MUSCLE (3.8) multiple sequence alignment

TPHA0D04580        MRNTIMDIR------------------------SYTERRSVIEPHYSVLDLLEANMGGP-
Kpol_2001.73       ------------------------------------MEKHLLDPHYSVLKLLENNFNNP-
TBLA0E02090        MTEQLDANATGKSN--------------SSSGSMDYDKRGFLDPHFSLIELLENAKYSLQ
CAGL0H06545g       -MLRFQRGTVKESSSAKL-----------ASTSRNGPESSILDPHHSVMELLQRQMEGS-
KAFR0D02250        MNVNKEHGNLKGKKAEPL-----------EAPVTTIITNSILDPHLSVLELLERGFQNVH
KLLA0A00660g       MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDPHDSVMDLLNGQQSCAF
AFR283W            MSTKSQVTRRVRTSIATP----------EDGVHGNNQHKGILDPHLSVLEMLDRQDGDG-
Ecym_4021          MSQTVEKMQSNGHT--------------QNGGLPGTTQRSILDPHLSVLEILEGKELNKV
SAKL0E14850g       MRQISMKKSHSGSDIPDP----------SASGSMPFQKRSILDPHFSVLQLLERNGCEQE
KLTH0E01122g       MSQYITNPRQQSRQLRRNSPSGQEPHF-ATSSVPLNQRNSILDPHLSVLQLLDRADPPSE
Kwal_55.19716      MSQYTTASRSRVNDRDPR----------FSTSERLNNRNSILDPHLSVLQLLERNEVHSE
KNAG0L02100        ---------------------------------MSGHANSVLDPHLSVLELLEKS-----
NCAS0G00260        ---MQNIDLVRGNHTWRVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDT-
Suva_9.43          MVLDYQHRETKGSSSKNMAPNSSSMNIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS
Skud_9.22          MVLDYPQRETKGSSSKNMAPNSSSMNIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS
Smik_9.23          MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS
YIL146C            MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS
ZYRO0G06666g       MTSTEGTGGGDGK---------------GISGFSDIERRSILDPHLSVLELLRRPSDTR-
TDEL0B02220        MVSASESKIAKQDRVGEV----------SGVETTAFEKKSLLDPHLSVLELLERTGDTQ-
                                                           .::** *::.:*        

TPHA0D04580        ----------PPSANVISNS-----------TNTQNDWNAI------IDLSDSWQ-----
Kpol_2001.73       --------------------------------------------NDSMNLSESWQ-----
TBLA0E02090        ENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDDINSENQESSELSQSLSNSWQRIQTP
CAGL0H06545g       -------------------------------EVP----------SESGVLGESWQQIRES
KAFR0D02250        EQDDTIMSTTPRDIAVEMAT-----------VRLNSEASGVSTPSVGDIISQSWHTIQRR
KLLA0A00660g       DSRLIQNQ--DLIDRKGKSN-----------NIDHNDINTH---THSKGLTDSWQAIDRD
AFR283W            ----------AGQVEEGAVM-----------TVGKRRVER----SLHHSISESWQAIKRS
Ecym_4021          ----------EGPHELSGAS-----------RVSGKQFEGE--RVLHHSISESWQSIKST
SAKL0E14850g       EDVNQASSQIPVELKSAFNR-----------PLSPHKRYPE---ALNQSISDSWQSIKMV
KLTH0E01122g       ----------LSSLKHGEIA-----------KPATPRRSGF--ESVNCSISESWQSIKHT
Kwal_55.19716      ----------PQEFRHSDIP-----------SPHLLSRSSS--EPMGRSISDSWQSIRHT
KNAG0L02100        -------------CERGGHA-----------EAPGSSRNKG---AGQIQLSESWCTVERD
NCAS0G00260        ----------VM--------------------------------EASSRISRSWQNIESP
Suva_9.43          ----------PLGQSLVTSI-----------DISNHH-------NVIDNISGSWQTIQPL
Skud_9.22          ----------PMGHSLVTSI-----------DISSHH-------YVNDSISGSWQAIHPL
Smik_9.23          ----------PMGQSLVTSI-----------DISGHQ-------NVNDSISGSWQAIQPL
YIL146C            ----------PMGQNLVTSI-----------DISGNH-------NVNDSISGSWQAIQPL
ZYRO0G06666g       ----------PHEALKGEVS-----------DIVGNCAGTT--GTGNGSISQSWQTIHRN
TDEL0B02220        --------------RVGRGV-----------EKADDMAN------TTNSISSSWQAIHRN
                                                                    :  **      

TPHA0D04580        ----------------------------ILSSSSENSEEE--------------------
Kpol_2001.73       ----------------------------ILSSSSENSEED--------------------
TBLA0E02090        DY-SPLDVKDSNSINNINNNT-----VGIL-SSTDSSEEE----QDNISLNTYLRVNSAV
CAGL0H06545g       DV---GDGGDSNFDQQSNT-------SAILSSSSEASEDEDLDIQQQ-------------
KAFR0D02250        DLEESLHNNSNKLVLQSAT-------AGIL-SSSDTSEEEEGYDIN--------------
KLLA0A00660g       EY-SFLNAGNHNNYHNTSNGDFNQQFGGVL--SSDTSEEE----VE--------------
AFR283W            DY-SFLSGTHEVGAMHSS--------VGIL-SSSDTSEEE----AE--------------
Ecym_4021          DY-LFLSRANDTSLQQQSA-------VGIL-SSSDTSEEE----QD--------------
SAKL0E14850g       DY-SILNSLHDTSSSQA---------VGIL-SSSDTSEEE----LD--------------
KLTH0E01122g       DC-SMVNTQGDATHQH----------AGIL-SSSDTSEDE----PD--------------
Kwal_55.19716      DY-SILNLIGETSHQP----------AGIL-SSSDTSEDE----PD--------------
KNAG0L02100        EL-S-AM---ERSASQQTN-------NGVL-SSSDTSEEG----EP--------------
NCAS0G00260        A--DSKQLLSAKSSQVSNL-------VSILSSSSDTSDEE----VD--------------
Suva_9.43          D--LGASFIPERCSSQTTN-------GSIL-SSSDTSEEE----QD--------------
Skud_9.22          D--LGASFVPERSSSQTTN-------GSIL-SSSDTSEEE----QE--------------
Smik_9.23          D--LGASFIPERCSSQTTN-------GSIL-SSSDTSEEE----QE--------------
YIL146C            D--LGASFIPERCSSQTTN-------GSIL-SSSDTSEEE----QE--------------
ZYRO0G06666g       D--SCLSVVPERCPSQATA-------AGIL-SSSDTSEDE----PD--------------
TDEL0B02220        D--AMITGVPERCSSQAAA-------VGIL-SSSDTSEEE--------------------
                                               :*  *:: *::                     

