLLMEYCDR
GGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK
LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKS---DIWA
LGVFLYKLCYYTTPFEKT-GENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIY
QLLEEVSKIQNVPCPIPDFYLQRKLAQAQAQTQAQD------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------VVMNVPIPSYPVAIPAITNNN--GSYN
YNMSIASATINPQNAN---------NNNTNNNPYTVAS----------------------
---------------------------NNVTGILQSINAPLLNVPL--QPNRPISSQKKH
IQKSQTMP----------------------------------------------------
------------------------------------------------------------
------------MPSMDANLKKSTCQLGHTTLSIPNKNNDVIQKRASVSSSRSSPLLQER
IIS-----------------TDMSFSSDDDKDDDSSIHTDEQN----VKIDTQPLTHTIS
K-------------------------TKSLFDNNDNVEHGRSLN----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KHATKREKHRSL-----PPLQRNTLKNNFDQMYD-----
----DTTQSNSKSSTP---EKSILSN----------------------------------
-------------QETKEQIKKKMLEKL--------------------------------
--------------------QRVKSITASTPTLPTTS-----------------------
----------------------------------NDKEVAQKKKQNQLF-----L-----
------------------------------------------------------------
---------------
>Smik_9.84
MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN--ANIACLKRV
IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEFCER
GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK
VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWA
LGIFLYKICYYTTPFEKS-GEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC
QVLEEVSRLQIKPCPIRNFYLLRAMSQTA--QLASEPPS---------------------
------------------------------------------------------------
------------------------------------------------------------
-------MKYVPTQKFLPAQGL-----------QSMKPISNMIPVSHVRTTPNL--STLP
RSIDDNNMTDVTKQISLQF-VGD----SNVDTPLKKTK---------------SV--PLS
DDFASLYYRELHPFQKSQTFK----SVENFQSPQRRSMPPSSLPPA--NSIILDKT--PT
MNRPNNY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTTDIITMSGSKLSPALTNKPVNS-QKEFIAPENVSGGNIVRS
L-S-----------------SKLKKVITGESRGSSPIKSRQNT-GDSTRSALGMLRHGFT
GSSMNNNRSASFDSNNGSSNNNSV--NRRLGSSSTS-SLSVFNP----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DTKRQEEIDKKQ-----KLENRRSMPSSILSDFDQHERI
NSR-TGSRDYYRSHSP---VKKIQTTSKSAPKPITKPVIG--------------------
--------DININQEKKESIQRRVHNLLKSSE-DPLTY--KSASGYGKYTDTDT---ETS
--------------------NRHSSVRITPITEEKFK------SRNKNG-----------
LSNNKTKDNDRHK-----SRPPRPPP--------KPLHLRAEIQKVRSS---SRLHSGE-
LSSE-RISS-DATETIVEVNVDDLE-----ADFRKRFPSKV-------------------
---------------
>YIL095W
MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANIACLKRV
IVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-----VNGIAYEVFVLMEFCER
GGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYK
VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWA
LGVFLYKICYYTTPFEKS-GEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNIC
QVLEEVSRLQNKPCPIRNFYLLRAMNQNANTQLAGEPSS---------------------
------------------------------------------------------------
------------------------------------------------------------
-------TTYVPTQKFIPVQSL-----------QSINQPPNMMPVTHVSTTPNL--GTFP
ISINDNNKTEVTAHAGLQV-GSH----SNLTSPLMKTK---------------SV--PLS
DEFASLYYKELHPFQKSQTFK----SVESFQSPQRKSMPPLSLTPV--NNDIFDRV--SA
INRPNNY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTIDNMAVPNLKLSPTITSKSLSS-TKEIAAPDNINGSKIVRS
L-S-----------------SKLKKVITGESRGNSPIKSRQNT-GDSIRSAFGKLRHGFT
GNSVNNSRSASFDNNNVNGNGNNT--NRRLVSSSTS-SFPKFNS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DTKRKEESDKNQ-----RLEKRRSMPPSILSDFDQHERN
NSR-TGSRDYYRSHSP---VKKTQASAKTTSKPTLIPDNG--------------------
--------NVNINQEKKESIQRRVHNLLKSSD-DPVTY--KSASGYGKYTDIGT---ETS
--------------------NRHSSVRITPITEEKFK------KTLKDG-----------
VLDIKTKSNGKDK-----SRPPRPPP--------KPLHLRTEIQKIRNF---SRLQSKK-
LPIE-RISS-EATETIVDVNVDDLE-----ADFRKRFPSKV-------------------
---------------
>Skud_9.78
MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANTACLKRV
IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGIAYEVFVLMEFCER
GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK
VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS---DIWA
LGVFLYKICYYTTPFEKS-GEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC
QVLEEVSRLQNEPCPIRNFYLLRAMGQNA--QLASEPPS---------------------
------------------------------------------------------------
------------------------------------------------------------
-------VTYVSAQQLLPAQTL-----------QGIKHLQSMVPVTHVRTTPNL--GTLT
KAITNNNQTESILPVRTQP-ESD----LNLGNPLMKTK---------------SV--PLS
DDFASLYYRELHPFQKSQTFK----SVESFQSPQRKLSTPSSSSPV--NSKNNDRASTST
VDRPNNY-----------------------------------------------------
------------------------------------------------------------
------------VDSVTQTIDNMAALNLNQSSVAINKPSGP-PKESIVPENVTGGSIVRS
L-S-----------------SKLKKVITGESRSSSPIKSRQNT-GDSIRSAFGMLRHGLT
GSSVSNNRTISFDSNNGNGNGNSV--NRRLASSSS--SSSNFNF----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DTKRQDDLDKKQ-----KLENRRSMPPSILSDFDKHERN
NSR-TGSRDYYRSHSP---VKKNQTTPKTASRTTLKSDSS--------------------
