MUSCLE (3.8) multiple sequence alignment

TBLA0E02100        ------MRLPSWKIKLKMNKQ--TVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYF
TPHA0E00250        -------------MNLKNLRL--ATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYF
Kpol_1043.68       -------------MLRACNVS--IWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYF
AFR284W            ------------MRLGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYF
Ecym_4020          MALLFIKKHLSIPTTRRIRKH--MFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYF
KLLA0A00638g       -----MLAGLKRRCSLKALRE--RFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYF
TBLA0I01680        ------------MGPSRMFRS--ILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYF
SAKL0E14872g       ------------MTVIGHLRS--KLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYF
KLTH0E01100g       ------MARLKKFDLGAYAKR--KLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYF
Kwal_55.19707      ------MVRLNNIDLGAFFQR--RLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYF
TPHA0D04590        --------------MQLIPKK--FWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYF
KAFR0D02240        MVARVFARKRISQRLKRLAHL--NTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYF
Kpol_2001.74       --------------MRQSWRK--AFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYF
KNAG0L02110        ------------MWFRLRSFT--P-KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYF
CAGL0H06567g       ---------MDSTESAPRRRR--FLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYF
NDAI0F00310        --------------MKIPDKF--VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYF
NCAS0G00250        ------------MKVNLSKWY--VLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYF
Suva_9.41          ------------MRFRLPSRS--VFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYF
Skud_9.21          ------------MRFRLPSRS--DFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYF
Smik_9.22          ------------MRLRLPSKS--EFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYF
YIL147C            ------------MRFGLPSKL--ELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYF
ZYRO0G06644g       ------------MWMRQLMFG--KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYF
TDEL0B02210        ------------MRLGTIAKE--KFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYF
                                              *    : :**  : . :.  **  ::  :*:**

TBLA0E02100        TTHYKDLNVNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGI
TPHA0E00250        TNNYKSLRAEQLFIAAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENW
Kpol_1043.68       TKNYRDLRLQQLYIAARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENW
AFR284W            TSNYRTLRADRLHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENW
Ecym_4020          TTNYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNL
KLLA0A00638g       TTNYKSVRAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNW
TBLA0I01680        TVNYKHMRVDRLSIAAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVW
SAKL0E14872g       TANYKSLRADRLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENW
KLTH0E01100g       TSSFKSMRAERLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENW
Kwal_55.19707      TSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENW
TPHA0D04590        TANYKNLKTGRLYIAAQLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNW
KAFR0D02240        TSSYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNW
Kpol_2001.74       TENYKELRSGRLNIAAKLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENW
KNAG0L02110        TSNYKNLRSDRLYIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANW
CAGL0H06567g       TSNYKNLRSDRLYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENW
NDAI0F00310        TANYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENW
NCAS0G00250        TSNYKNLRSDRLYIAAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENW
Suva_9.41          TSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNW
Skud_9.21          TSNYKNLRSDRLYIAAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNW
Smik_9.22          TSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNW
YIL147C            TSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNW
ZYRO0G06644g       TDNYKNLRSERLYMAAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANW
TDEL0B02210        TSNYKSLRSERLYVAAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANW
                   *  :. :.  .* :*: * ::*::*.:  ::**   .   . :   :     *  .    