TPHA0D04580        -------------------------------------DIEVRNGTLGRSRNANMSIHAST
Kpol_2001.73       ---------------------------------------------------EQEPFITGS
TBLA0E02090        KEDSSFINPNNNIISLSPTPANGTKKNGTTDYNDDDDDDDEINSKNKDTPKAKNLFNMKT
CAGL0H06545g       ---------------LLGGQQEYKNFHMTAEEQLQEQAQGQGFGRPSLLKGTQSRLSEQD
KAFR0D02250        ---------------GKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKI
KLLA0A00660g       ---------------INAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGD
AFR283W            -----------------------------------------------MRPSAHGTVHLGS
Ecym_4021          ---------------IHPSPPP--------------PNSASSAFDSRIINIAGQAFSATL
SAKL0E14850g       ---------------HLNSPSP-------------SSQQVFPNGPPISFQTQAGVLTASA
KLTH0E01122g       ---------------AQLSPSP--------------NNFAFPNSATSIFPEAPHNLEASS
Kwal_55.19716      ---------------HFLSPSP--------------NEYAFANGAKTVFPEASHAPEGPS
KNAG0L02100        ---------------EQGSPG----------------DGEGGGVADTRMARPAMSLQSTS
NCAS0G00260        ------------------------------------RINSLNSAGEGSSKNYNNPSPLQN
Suva_9.43          ---------------LLQAPAA---------DIINIIKQGQDGTSVTSPSHPFKQLHTVI
Skud_9.22          ---------------LLQAPAA---------DIINIIKQGQEGASVTSPSRPFRQLHKVI
Smik_9.23          ---------------LLQAPAA---------DIINIIKQGQEGTNVTSSSHPFRQLHKVI
YIL146C            ---------------LLQAPAA---------DIINIIKQGQEGANVVSPSHPFKQLQKII
ZYRO0G06666g       ---------------AVNSPSA-----------VHQQLHATPPQKHTKSLEDYRSLNVGI
TDEL0B02220        ---------------IDPASSP---------------NVAHFTQFHQSQQPPRLPFKLDV
                                                                               

TPHA0D04580        TSAYS-------------------------------------------------------
Kpol_2001.73       AITVT-------------------------------------------------------
TBLA0E02090        SKYYPKYRTFTPNDTRLSHMQHSNSNLHISMNNSINNNNFDSSMTSSKDTLTTSFLEIFK
CAGL0H06545g       SNRSGSVRTIVDKGSCSSSL----------------------------------------
KAFR0D02250        CTVSDLNRRVPSNNAMTPDTE---------------------------------------
KLLA0A00660g       PVKSTKTGQFSKAELGAG------------------------------------------
AFR283W            SLASPMRQLLVEEDNS--------------------------------------------
Ecym_4021          SHLRS-------------------------------------------------------
SAKL0E14850g       TLPNPG------------------------------------------------------
KLTH0E01122g       LREYQNSEIAN-------------------------------------------------
Kwal_55.19716      LATLQDSVYEHSN-----------------------------------------------
KNAG0L02100        STL---------------------------------------------------------
NCAS0G00260        PIYLPEFTDVTAG-----------------------------------------------
Suva_9.43          SLPMPPRERTFYGEQEDVVCI---------------------------------------
Skud_9.22          SLPLPAKGRTSYGEQDDDD-----------------------------------------
Smik_9.23          SLPIPSREKTPYKEQDIN------------------------------------------
YIL146C            SLPLPGKEKTPFNEQDD-------------------------------------------
ZYRO0G06666g       PLVLPEDSNNINNNNKNGSTTGS-------------------------------------
TDEL0B02220        PVILPARDQEPSGQTQTPD-----------------------------------------
                                                                               

TPHA0D04580        --------------------------------------------HSYFDQSASDTSS---
Kpol_2001.73       --------------------------------------------NPNSSNSNCTSNN---
TBLA0E02090        DNSNSNSKNLNNEFNNDIDLKIKHLVLSNSLDNDDQSNSTITNSYNNLNLTKSMTSS---
CAGL0H06545g       -------------------------------DEHE---LNSIFTSDSMSLTKSTGSS---
KAFR0D02250        -------------------------------EEEE--------GEDYMTASKSLTSS---
KLLA0A00660g       -------------------------------TGED------------ETIMVNLGHSWA-
AFR283W            -------------------------------CAEE---------DDCQTVTISMPSS---
Ecym_4021          -------------------------------EDED---------DDGETVTVSLPNT---
SAKL0E14850g       -------------------------------VLEE---------DDNETVTVSLAAS---
KLTH0E01122g       -------------------------------PREE---------NDNETVTMSLMNS---
Kwal_55.19716      -------------------------------VAED---------NDNETVTLSLINS---
KNAG0L02100        -------------------------------DGVD---------DDSATVSKSLTSS---
NCAS0G00260        -------------------------------DNDD---------GIASTITKSLTSSSTI
Suva_9.43          -------------------------------DNDD---DNGMYEEDSVTITKSLTSS---
Skud_9.22          -------------------------------NNVDDDYDDGAYEEDSGTITKSLTSS---
Smik_9.23          -------------------------------DDED-----GAYEEDSVTITKSLTSS---
YIL146C            -------------------------------DGDE----DEAFEEDSVTITKSLTSS---
ZYRO0G06666g       -------------------------------NGEE---------DDNDTITKSLNSS---
TDEL0B02220        -------------------------------NDDE---------RDDETLTKSLSNS---
                                                                           .   

TPHA0D04580        SNQFVMPRL--------SYS---KKE---GSLKAISVV-G-SHADSFYQEYLQVSTGEYC
Kpol_2001.73       GSTFIMPKLIVS----QNLWDTNNDN---NNNRFLIV--G-NNSLFFYNEILP---INYK
TBLA0E02090        SNSFIMPKL--------SWT---NTF---RKFRILIL--GSNQNLTFYQ-NIP---TSYK
CAGL0H06545g       STSFVMPKL--------SLTY--KPS---QAKKLLVV--G-RLSKRFHQ-DIP---REYR
KAFR0D02250        STSFIMPRL--------SLTKKERQQLNANEFRILIV--G-RLSSKLFK-MIP---HKFQ
KLLA0A00660g       GSFFVMPKL--------SLS---ESM---KRFKILILSDG-DSANSFYN-RLS---RYHR
AFR283W            STSLVMPKL--------SLS---QRL---GEPQLLLV--G-QPARKFWL-TIP---KCYQ
Ecym_4021          MTSLVMPKL--------SLS---DRI---IESKVLIV--G-QPARKFWF-SIP---KSYQ
SAKL0E14850g       SNSFVMPQL--------SLS---QRS---HRFEILVV--G-KPARKFWN-NVP---KMYQ
KLTH0E01122g       SNSFVMPKL--------SLI---QQS---QKFCILIV--G-KPAQRFYR-DIP---RAYH
Kwal_55.19716      SNSFVMPKL--------SLA---QPL---RKFSILIV--G-KPAQRFYR-DIP---RAYQ
KNAG0L02100        SNSFIMPKLYTTVAGAPSTVSTALQT---RCFKVAVL--G-RGAVKFCQETVP---EQFR
NCAS0G00260        SNSFVMPTL--------SLSSSQSQQ---RKFQILIF--G-RLGPSFYR-TIP---KQYQ
Suva_9.43          TNSFVMPKL--------SLS---RKN---PVFRLLIL--G-RTGTNFYQ-STP---KEYQ
Skud_9.22          TNSFVMPKL--------SLS---QKN---PVFRLLIL--G-RTGSNFYQ-SIP---KEHQ
Smik_9.23          TNSFVMPKL--------SLS---QKN---PVFRLLIL--G-RTGSNFYQ-SIP---KEYQ
YIL146C            TNSFVMPKL--------SLT---QKN---PVFRLLIL--G-RTGSSFYQ-SIP---KEYQ
ZYRO0G06666g       SNSFIMPKL--------SLS---QKT---QKFRILVL--G-RPGLKFYH-SIP---KKYQ
TDEL0B02220        SNSFVMPKL--------SLS---QKS---HKLRILIL--G-RPGLKFYQ-SIP---KRYQ
                    . ::** *        .                  .  *      :           . 