--------DIDVKQVNKESIQRRVHNLLNNSE-DPLAH--KSASGYGKYTDVNA---EAS
--------------------NRHSSVRITPITEGKFN------KYYNSG-----------
TLKGETSRNDKHK-----SRPPRPPP--------KPLHLRTEIQNTRNF---SRLQSRQ-
PQME-RISS-EATETIVDVNVDDLE-----ADFRKRFPSKV-------------------
---------------
>Suva_9.104
MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSS--ANIACLKRV
IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEYCER
GGLIDFMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYK
VCDFGSVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWA
LGVFLYKICYYTTPFEKT-GEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNIC
QVLEEVSRLQNRPCPIRNFYLLRAMNQNA--QFGSESTS---------------------
------------------------------------------------------------
------------------------------------------------------------
-------MTYTPAQQLVSPQSF-----------QNIQAMPNIVPLSNIKTTPNL--DSAS
NFVNNNNKMEAMLQLRTQKLETG----PNFSIPLTKTK---------------SV--PLS
DDFTSLYYKELHPFQKPHTFK----SVEGSQSPQRK-SIPFSPTPV--NSNNYDRV--ST
INRPNNY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTLDSIATLKLKPSPTISNKTTGF-SKESTVPENVTGGKIVRS
L-S-----------------SKLKRVITGESRNGSPIKSRQNT-GDSIRSAFGMLRHGFT
GSSINNSRSTSFDNN----NANSV--NRRLTSSSSNPSSSNLNS----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DTKRKEELDKKR-----KLEHRRSMPPSILSDFDQHERN
NSR-TGSRDYYRSHSP---VKKTQTTPTTTTRPSLKSSNS--------------------
--------DINIDQEKKESIQRRVHNLLNNSE-DSLSY--KSASGYGKYTDTEA---EST
--------------------NRQSSVRITPITEERFN------NYHSSN-----------
TMNDHTSSKDKPK-----SRPPRPPP--------KPLHLRTKIHNTRCS---SNLQSRK-
PPME-RISS-EATETIVDVNVDELE-----ADFRKRFPSKV-------------------
---------------
>TDEL0G02150
MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFID--SNVACLKRV
IVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKS----SFPNGSYEVFLLMEYCAG
GGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK
VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS---DIWA
LGVFLYKLCYYTTPFEKG-GELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVC
QVLEDVSRMQGIQCPVRNFYLLRAMEQQQ-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------QSTQNQLRYSRTQPVLNVPII------
--------------------------SQPVGFPMHQIS----------------------
---------------------------GAPLGSSTSHIVPSNSVPI--LAARPRSAGSNG
TGRSFQT-----------------------------------------------------
------------------------------------------------------------
------------PSTSSLSAKSSQTFHRAASRSPVSTHLSTSPVRHG-------------
--R-----------------GNISQIVESNRTSFDRPRYVDSV-TQTSDTEEEPLKVASK
SSVSLPARESHAVAD-----------KSSVVRSSSLRSKSTSSE----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------RPAV-------------APKQQVAVPHTKLEHIYAAKIP
TGR-QSLRQESEIEIP---LTSVRS-----------------------------------
-------------REAKESIQRRVRDLLNSSE-DLPLS--KSEPKKDE------------
--------------------PKRGQLSKTHHDEKPSV-----------------------
-------KEKSKQ-----KVRPRAPP--------KPAHLRPKPPPKPAF-----LSGKKM
VDTEPS----EAGKAVIDAKVESLE-----RDLRKEVTGTL-------------------
---------------
>NCAS0G03810
MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTN--TNVACLKRV
IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKF----NPNEGSYEVFLLMEYCDM
GGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK
VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKS---DIWA
LGVFLYKLCYYTTPFEKN-GEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSY
QVLEEVSSMQNVQCPIPNFYLMNNNVTQGQMA----------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------MQTQPQNNGAMMASPNMQPYVPNNNFV
YNTPNAVSMNDIQMMNAINLKVNSTHNTGMIPPTMATN----------------------
-----------------------MARTIPMQPVQKSQTLPVSSIPT--NLQNTNKSSPFN
LKSTTTY-----------------------------------------------------
------------------------------------------------------------
------------VDSETQTETPKQTLNKAISSNTEGFSLINEKN----------------
--P-----------------NSVPMLSPSFSTSSSSSSSDENDSVDLRNKAYSPIRTPLK
SQLQDNDERIKKVIQVA---------KEGLSRSRTSLESEPTFK----------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KEKKNKVYNATL-----EKAKKHRSLPVMETTIKPDSTK
PIASKSEISFAEPAVK---SNSKSN-----------------------------------
-------------EETKILIKQKMLEKLNASQ-NQFKK--KSIP----------------
--------------------DGDSIHKNDQ------------------------------
------------------TPKPKVPS--------KPAHLRPKVPKKPAF-----LSSQK-
IK----------------------------------------------------------
---------------
>KAFR0H03330
MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCD--SNIACLKRV
IVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKS----NFNNGSYEVFLLMEYCER
GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK
ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKS---DIWA
IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIY
QVIEEISKMQNVPCPIVNFYL---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------VTQQQKHKMVQLQPIPVNTLN------
---------------------------VSQTHPILQDG----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------KQRILEQHSSSP----------------------------
--------------------MIDHQLKKI-------------------------------
----------------------------------KRFH----------------------
------------------------------------------------------------
---------------