TBLA0E02100        IESQSVLDKFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTI
TPHA0E00250        VESISSVSAFLTSSSIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPL-SSDERL
Kpol_1043.68       ASTSDVLSTFLESSVVFLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPL-SGTDSL
AFR284W            IEADKILGGFLERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPL-EMDKYE
Ecym_4020          DNAKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPL-SSNSPL
KLLA0A00638g       NSAEDSLEKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPL-SGVEPL
TBLA0I01680        YDSQVVVEKFLSSSDIFSISRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPL-SSSDPL
SAKL0E14872g       SEAEIVLEKFLGSSDLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPL-STDDPL
KLTH0E01100g       ADAVTTLDKFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPL-STNVSL
Kwal_55.19707      SDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPL-STDVAL
TPHA0D04590        YESSLVLEKFLTSSDLFSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTL-SLNISL
KAFR0D02240        ESTESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPL-STNIPL
Kpol_2001.74       IESENVVQKFLSSSDLFYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPL-STNQSL
KNAG0L02110        MDSQSVLEKFLGSSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPL-STNVPL
CAGL0H06567g       EESTNVIQKFLSSSNLFFLSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPL-STDVPL
NDAI0F00310        ADSASILQKFLSSSNLFSVAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPL-STNIPL
NCAS0G00250        ADSEQVIQKFLTSNNLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPL-ATNQPL
Suva_9.41          VDSVSIVQKFLSSSNLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPL-STDMAL
Skud_9.21          VDSLSVVQKFLSSSNLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPL-STDIPL
Smik_9.22          VDSLSVVQKFLSSSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPL-STDTPL
YIL147C            VDSLSVIQKFLSSSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPL-STDTPL
ZYRO0G06644g       VDSGNVIQKFLTSSGLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPL-SGNKPL
TDEL0B02210        VDSSSVLQKFLSSSALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPL-SSNMAL
                    .:   :  *:  .  :    :**     : .  .* :   :       * .*       

TBLA0E02100        PPLINNTGILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSV
TPHA0E00250        PASIGTIGFLTDPVLNTSNYLMSLSLPI---FGNPSIILSDSRVYGYVTIITGASSIVAV
Kpol_1043.68       PSYLGTTGLLTDPVLNDSTYLMSMSLPI---IANPSVTLSDSRVFGYLTVVMSAETIRAV
AFR284W            YNEALDVQVETLP-YNKTLNLMSMTLPV-----EASTIIGRGNVVGFLTIVMSADPITAV
Ecym_4020          PSSIIDDGMLSNPVFNGSSFFMSMSLPV---SAKASILYPKSDTVGYITMVMSADQVSSV
KLLA0A00638g       SSSLLTTGIVTDPVYNWTNYLLSMSLPV---STNPSIILNTNEIAGYITVIASAESLKAV
TBLA0I01680        PASLGSSGMLTDPVLNSTTYLMSMSLPI---LANPSIILTDSKVYGYITIIMSAESLMSV
SAKL0E14872g       ASSLQTSGILTDPVLNDTVYVMSMSLPI---FASPSIMLTNSEISGYITVVMSAESLKIV
KLTH0E01100g       PSSLEVKGMLTDPVLNDTGYLMSMSLPI---FANPSIILSTSKVYGYITVVISAEGLKTV
Kwal_55.19707      PSSLERTGMLTDPVLNGSVYLMSMSLPI---FANPSIILSTAKVYGYITVVISAEGLKSV
TPHA0D04590        PSSLETIGICTDPVLNGSNFLMSMSLPI---FANPSIILSDSRIYGYLSVIMSAEGLKSV
KAFR0D02240        SSSLETTGILTDPVLNGTSYLMSMSLPV---FANPSIILSTSRVYGYITIIMTADGLLSV
Kpol_2001.74       PSSLNNDGILTDPVLNGSIYLMSMSLPI---LTNPSIILSSSRVYGYITIVMSADGLKNV
KNAG0L02110        PSSLETNGIVTNPVKNGSSYLMSMSLPI---FANPSIILTDSRVYGYVTVVMSAEGLLSV
CAGL0H06567g       PSSLMTNGMLTDPVLNGTDYLMSMSLPI---FANPSIIFSDLKVYGYITVVMSAEGLRSV
NDAI0F00310        SSSLETTGILTDPVLNSSTYLMSMSLPI---FANPSVILAESRVYGYLTVVMSAEGLRTV
NCAS0G00250        SSSLETIGILTDPVLNGSTYIMSMSLPI---FANPSIILTDSKVYGYITIVMSAEGLKTV
Suva_9.41          PSSLETTGILTDPILNSTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSV
Skud_9.21          PSSLETTGILTDPIVNNTDYLMSMSLPI---FANPSIILTDSRVYGYITIVMSAEGLKSV
Smik_9.22          PSSLETTGILTDPVVNNTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSV
YIL147C            PSSLETIGILTDPVLNSTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSV
ZYRO0G06644g       PSSLQSEGILTNPVLNGTSYLMSMSLPI---FANPSIILTTSHVYGYITIVMSADSLKNV
TDEL0B02210        PASLESEGMLTDPVLNGTSYLMSMSLPI---YANPSIILTESRVYGYVTIIMSADSLKSV
                           . : *  * :  .:*::**:      .:         *:::::  *. :  *