TPHA0D04580        FMLDV--STDNSVSLLVVQNHLELLDILRHSRD-ITVVAIVLSLDHRRGDNLEII-----
Kpol_2001.73       KFFKI-WCLNKL-------DSSNLIIIINDHNELFNILQKILLNSNRKSCFNIIIILIIE
TBLA0E02090        YLFELPPNNFDY----NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKK---PII-----
CAGL0H06545g       QYFHI-SQSSDP---SEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKK----PII-----
KAFR0D02250        NLFQL-QKSYDI---NEYQKFTAILVVIQETRELISLLNRISRSEKVKR---PLI-----
KLLA0A00660g       LMFDV-GKLNEASKEEAL-KYTAFMIIFSDSKKVTTILNRMWKKYGDF----TLI-----
AFR283W            KLFDV-KNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCP----TVI-----
Ecym_4021          KMFEI-CSLSVLRDKDVDEKYSTIMVIFHDMGLAPELLDRICNKVVRP----RII-----
SAKL0E14850g       KMFDI--GDFESISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGK----AII-----
KLTH0E01122g       KMFEV-RDVGHL-SPREMNKYSAVMVIFGEPKEGKELLEKVAAHNS------NII-----
Kwal_55.19716      KMFEV-CDAESFKTRDVD-QFSAIMVIFTDPKNGQSLLEMVTGRSS------NII-----
KNAG0L02100        HRFELTAGVHDL---AQCADRQGILIVVQEVRELISLLNRVHCACPEV----PVV-----
NCAS0G00260        YLFHV-PNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFKKVPPPII-----
Suva_9.43          SLFEL-PKSHDS---TIFPQYTGIVIVFQELREMVSLLNRIVEYAQGK----PII-----
Skud_9.22          SLFEL-PKYHDS---TAFPQYTGIIIIFQELREMVSLLNRIVQYSQGK----PII-----
Smik_9.23          SLFEL-PKYHDS---ATFPQYTGIIIIFQELREMVSLLNRIVQYSQGK----PII-----
YIL146C            SLFEL-PKYHDS---ATFPQYTGIVIIFQELREMVSLLNRIVQYSQGK----PVI-----
ZYRO0G06666g       HMFEL-PRSHDP---AEFKQYTGILVVFQELKEMVSLLNRVCQCNPNR----PVI-----
TDEL0B02220        HFFEL-SRLQDP---SEFRQFTGILIVFQELKEMVSLLNRVCQCAPTR----PVI-----
                     : :                  .  :.        ::  :            ::     

TPHA0D04580        ----KNCNK--------VLS-------------SMKERKWPMLYYPNLIIIHERANNNHG
Kpol_2001.73       KFNNLITNRRKIKLIKNSINIINKQFNLKKINFNFFNPSILIIYKNSKLI------NYNK
TBLA0E02090        ----PICEKGQINEVKNILK-------------PYIKTKDLSLLYPPIVG------TNRD
CAGL0H06545g       ----PICQPGQRIRVKNILK-------------SFLKNDAITLWYPPVTI------ANEK
KAFR0D02250        ----AICEKDAFLQCKNVLK-------------SYLRNDLITLLYQPFVI------SNTE
KLLA0A00660g       ----PICQKGQKQSVTEKVK-------------TFANSNKIKLMSYPVVI------SDHY
AFR283W            ----PVCQKGQKSTLAALLK-------------RYTARKCIRVYCSPIIM------SNHH
Ecym_4021          ----PICQKGQKQHLSSLLK-------------QYVSGNRIKLFCNPIVM------SNHH
SAKL0E14850g       ----PICQRGQKQQLASLLE-------------PFVKAKKIRLMFQPTVM------SNHQ
KLTH0E01122g       ----AVCQRGQQQQISNILN-------------RYSKSNEIRLVYHLTVM------SDHQ
Kwal_55.19716      ----AVCQRGQQQQISNLLN-------------RFSKTHHLRLIYHLTVM------SDHQ
KNAG0L02100        ----AVYDRDRQVQVKNVLR-------------NFTRQRLVSLLHPPVPL------SNNE
NCAS0G00260        ----PICQPGQKIKVKSILK-------------YFLKNNFVTLLSPIIII------NDER
Suva_9.43          ----PICQPGQTIQVKNVLK-------------SFLKNSLIKLLYPPVVA------TNRK
Skud_9.22          ----PICQPGQTIQVKNVLK-------------SFLRNKLIKLLYPPVVV------TNRR
Smik_9.23          ----PICQPGQTIQVKNVLK-------------SFLRNKLIKLLFPPVVV------TNRK
YIL146C            ----PICQPGQVIQVKNVLK-------------SFLRNKLVKLLFPPVVV------TNKR
ZYRO0G06666g       ----PVCQSGQRQQVRNLLE-------------SLLKNRLVSLLYPPVVV------NNQP
TDEL0B02220        ----PVCQTGQHQQVRNVLE-------------SLLKSKLISLLYPPVVI------SNHS
                          :          :                       :                 

TPHA0D04580        SKTKVIANLLQFLR--EH----EPSKLNGSIRSDTVSQERSERMIKELFKPNSAPVNNKK
Kpol_2001.73       NFNNFLIFIKNYLS--NS---------------KN-----------HTSKDLISANDNII
TBLA0E02090        GMNTLYLHLNDLSKNVELEITRDKSNNNINNNNNSINGDGRHLHHNDYESNSGDDEADNF
CAGL0H06545g       SMEKLFKHTVKLVN--KL---------------EN-----------EEDVLSLSTSDKSL
KAFR0D02250        ELDRMLVFLKETSI--KFYEQAYNPKIQIKEKVPN-----------DGNRNAPTSSDLTL
KLLA0A00660g       EIHGLLRHLHSLYV--EV---------------DS-----------DYETDIPK------
AFR283W            EKHRLLKHLHNLCN--ES---------------ES-----------GYETELTV------
Ecym_4021          EKHRLLKHLHQLSS--GS---------------DS-----------GYETEVTV------
SAKL0E14850g       EIHKLLRYLHRLST--EI---------------DS-----------GYETDETH------
KLTH0E01122g       DVHRLLRYLNTLST--EV---------------DS-----------GYETEVGS------
Kwal_55.19716      DVHRLLRYLYTLSN--EI---------------DS-----------EYDTEVGP------
KNAG0L02100        ALDKMFHFVDNLAR--QQ--------------EPA-----------GVIHNDPQ------
NCAS0G00260        ALLKMFKTMQSISK--TV----ISASSSTTSSDNE-----------EEESSDPSMNDKVI
Suva_9.43          DLKKMFQRLQDLSL--EY-----------VEDEKN-----------EDEDEDND--DEII
Skud_9.22          DLKKMFQRLQDLSL--EY---------------AE-----------DGDNDDEDNDDEII
Smik_9.23          DLKKMFQRLQDLSL--EY-----------AEDENE-----------EGDDDETT------
YIL146C            DLKKMFQRLQDLSL--EY----------------------------GEDVNEEDNDDEAI
ZYRO0G06666g       DLLGMFRFLQELSK--TV-------------SDNS-----------DMDAEEPNNGSKRL
TDEL0B02220        DLNNMYRFLLDLSK--TI-----------SDNSED-----------DEDEEERELLDKKI
                       .                                                       

TPHA0D04580        NLSRSSIRAIRNVKSMRKSK------------------------YKPRI--------PLT
Kpol_2001.73       I-PSQLLNKRKRLIKSNKKK------------------------KKSKKSKLNSLNKYNQ
TBLA0E02090        DILQSPNFSANLKRRVKKSKLSTSSSNSVLKDSRVTTKNMRISSSTNRKEDVSSAKKKKR
CAGL0H06545g       S-DET-----------SGYR------------------------KNNRR--------KKH
KAFR0D02250        S-KDRVKNDKHRHTKGDGSG------------------------GSKKG--------NEH
KLLA0A00660g       -------------------K------------------------TKPRK--------GAK
AFR283W            -----------------KSK------------------------KQHRR--------PRK
Ecym_4021          ----------------EPVK------------------------KLPRK--------AKK
SAKL0E14850g       ----------------LKVR------------------------KRKK---------THK
KLTH0E01122g       ----------------RKIR------------------------KRRKS--------SK-
Kwal_55.19716      ----------------RKVR------------------------KR-RK--------SYK
KNAG0L02100        ----------------TTQE------------------------QHPDH----NEDDPHR
NCAS0G00260        D------VKTIKESMMSSQK------------------------KKNKK--------KHH
Suva_9.43          Q-PYSRSYYRSKKG--GSSK------------------------KKSSK--------SNK
Skud_9.22          H-TNSRSYYRNKKA--NSSK------------------------KKSFK--------SNK
Smik_9.23          ---KSRSYYRYKKA--NNSK------------------------RKSPK--------SNK
YIL146C            H-TKSRSYCRNKKA--ENSK------------------------KKSPK--------SNK
ZYRO0G06666g       K----RSLQRKKKKFIETSA------------------------ERNGR--------PHK
TDEL0B02220        K----KSHQRKKKR--AGSY------------------------DKTDK--------PRK
                                                                               

TPHA0D04580        ERDKSGIGKKDDKNQNDKDW---------------FYKWSVSISIGIGIGVGYCLSTI--
Kpol_2001.73       NDDDDDSNST-------GKW--------------LFVYYGISITLGVGVG--YCISS---
TBLA0E02090        KTIEQLKCYATVEDFPKNSWKTNNNQNTYTKKLKKIIYWTVSLSVGVGLG--FCLSY---
CAGL0H06545g       GGKPSTNY---------SKW----------------ITWGISLTIGVSIG--YYATY---
KAFR0D02250        DRKPKENEEY-------NKW----------------IIWGISLSIGVGIG--YCISY---
KLLA0A00660g       --KKPAPHLA-------KRW----------------WFWPISIALGVGIG--CCVTFYFS
AFR283W            --KDAGPVAL-------RHW----------------AIWTASFTIGIGIG--CCISL---
Ecym_4021          --RPSKPSTF-------RDW----------------VVWTASITIGIGIG--CCVSL---
SAKL0E14850g       --KKSKGTS--------NRW----------------VIWGLSLTVGVGIG--CCISF---
KLTH0E01122g       --KRSPQITV-------NRW----------------VIWSISLTVGVGLG--YCISC---
Kwal_55.19716      --KRETPAAV-------NRW----------------VIWSISLTVGVGIG--YCISC---
KNAG0L02100        GPSKPEGTF--------KRW----------------LLWGVSISLGIGAGY-YCVSY---
NCAS0G00260        NNRRKEHVRSSSTSFFKNKW----------------VVWSISLTVGAGMG--YIISY---
Suva_9.43          KSKKKKQRSS-------TRW----------------FTWGVSITIGISFG--CCVTY---
Skud_9.22          KPKKKKQRSL-------TRW----------------FTWGVSITIGISFG--CCVTY---
Smik_9.23          KPKKKKQRFF-------TSW----------------FTWGISITIGISFG--CCVTY---
YIL146C            KPKRKKQKFF-------TSW----------------FTWGISITIGISFG--CCVTY---
ZYRO0G06666g       --KRHNNEKV-------NRW----------------VLWGVSLTLGVGVG--YCISH---
TDEL0B02220        --RRSKETKI-------NKW----------------IVWGISLTVGVGVG--YCMSY---
                                      *                  :  *:::* . *     :    

TPHA0D04580        -IPSTTFSYL----------LRDFDSNETNDLIAYMDV---------------VTDTDSD
Kpol_2001.73       -LVVS---------------QNSNDIQSIVPSTPNNDI----------------------
TBLA0E02090        -YASTIFSNISESISKGINTLISESVTPTVSDTPIPSP------------TTYSMEENLS
CAGL0H06545g       -MITTTLLY---GKAESHHANEAKGFSITNGNSGSSSI-------------------SHS
KAFR0D02250        -FGSSPWSSL---VQYFN--PESDSISATVPVPLSNES---------------FVLLHDS
KLLA0A00660g       KFETSSYNS---SVGVIQ--TADKEIDAIVDAIEGNSP---------------SILEESS
AFR283W            -MATTRFTFF--SSAPLP--LTAVIPAQIPSSVASDKP----------------------
Ecym_4021          -MVSTRYAFL--VPRQLA--VDDITSSPLSPEGTDKSS----------------------
SAKL0E14850g       -ILSSYSSSV--QIPHAS--RDDVVLVEEVPTLPDKAE----------------------
KLTH0E01122g       -LLSSTSSTL--SVTLRS--GDEVTIMEDIHNSPHESP----------------------
Kwal_55.19716      -LLSSTMSVRGNTLTLHS--SDEIALIEEAPISPHETV----------------------
KNAG0L02100        -VVSSSM-----CVSCFNFRHTDHTLAATTSTAAAAAA-------------------AAT
NCAS0G00260        -CVFNSSKRL--PLEKIAHQTRPGPLSSLIHLKSNKNL---------------LYLERTT
Suva_9.43          -FVTAAYDHQ--TIRSLN--SRSSFFASFLSLDPSSDT----------------------
Skud_9.22          -FATAAYDHQ--TGKSFN--LRSSILTSLLSLDSYHDTVNTPATTSTSSGEQFLWFDKGT
Smik_9.23          -FVTAAYDHQ--TVKSLS--LRSSLLTSMLSLDSSSDTVNTPATASPSSSEHFLWFDKGT
YIL146C            -FVTAAYEHQ--TVKSLS--LRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGT
ZYRO0G06666g       -LVSSTWIS-----------LTTNPLGPVDPESVSKDL---------------FVFDRQE
TDEL0B02220        -FASSGLIS-----------MSAKSIASINGCRPNDNV---------------VVFDDSS
                                                                               