TBLA0E02100        FNDTAGLSDSTTALLSAIYTNDT-LPRYFHFVFPP-FDLDDSIIDERQTIKNGTFQYRAF
TPHA0E00250        FNDTTALENSNVAIISAKYRNSTTYADGYHFVFPP-YGSDASVIDIFYPLSNNSFLFDAF
Kpol_1043.68       VNDTTALEKSIVAVISSTNTNGT-SGQEYHFVFPP-HGASDDIVNTAYPVENSTFLSDAF
AFR284W            -NDTSVLGESMVSILTGIPNDKG-NLVKYRFVFPP-GETDRSVTETEYPIKNASFLRDAF
Ecym_4020          CAGKPALNGSTVSVLAGVYDENN-ILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAF
KLLA0A00638g       VNDTIALDKSSVSILSAVFDSNS-SLTGYHFVFPP-HGTSSFSSKVTFPIKNGTFIADAF
TBLA0I01680        YNDTTALEKSNVAIVSGEYSDYSASLTEYHFVFPP-YGATPKIIDIYYPLQNGSFLYDAM
SAKL0E14872g       FNDTTALDKSDVAILSAEYSNQS-LPVSYHFVFPP-HGVGADIIDYSFTIENGSFIQSAF
KLTH0E01100g       FNDTTALEDSSVILVSTVYDNRE--LAGYHLVFPP-YGMPSDIIDKRYTIGNDSFLMDAF
Kwal_55.19707      YNDTTALDDSSVIIVSTVYDDHE--LAGYHLVFPP-YNMYPDVINEHYQIENGSFLEDAI
TPHA0D04590        FNDTTALENSEVFVISADYSITT-NLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGL
KAFR0D02240        FNDTTAIEKSNVAIVSAVYNNQS-ELDAYHLALPP-YGFTASVTDINFQLKNSSFLNGAL
Kpol_2001.74       YLNNTALENSNVTVISAIYNDQG-KVDGFHFVFE--VENDDFSTLIEYPIQNGTYLSSAL
KNAG0L02110        FNDTTALERSYVAIVSAVYTNAT-KLDAYRFVFPP-FGSTSSILNETFPLNNNTFLSSAL
CAGL0H06567g       FNDTTALEKSNVAIVSARYSNYT-KIDSYRFVFPP-YGVSPSILNRTFELDDSSFLNGAF
NDAI0F00310        FNDTTALEKSNVAIVSAVYNNVS-ALTAYRFVFAP-MGAPSYIINSTYRLTNGSFLSSAL
NCAS0G00250        FNDTTALEQSNVAIVSGVYNNES-TLNAYHFVFAP-YGAPSYVINSTFRIMNNSFLNTAL
Suva_9.41          FNDTTALEKSNVAIISAVYNNQS-KAYAYHFVFPP-YGTSSSITKTIFPIKNNTFISSAF
Skud_9.21          FNDTTALEKSNVAIISATYNAQG-RASGYHFVFPP-YGTLLSITQRIFPIENNTFISSTF
Smik_9.22          FNDTTALEKSNVAIISALYNNQG-KASGYHFIFPP-YGTASTLTQSVFSIKNNTFISSAF
YIL147C            FNDTTALEHSTIAIISAVYNSQG-KASGYHFVFPP-YGSRSDLPQKVFSIKNDTFISSAF
ZYRO0G06644g       FDDTTALEKSNVAILSAVYDQNE-TLSSYNFVFAP-LGVPSSILAETIPIKNGTFLSSAL
TDEL0B02210        YDDRTALEKSSVTIVSAIYKKDQ-GLGSYRFVFAP-YGTTPGILDETWPINNNSFLSAAL
                     .   :  *   :::            :.. :                : : ::    :