TPHA0D04580        FIKDTIDNGQTINLPQTWDFLTSTVRHICVIMKYIILKPISF-LGSNWQNL-------DD
Kpol_2001.73       IALESQDLNSHNGDDYNWNFLKLSIKNVYSILKRFITTSINLLEYKT----------LND
TBLA0E02090        TTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQGL-NGVDQILPSKYNFYEDP
CAGL0H06545g       TEYYESTISQKGLLRNTIVFIKRTIHNLNGKVGTFFAS----------ITQVIKQTPVRE
KAFR0D02250        DN----DSETKKYFFKSINFLKYSINKVKVIIKDTIRKPL---NAFSYLNGLNT----DD
KLLA0A00660g       PQS------ISDFLGQVCKLVKDTAIQINELLKQFLSAHL---MTSAWIQSIGKEFMQPD
AFR283W            ---------PHRLVPHFYMLCKTTIRQLGTSLRLFFFEKF---ESRTWVHIFGMDLHSDD
Ecym_4021          ----------HNLFLHAYSLCKTSLKKLASSLRPFFSDRL---ESCTWIHTLGIELSYDD
SAKL0E14850g       ---------GNGPIGQVITLLRKTVKQFNLVLKQFIYEQV---GSLSWIQRVGKELISED
KLTH0E01122g       ---------FDNYLRHLLLAVKRAVKQVNSSFKQYLSGQS---LPVLWMQRIGKEWLSEA
Kwal_55.19716      ---------LENYFRQLVLAFKKAVKQVSQSFKQCLHGHS---LPVLWMQRIGKDWMSEA
KNAG0L02100        PSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDR-------SQEWHLHD
NCAS0G00260        P-----NDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWKFDE
Suva_9.43          ------DGHSRHYFCLFWGHASDKLQ----FGRIHYEKSQRHKGNMGTISIKTLIFPLMN
Skud_9.22          LQI---NFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNK----NSDFSLDE
Smik_9.23          LQI---NFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPLSFLENLNR----SSDFSIDE
YIL146C            LQI---NFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKFLENLNK----SSEFSIDE
ZYRO0G06666g       LKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPAN--CLEWPTSD
TDEL0B02220        LGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTN--YKEWGAED
                                                                               

TPHA0D04580        SN----RIIAMSYVLL
Kpol_2001.73       SN----KIIAMSYVLL
TBLA0E02090        A-----MILALGFVLL
CAGL0H06545g       DN----QFYTLGYMLS
KAFR0D02250        AS----SLLALGYILI
KLLA0A00660g       SQSTISKVTALDLVMF
AFR283W            PLASLGRLMPLDFIML
Ecym_4021          SLISMGRIMPLDFIML
SAKL0E14850g       SDGTVGRVAALDLVLL
KLTH0E01122g       SDPTLPGVTALDLVLV
Kwal_55.19716      SDTTLPGVTALDLVLI
KNAG0L02100        PN----RFLQLGYAVI
NCAS0G00260        QD----RILALCYLLL
Suva_9.43          LI----GFWHSVIFYY
Skud_9.22          SN----RILALGYILL
Smik_9.23          SN----RILALGYILL
YIL146C            SN----RILALGYILL
ZYRO0G06666g       EHTN--RVLALGYVML
TDEL0B02220        NSN---RVLALGYILL
                          .        

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0D04580
MRNTIMDIR------------------------SYTERRSVIEPHYSVLDLLEANMGGP-
----------PPSANVISNS-----------TNTQNDWNAI------IDLSDSWQ-----
----------------------------ILSSSSENSEEE--------------------
-------------------------------------DIEVRNGTLGRSRNANMSIHAST
TSAYS-------------------------------------------------------
--------------------------------------------HSYFDQSASDTSS---
SNQFVMPRL--------SYS---KKE---GSLKAISVV-G-SHADSFYQEYLQVSTGEYC
FMLDV--STDNSVSLLVVQNHLELLDILRHSRD-ITVVAIVLSLDHRRGDNLEII-----
----KNCNK--------VLS-------------SMKERKWPMLYYPNLIIIHERANNNHG
SKTKVIANLLQFLR--EH----EPSKLNGSIRSDTVSQERSERMIKELFKPNSAPVNNKK
NLSRSSIRAIRNVKSMRKSK------------------------YKPRI--------PLT
ERDKSGIGKKDDKNQNDKDW---------------FYKWSVSISIGIGIGVGYCLSTI--
-IPSTTFSYL----------LRDFDSNETNDLIAYMDV---------------VTDTDSD
FIKDTIDNGQTINLPQTWDFLTSTVRHICVIMKYIILKPISF-LGSNWQNL-------DD
SN----RIIAMSYVLL
>Kpol_2001.73
------------------------------------MEKHLLDPHYSVLKLLENNFNNP-
--------------------------------------------NDSMNLSESWQ-----
----------------------------ILSSSSENSEED--------------------
---------------------------------------------------EQEPFITGS
AITVT-------------------------------------------------------
--------------------------------------------NPNSSNSNCTSNN---
GSTFIMPKLIVS----QNLWDTNNDN---NNNRFLIV--G-NNSLFFYNEILP---INYK
KFFKI-WCLNKL-------DSSNLIIIINDHNELFNILQKILLNSNRKSCFNIIIILIIE
KFNNLITNRRKIKLIKNSINIINKQFNLKKINFNFFNPSILIIYKNSKLI------NYNK
NFNNFLIFIKNYLS--NS---------------KN-----------HTSKDLISANDNII
I-PSQLLNKRKRLIKSNKKK------------------------KKSKKSKLNSLNKYNQ
NDDDDDSNST-------GKW--------------LFVYYGISITLGVGVG--YCISS---
-LVVS---------------QNSNDIQSIVPSTPNNDI----------------------
IALESQDLNSHNGDDYNWNFLKLSIKNVYSILKRFITTSINLLEYKT----------LND
SN----KIIAMSYVLL
>TBLA0E02090
MTEQLDANATGKSN--------------SSSGSMDYDKRGFLDPHFSLIELLENAKYSLQ
ENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDDINSENQESSELSQSLSNSWQRIQTP
DY-SPLDVKDSNSINNINNNT-----VGIL-SSTDSSEEE----QDNISLNTYLRVNSAV
KEDSSFINPNNNIISLSPTPANGTKKNGTTDYNDDDDDDDEINSKNKDTPKAKNLFNMKT
SKYYPKYRTFTPNDTRLSHMQHSNSNLHISMNNSINNNNFDSSMTSSKDTLTTSFLEIFK
DNSNSNSKNLNNEFNNDIDLKIKHLVLSNSLDNDDQSNSTITNSYNNLNLTKSMTSS---
SNSFIMPKL--------SWT---NTF---RKFRILIL--GSNQNLTFYQ-NIP---TSYK
YLFELPPNNFDY----NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKK---PII-----
----PICEKGQINEVKNILK-------------PYIKTKDLSLLYPPIVG------TNRD
GMNTLYLHLNDLSKNVELEITRDKSNNNINNNNNSINGDGRHLHHNDYESNSGDDEADNF
DILQSPNFSANLKRRVKKSKLSTSSSNSVLKDSRVTTKNMRISSSTNRKEDVSSAKKKKR
KTIEQLKCYATVEDFPKNSWKTNNNQNTYTKKLKKIIYWTVSLSVGVGLG--FCLSY---
-YASTIFSNISESISKGINTLISESVTPTVSDTPIPSP------------TTYSMEENLS
TTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQGL-NGVDQILPSKYNFYEDP
A-----MILALGFVLL
>CAGL0H06545g
-MLRFQRGTVKESSSAKL-----------ASTSRNGPESSILDPHHSVMELLQRQMEGS-
-------------------------------EVP----------SESGVLGESWQQIRES
DV---GDGGDSNFDQQSNT-------SAILSSSSEASEDEDLDIQQQ-------------
---------------LLGGQQEYKNFHMTAEEQLQEQAQGQGFGRPSLLKGTQSRLSEQD
SNRSGSVRTIVDKGSCSSSL----------------------------------------
-------------------------------DEHE---LNSIFTSDSMSLTKSTGSS---
STSFVMPKL--------SLTY--KPS---QAKKLLVV--G-RLSKRFHQ-DIP---REYR
QYFHI-SQSSDP---SEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKK----PII-----
----PICQPGQRIRVKNILK-------------SFLKNDAITLWYPPVTI------ANEK
SMEKLFKHTVKLVN--KL---------------EN-----------EEDVLSLSTSDKSL
S-DET-----------SGYR------------------------KNNRR--------KKH
GGKPSTNY---------SKW----------------ITWGISLTIGVSIG--YYATY---
-MITTTLLY---GKAESHHANEAKGFSITNGNSGSSSI-------------------SHS
TEYYESTISQKGLLRNTIVFIKRTIHNLNGKVGTFFAS----------ITQVIKQTPVRE
DN----QFYTLGYMLS
>KAFR0D02250
MNVNKEHGNLKGKKAEPL-----------EAPVTTIITNSILDPHLSVLELLERGFQNVH
EQDDTIMSTTPRDIAVEMAT-----------VRLNSEASGVSTPSVGDIISQSWHTIQRR
DLEESLHNNSNKLVLQSAT-------AGIL-SSSDTSEEEEGYDIN--------------
---------------GKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKI
CTVSDLNRRVPSNNAMTPDTE---------------------------------------
-------------------------------EEEE--------GEDYMTASKSLTSS---
STSFIMPRL--------SLTKKERQQLNANEFRILIV--G-RLSSKLFK-MIP---HKFQ
NLFQL-QKSYDI---NEYQKFTAILVVIQETRELISLLNRISRSEKVKR---PLI-----
----AICEKDAFLQCKNVLK-------------SYLRNDLITLLYQPFVI------SNTE
ELDRMLVFLKETSI--KFYEQAYNPKIQIKEKVPN-----------DGNRNAPTSSDLTL
S-KDRVKNDKHRHTKGDGSG------------------------GSKKG--------NEH
DRKPKENEEY-------NKW----------------IIWGISLSIGVGIG--YCISY---
-FGSSPWSSL---VQYFN--PESDSISATVPVPLSNES---------------FVLLHDS
DN----DSETKKYFFKSINFLKYSINKVKVIIKDTIRKPL---NAFSYLNGLNT----DD
AS----SLLALGYILI
>KLLA0A00660g
MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDPHDSVMDLLNGQQSCAF
DSRLIQNQ--DLIDRKGKSN-----------NIDHNDINTH---THSKGLTDSWQAIDRD
EY-SFLNAGNHNNYHNTSNGDFNQQFGGVL--SSDTSEEE----VE--------------
---------------INAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGD
PVKSTKTGQFSKAELGAG------------------------------------------
-------------------------------TGED------------ETIMVNLGHSWA-
GSFFVMPKL--------SLS---ESM---KRFKILILSDG-DSANSFYN-RLS---RYHR
LMFDV-GKLNEASKEEAL-KYTAFMIIFSDSKKVTTILNRMWKKYGDF----TLI-----
----PICQKGQKQSVTEKVK-------------TFANSNKIKLMSYPVVI------SDHY
EIHGLLRHLHSLYV--EV---------------DS-----------DYETDIPK------
-------------------K------------------------TKPRK--------GAK
--KKPAPHLA-------KRW----------------WFWPISIALGVGIG--CCVTFYFS
KFETSSYNS---SVGVIQ--TADKEIDAIVDAIEGNSP---------------SILEESS
PQS------ISDFLGQVCKLVKDTAIQINELLKQFLSAHL---MTSAWIQSIGKEFMQPD
SQSTISKVTALDLVMF
>AFR283W
MSTKSQVTRRVRTSIATP----------EDGVHGNNQHKGILDPHLSVLEMLDRQDGDG-
----------AGQVEEGAVM-----------TVGKRRVER----SLHHSISESWQAIKRS
DY-SFLSGTHEVGAMHSS--------VGIL-SSSDTSEEE----AE--------------
-----------------------------------------------MRPSAHGTVHLGS