TBLA0E02100        DKNKSGSKKKVKLVNK--------KNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLT
TPHA0E00250        TEDTTGSVSSTTFFYS--------SLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLT
Kpol_1043.68       SSPEGGSINKSKSLYS--------KAVAIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLT
AFR284W            LNRSDNYVTSTSSFYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLT
Ecym_4020          VNRSSGSVSKTNAFYE--------PNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLT
KLLA0A00638g       ENGKVGSVMKTNMVQE--------RNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLM
TBLA0I01680        NNQKKGSIMKTKFFYN--------NDVAIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLT
SAKL0E14872g       DDRKSGSVKRTSFFYG--------KDVAVGYSPCLFKQVQWVAVISQPENVFLSPSTRLT
KLTH0E01100g       KQSKGGSIKSTHFLYS--------KAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLA
Kwal_55.19707      KDGKGGSIKSTRFFNN--------KKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLA
TPHA0D04590        VNGKGGAVKKTNGFLG--------TAAAVGYSSCSFSLVNWLAIVAQPEAAFSESATKLE
KAFR0D02240        KQGKGGSIKKTHFLYN--------KAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLT
Kpol_2001.74       VEGKSGSIKKTKYPFN--------RELAIGYSPCSFSLSNWVALVTQPEAVFLSPSTKLE
KNAG0L02110        RQGKGGALKSTRLFYR--------LKLAVGYSPSTSNLANWVAIVAQAESVFISPATKLA
CAGL0H06567g       KQAKGGSIKKTKFFYT--------KDVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLT
NDAI0F00310        REGKGGSLKSTKFFYS--------KNVAIGYSPCTFSFVNWVAVVSQAESVFLSPSTKLA
NCAS0G00250        REGKGGSVKKTKFFYT--------KNIAVGYSPCTFSFVNWIAIVSQDESVFLSPSTKLA
Suva_9.41          KNGKGGSLKKTNSFGI--------KNLALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLA
Skud_9.21          RNGKGGSLKKTNNFGT--------KNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLT
Smik_9.22          RNGKGGSLKQTNSFGI--------KNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLA
YIL147C            RNGKGGSLKQTNILST--------RNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLA
ZYRO0G06644g       RQGKGGALERTKFLYT--------KKVAVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLT
TDEL0B02210        RQGKAGSEQRTDLFYN--------RPSAVGYSPCSFKFVNWVAIISQSEAVFMEPSTRLT
                    .   .                     *:** .      .*:. :   :  *   : .* 

TBLA0E02100        KIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDH
TPHA0E00250        KIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELISRGRGLRP---------YYEN
Kpol_1043.68       KIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISKRDGNEVHRSNS----SSSS
AFR284W            KIIIGTVLGVAVFMCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSG----RSSS
Ecym_4020          KIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATELIAAGRGLRSYRHSS----RSSS
KLLA0A00638g       KIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIITSGRDLKHYSNTG----NSDS
TBLA0I01680        RIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATELIAEGRGLRS--SSN----RTLS
SAKL0E14872g       NIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEIITARRGLRSYNQSA-----PAS
KLTH0E01100g       RIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSS
Kwal_55.19707      KIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTS
TPHA0D04590        RIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATERIAEGRGLRP--PQPTVG-SSVS
KAFR0D02240        KIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIITEGRGLRP--TTP--GSGSVS
Kpol_2001.74       KIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELISQGRGLKP--TSNF---SNGD
KNAG0L02110        KIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELITESRGLRP--TTP----TSGS
CAGL0H06567g       KIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEGRGLRP--AGAGSGSRSGS
NDAI0F00310        KIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELISEGRGLKS--TNP--DSRSVS
NCAS0G00250        KIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELMSEGRGLKS--TTP--GSKNVS
Suva_9.41          KIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRP--STP----RTVS
Skud_9.21          KIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELITEGRGLRP--STP----RTVS
Smik_9.22          KIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRP--STP----RTVS
YIL147C            KIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRP--STP----RTIS
ZYRO0G06644g       KIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELITEGRGLRA--SSPGAGSSNVS
TDEL0B02210        KIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEIITEGRGLRS--GTP--GSSSVS
                   .** *.  .:  .    :: :: : *:*::.*:.*:* ::   .                