SLASPMRQLLVEEDNS--------------------------------------------
-------------------------------CAEE---------DDCQTVTISMPSS---
STSLVMPKL--------SLS---QRL---GEPQLLLV--G-QPARKFWL-TIP---KCYQ
KLFDV-KNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCP----TVI-----
----PVCQKGQKSTLAALLK-------------RYTARKCIRVYCSPIIM------SNHH
EKHRLLKHLHNLCN--ES---------------ES-----------GYETELTV------
-----------------KSK------------------------KQHRR--------PRK
--KDAGPVAL-------RHW----------------AIWTASFTIGIGIG--CCISL---
-MATTRFTFF--SSAPLP--LTAVIPAQIPSSVASDKP----------------------
---------PHRLVPHFYMLCKTTIRQLGTSLRLFFFEKF---ESRTWVHIFGMDLHSDD
PLASLGRLMPLDFIML
>Ecym_4021
MSQTVEKMQSNGHT--------------QNGGLPGTTQRSILDPHLSVLEILEGKELNKV
----------EGPHELSGAS-----------RVSGKQFEGE--RVLHHSISESWQSIKST
DY-LFLSRANDTSLQQQSA-------VGIL-SSSDTSEEE----QD--------------
---------------IHPSPPP--------------PNSASSAFDSRIINIAGQAFSATL
SHLRS-------------------------------------------------------
-------------------------------EDED---------DDGETVTVSLPNT---
MTSLVMPKL--------SLS---DRI---IESKVLIV--G-QPARKFWF-SIP---KSYQ
KMFEI-CSLSVLRDKDVDEKYSTIMVIFHDMGLAPELLDRICNKVVRP----RII-----
----PICQKGQKQHLSSLLK-------------QYVSGNRIKLFCNPIVM------SNHH
EKHRLLKHLHQLSS--GS---------------DS-----------GYETEVTV------
----------------EPVK------------------------KLPRK--------AKK
--RPSKPSTF-------RDW----------------VVWTASITIGIGIG--CCVSL---
-MVSTRYAFL--VPRQLA--VDDITSSPLSPEGTDKSS----------------------
----------HNLFLHAYSLCKTSLKKLASSLRPFFSDRL---ESCTWIHTLGIELSYDD
SLISMGRIMPLDFIML
>SAKL0E14850g
MRQISMKKSHSGSDIPDP----------SASGSMPFQKRSILDPHFSVLQLLERNGCEQE
EDVNQASSQIPVELKSAFNR-----------PLSPHKRYPE---ALNQSISDSWQSIKMV
DY-SILNSLHDTSSSQA---------VGIL-SSSDTSEEE----LD--------------
---------------HLNSPSP-------------SSQQVFPNGPPISFQTQAGVLTASA
TLPNPG------------------------------------------------------
-------------------------------VLEE---------DDNETVTVSLAAS---
SNSFVMPQL--------SLS---QRS---HRFEILVV--G-KPARKFWN-NVP---KMYQ
KMFDI--GDFESISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGK----AII-----
----PICQRGQKQQLASLLE-------------PFVKAKKIRLMFQPTVM------SNHQ
EIHKLLRYLHRLST--EI---------------DS-----------GYETDETH------
----------------LKVR------------------------KRKK---------THK
--KKSKGTS--------NRW----------------VIWGLSLTVGVGIG--CCISF---
-ILSSYSSSV--QIPHAS--RDDVVLVEEVPTLPDKAE----------------------
---------GNGPIGQVITLLRKTVKQFNLVLKQFIYEQV---GSLSWIQRVGKELISED
SDGTVGRVAALDLVLL
>KLTH0E01122g
MSQYITNPRQQSRQLRRNSPSGQEPHF-ATSSVPLNQRNSILDPHLSVLQLLDRADPPSE
----------LSSLKHGEIA-----------KPATPRRSGF--ESVNCSISESWQSIKHT
DC-SMVNTQGDATHQH----------AGIL-SSSDTSEDE----PD--------------
---------------AQLSPSP--------------NNFAFPNSATSIFPEAPHNLEASS
LREYQNSEIAN-------------------------------------------------
-------------------------------PREE---------NDNETVTMSLMNS---
SNSFVMPKL--------SLI---QQS---QKFCILIV--G-KPAQRFYR-DIP---RAYH
KMFEV-RDVGHL-SPREMNKYSAVMVIFGEPKEGKELLEKVAAHNS------NII-----
----AVCQRGQQQQISNILN-------------RYSKSNEIRLVYHLTVM------SDHQ
DVHRLLRYLNTLST--EV---------------DS-----------GYETEVGS------
----------------RKIR------------------------KRRKS--------SK-
--KRSPQITV-------NRW----------------VIWSISLTVGVGLG--YCISC---
-LLSSTSSTL--SVTLRS--GDEVTIMEDIHNSPHESP----------------------
---------FDNYLRHLLLAVKRAVKQVNSSFKQYLSGQS---LPVLWMQRIGKEWLSEA
SDPTLPGVTALDLVLV
>Kwal_55.19716
MSQYTTASRSRVNDRDPR----------FSTSERLNNRNSILDPHLSVLQLLERNEVHSE
----------PQEFRHSDIP-----------SPHLLSRSSS--EPMGRSISDSWQSIRHT
DY-SILNLIGETSHQP----------AGIL-SSSDTSEDE----PD--------------
---------------HFLSPSP--------------NEYAFANGAKTVFPEASHAPEGPS
LATLQDSVYEHSN-----------------------------------------------
-------------------------------VAED---------NDNETVTLSLINS---
SNSFVMPKL--------SLA---QPL---RKFSILIV--G-KPAQRFYR-DIP---RAYQ
KMFEV-CDAESFKTRDVD-QFSAIMVIFTDPKNGQSLLEMVTGRSS------NII-----
----AVCQRGQQQQISNLLN-------------RFSKTHHLRLIYHLTVM------SDHQ
DVHRLLRYLYTLSN--EI---------------DS-----------EYDTEVGP------
----------------RKVR------------------------KR-RK--------SYK
--KRETPAAV-------NRW----------------VIWSISLTVGVGIG--YCISC---
-LLSSTMSVRGNTLTLHS--SDEIALIEEAPISPHETV----------------------
---------LENYFRQLVLAFKKAVKQVSQSFKQCLHGHS---LPVLWMQRIGKDWMSEA
SDTTLPGVTALDLVLI
>KNAG0L02100
---------------------------------MSGHANSVLDPHLSVLELLEKS-----
-------------CERGGHA-----------EAPGSSRNKG---AGQIQLSESWCTVERD
EL-S-AM---ERSASQQTN-------NGVL-SSSDTSEEG----EP--------------
---------------EQGSPG----------------DGEGGGVADTRMARPAMSLQSTS
STL---------------------------------------------------------
-------------------------------DGVD---------DDSATVSKSLTSS---
SNSFIMPKLYTTVAGAPSTVSTALQT---RCFKVAVL--G-RGAVKFCQETVP---EQFR
HRFELTAGVHDL---AQCADRQGILIVVQEVRELISLLNRVHCACPEV----PVV-----
----AVYDRDRQVQVKNVLR-------------NFTRQRLVSLLHPPVPL------SNNE
ALDKMFHFVDNLAR--QQ--------------EPA-----------GVIHNDPQ------
----------------TTQE------------------------QHPDH----NEDDPHR
GPSKPEGTF--------KRW----------------LLWGVSISLGIGAGY-YCVSY---
-VVSSSM-----CVSCFNFRHTDHTLAATTSTAAAAAA-------------------AAT
PSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDR-------SQEWHLHD
PN----RFLQLGYAVI
>NCAS0G00260
---MQNIDLVRGNHTWRVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDT-
----------VM--------------------------------EASSRISRSWQNIESP
A--DSKQLLSAKSSQVSNL-------VSILSSSSDTSDEE----VD--------------
------------------------------------RINSLNSAGEGSSKNYNNPSPLQN
PIYLPEFTDVTAG-----------------------------------------------
-------------------------------DNDD---------GIASTITKSLTSSSTI
SNSFVMPTL--------SLSSSQSQQ---RKFQILIF--G-RLGPSFYR-TIP---KQYQ
YLFHV-PNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFKKVPPPII-----
----PICQPGQKIKVKSILK-------------YFLKNNFVTLLSPIIII------NDER
ALLKMFKTMQSISK--TV----ISASSSTTSSDNE-----------EEESSDPSMNDKVI
D------VKTIKESMMSSQK------------------------KKNKK--------KHH
NNRRKEHVRSSSTSFFKNKW----------------VVWSISLTVGAGMG--YIISY---
-CVFNSSKRL--PLEKIAHQTRPGPLSSLIHLKSNKNL---------------LYLERTT
P-----NDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWKFDE
QD----RILALCYLLL
>Suva_9.43
MVLDYQHRETKGSSSKNMAPNSSSMNIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS
----------PLGQSLVTSI-----------DISNHH-------NVIDNISGSWQTIQPL
D--LGASFIPERCSSQTTN-------GSIL-SSSDTSEEE----QD--------------
---------------LLQAPAA---------DIINIIKQGQDGTSVTSPSHPFKQLHTVI
SLPMPPRERTFYGEQEDVVCI---------------------------------------
-------------------------------DNDD---DNGMYEEDSVTITKSLTSS---
TNSFVMPKL--------SLS---RKN---PVFRLLIL--G-RTGTNFYQ-STP---KEYQ
SLFEL-PKSHDS---TIFPQYTGIVIVFQELREMVSLLNRIVEYAQGK----PII-----
----PICQPGQTIQVKNVLK-------------SFLKNSLIKLLYPPVVA------TNRK
DLKKMFQRLQDLSL--EY-----------VEDEKN-----------EDEDEDND--DEII
Q-PYSRSYYRSKKG--GSSK------------------------KKSSK--------SNK
KSKKKKQRSS-------TRW----------------FTWGVSITIGISFG--CCVTY---
-FVTAAYDHQ--TIRSLN--SRSSFFASFLSLDPSSDT----------------------
------DGHSRHYFCLFWGHASDKLQ----FGRIHYEKSQRHKGNMGTISIKTLIFPLMN
LI----GFWHSVIFYY
>Skud_9.22
MVLDYPQRETKGSSSKNMAPNSSSMNIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS
----------PMGHSLVTSI-----------DISSHH-------YVNDSISGSWQAIHPL
D--LGASFVPERSSSQTTN-------GSIL-SSSDTSEEE----QE--------------
---------------LLQAPAA---------DIINIIKQGQEGASVTSPSRPFRQLHKVI
SLPLPAKGRTSYGEQDDDD-----------------------------------------
-------------------------------NNVDDDYDDGAYEEDSGTITKSLTSS---
TNSFVMPKL--------SLS---QKN---PVFRLLIL--G-RTGSNFYQ-SIP---KEHQ
SLFEL-PKYHDS---TAFPQYTGIIIIFQELREMVSLLNRIVQYSQGK----PII-----
----PICQPGQTIQVKNVLK-------------SFLRNKLIKLLYPPVVV------TNRR
DLKKMFQRLQDLSL--EY---------------AE-----------DGDNDDEDNDDEII
H-TNSRSYYRNKKA--NSSK------------------------KKSFK--------SNK
KPKKKKQRSL-------TRW----------------FTWGVSITIGISFG--CCVTY---
-FATAAYDHQ--TGKSFN--LRSSILTSLLSLDSYHDTVNTPATTSTSSGEQFLWFDKGT
LQI---NFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNK----NSDFSLDE
SN----RILALGYILL
>Smik_9.23
MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS
----------PMGQSLVTSI-----------DISGHQ-------NVNDSISGSWQAIQPL
D--LGASFIPERCSSQTTN-------GSIL-SSSDTSEEE----QE--------------
---------------LLQAPAA---------DIINIIKQGQEGTNVTSSSHPFRQLHKVI
SLPIPSREKTPYKEQDIN------------------------------------------
-------------------------------DDED-----GAYEEDSVTITKSLTSS---
TNSFVMPKL--------SLS---QKN---PVFRLLIL--G-RTGSNFYQ-SIP---KEYQ
SLFEL-PKYHDS---ATFPQYTGIIIIFQELREMVSLLNRIVQYSQGK----PII-----
----PICQPGQTIQVKNVLK-------------SFLRNKLIKLLFPPVVV------TNRK
DLKKMFQRLQDLSL--EY-----------AEDENE-----------EGDDDETT------
---KSRSYYRYKKA--NNSK------------------------RKSPK--------SNK
KPKKKKQRFF-------TSW----------------FTWGISITIGISFG--CCVTY---
-FVTAAYDHQ--TVKSLS--LRSSLLTSMLSLDSSSDTVNTPATASPSSSEHFLWFDKGT
LQI---NFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPLSFLENLNR----SSDFSIDE
SN----RILALGYILL
>YIL146C
MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS
----------PMGQNLVTSI-----------DISGNH-------NVNDSISGSWQAIQPL
D--LGASFIPERCSSQTTN-------GSIL-SSSDTSEEE----QE--------------
---------------LLQAPAA---------DIINIIKQGQEGANVVSPSHPFKQLQKII
SLPLPGKEKTPFNEQDD-------------------------------------------
-------------------------------DGDE----DEAFEEDSVTITKSLTSS---
TNSFVMPKL--------SLT---QKN---PVFRLLIL--G-RTGSSFYQ-SIP---KEYQ
SLFEL-PKYHDS---ATFPQYTGIVIIFQELREMVSLLNRIVQYSQGK----PVI-----
----PICQPGQVIQVKNVLK-------------SFLRNKLVKLLFPPVVV------TNKR
DLKKMFQRLQDLSL--EY----------------------------GEDVNEEDNDDEAI
H-TKSRSYCRNKKA--ENSK------------------------KKSPK--------SNK
KPKRKKQKFF-------TSW----------------FTWGISITIGISFG--CCVTY---
-FVTAAYEHQ--TVKSLS--LRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGT
LQI---NFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKFLENLNK----SSEFSIDE
SN----RILALGYILL
>ZYRO0G06666g
MTSTEGTGGGDGK---------------GISGFSDIERRSILDPHLSVLELLRRPSDTR-
----------PHEALKGEVS-----------DIVGNCAGTT--GTGNGSISQSWQTIHRN
D--SCLSVVPERCPSQATA-------AGIL-SSSDTSEDE----PD--------------
---------------AVNSPSA-----------VHQQLHATPPQKHTKSLEDYRSLNVGI
PLVLPEDSNNINNNNKNGSTTGS-------------------------------------
-------------------------------NGEE---------DDNDTITKSLNSS---
SNSFIMPKL--------SLS---QKT---QKFRILVL--G-RPGLKFYH-SIP---KKYQ
HMFEL-PRSHDP---AEFKQYTGILVVFQELKEMVSLLNRVCQCNPNR----PVI-----
----PVCQSGQRQQVRNLLE-------------SLLKNRLVSLLYPPVVV------NNQP
DLLGMFRFLQELSK--TV-------------SDNS-----------DMDAEEPNNGSKRL
K----RSLQRKKKKFIETSA------------------------ERNGR--------PHK
--KRHNNEKV-------NRW----------------VLWGVSLTLGVGVG--YCISH---
-LVSSTWIS-----------LTTNPLGPVDPESVSKDL---------------FVFDRQE
LKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPAN--CLEWPTSD
EHTN--RVLALGYVML
>TDEL0B02220
MVSASESKIAKQDRVGEV----------SGVETTAFEKKSLLDPHLSVLELLERTGDTQ-
--------------RVGRGV-----------EKADDMAN------TTNSISSSWQAIHRN
D--AMITGVPERCSSQAAA-------VGIL-SSSDTSEEE--------------------
---------------IDPASSP---------------NVAHFTQFHQSQQPPRLPFKLDV
PVILPARDQEPSGQTQTPD-----------------------------------------
-------------------------------NDDE---------RDDETLTKSLSNS---
SNSFVMPKL--------SLS---QKS---HKLRILIL--G-RPGLKFYQ-SIP---KRYQ
HFFEL-SRLQDP---SEFRQFTGILIVFQELKEMVSLLNRVCQCAPTR----PVI-----
----PVCQTGQHQQVRNVLE-------------SLLKSKLISLLYPPVVI------SNHS
DLNNMYRFLLDLSK--TI-----------SDNSED-----------DEDEEERELLDKKI
K----KSHQRKKKR--AGSY------------------------DKTDK--------PRK
--RRSKETKI-------NKW----------------IVWGISLTVGVGVG--YCMSY---
-FASSGLIS-----------MSAKSIASINGCRPNDNV---------------VVFDDSS
LGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTN--YKEWGAED
NSN---RVLALGYILL