TBLA0E02100        TYDSNDDHTYES---KLISS-TPTLKNSDSNIHDEKSGR---------------------
TPHA0E00250        LSDRTSQDNTST---RTTIDLSDLDGYTNEKEKSLPTCTED-------------------
Kpol_1043.68       RSTFSSNRRSKD---GRH------------------------------------------
AFR284W            QNTSI-DRSNSR---GSDHSLPRELFEKKHHVSPFVTENHAA------------------
Ecym_4020          RTTSI-NRSNSK---GSPSP-TLREGDGLRKTPPSPYTPMH-------------------
KLLA0A00638g       NTAITHSRTRST---SNQNQVMKLFNKSVTKGTPSNYLNHNYNVF---------------
TBLA0I01680        RNGSLKFGRYSID--SPIIPISPTFLHNNNNHHRNSSNESHD------------------
SAKL0E14872g       RTNSFRKRPSTSSSIGSVFR-TITDRPHERDNGHSNFELHHR------------------
KLTH0E01100g       TAESF-SSALHP---ASIRRSGSVARSSKHKYIPESAKGTL-------------------
Kwal_55.19707      TAESF-SSIFGT---GSVRRSGSVARAGRDKYIPDSSKEVP-------------------
TPHA0D04590        RNSSI-KWRNSL---ENHVRSSLGFNANKLSDSGSITANNFK------------------
KAFR0D02240        RTSSM-RREKSP---RTSIV-SSRKSTATGNSNSLNENSASLSSHPMVL-----------
Kpol_2001.74       SSSTSDNWRESV---ESHVRASLGIFKSLRNNGSNE------------------------
KNAG0L02110        RANSI-LRDKSS---LISFPLHPVSTNNINNNNSNEKAQ---------------------
CAGL0H06567g       RTSSMKKDINDL---NFISRLSLSEK----------------------------------
NDAI0F00310        RNNSL-KLPSRN---TSHYR-NRSSASSVQQYTGEKQIYPTHSYQHNTIRNMSPQRLSPS
NCAS0G00250        RSSSIKHYVRSN---IPSTA-SSVHNFSGDNLSTTTNGHLNQRGLTPTPM----------
Suva_9.41          RTSSF-KRGFSS---GFAVP-SSLLQFNSGEAGSTTSASGHGCSGRGSAAVMSTDSSMKS
Skud_9.21          RASSF-RRGFSS---GFTAP-SSLLQFNTGEACSTTSANGHGSSGHGSGVALSTESSMKS
Smik_9.22          RASSF-KRGFGS---GFTVP-SSLLQFNTGESGSTISASGHGGSGHGSGAAFSTESSMKS
YIL147C            RASSF-KRGFSS---GFAVP-SSLLQFNTAEAGSTTSVSGHGGSGHGSGAAFSANSSMKS
ZYRO0G06644g       RRSSFFHRPSNC---GSSIRSRVTDNHNEK------------------------------
TDEL0B02210        RNSSFIRRRFSG---SSSVR----------------------------------------
                                                                               

TBLA0E02100        -------------TRGDANSGTLNSNNTITNNTN-------------NKDFNRL------
TPHA0E00250        -------------ERSKSLSNIASKSIFTTLRKI-------------LGFSSRS------
Kpol_1043.68       -------------NSSSYNLYEDVEKYTEIGKAN-------------KSTESLS------
AFR284W            -------------NSGSCSSMSDHERYLHHIARY-------------HDGETST------
Ecym_4020          -------------SHVEPNPSGIGREYSVDIARA-------------IGIEVPS------
KLLA0A00638g       -------------PPSRTDSPSVSARNSQTIPRG-------------PGDLTRS------
TBLA0I01680        -------------PEKLSHLSNDISKSSNSSSTG-------------SRFHFVC------
SAKL0E14872g       -------------TSNSVDSQEARMELEISGALP---------------DTNPT------
KLTH0E01100g       -------------NKNDFEEIQPDGIENNEDAAL-------------QKVHSPT------
Kwal_55.19707      -------------RGNSSDAIHEVNQENIEDIEM-------------QKVNSPT------
TPHA0D04590        -------------NNTSSSNSITSSHIYGNNNSS-------------HSSMGIN------
KAFR0D02240        -------------TSENVLVTNHSGLSRIPVNMN-------------QELLDRA----SA
Kpol_2001.74       -------------LQSNDDMNEINERSSKNNSTG-------------DNIKSSD------
KNAG0L02110        -------------PPSDQDTNTNNSSSSIAVSNI-------------REEHSPHADGVFS
CAGL0H06567g       -------------NHRPAYDSASDSNYATDGSLS-------------HDLQTSQ------
NDAI0F00310        PLGLSINRHNH--NNDINNNNNNNNNISPDNNLNLPLHGNNFQSDSVSNLSPRQGTPELR
NCAS0G00250        -------------PTTDLPSPSDSNFATEMISNA-------------NTSQRAN------
Suva_9.41          AMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLN-------------HDLLAPN------
Skud_9.21          AINLGHEKLSPSEEENKIPNNHNDVKISMDGSLN-------------HDLLAPN------
Smik_9.22          AINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLN-------------HDLLAPN------
YIL147C            AINLGNEKMSPPEEENKIPNNHTDAKISMDGSLN-------------HDLLGPH------
ZYRO0G06644g       -------------GHDLHGEQIQHGFFAMNGSIN-------------HSLAASI------
TDEL0B02210        -------------SPSLADEKGAVGRASTEGSFN-------------YDQAVPS------
                                                                               

TBLA0E02100        ------------RRNVSVSTHVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEH
TPHA0E00250        -----------GMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEH
Kpol_1043.68       ------KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEH
AFR284W            -----------NILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQ
Ecym_4020          -----------SHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRH
KLLA0A00638g       -ATTGSTPFSNDSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRH
TBLA0I01680        ------IFFSSHKSSNTPPPPMST--ILETKVPVYRRLFLDELSELTDTFNTMSDALDQH
SAKL0E14872g       ----TPTSYTNDQHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRH
KLTH0E01100g       -----PGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRH
Kwal_55.19707      -----PYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRH
TPHA0D04590        ---------PDDDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQH
KAFR0D02240        STVNTLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEH
Kpol_2001.74       -----------NDSSSSFQRYTTS-NLVQARVPVYGRFLQDELSELTDTFNAMTNALDQH
KNAG0L02110        GISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQH
CAGL0H06567g       ---ASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQH
NDAI0F00310        RSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQH
NCAS0G00250        ---SISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQH
Suva_9.41          ----ALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH
Skud_9.21          ----SLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQH
Smik_9.22          ----SLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH
YIL147C            ----SLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH
ZYRO0G06644g       ------ASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQH
TDEL0B02210        ------LNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQH
                                                  :*     . **:::*.:*:: *:: ** :

TBLA0E02100        YALLEKRVHQRTKQLEAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDI
TPHA0E00250        SNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDN
Kpol_1043.68       SQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDM
AFR284W            YVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQ
Ecym_4020          YALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDM
KLLA0A00638g       YALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDM
TBLA0I01680        YALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDI
SAKL0E14872g       YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDM
KLTH0E01100g       YALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDM
Kwal_55.19707      YALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDT
TPHA0D04590        YCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDV
KAFR0D02240        YTLLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDI
Kpol_2001.74       YTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDS
KNAG0L02110        YALLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDI
CAGL0H06567g       YALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDI
NDAI0F00310        YALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDI
NCAS0G00250        YALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDI
Suva_9.41          YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
Skud_9.21          YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
Smik_9.22          YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
YIL147C            YALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
ZYRO0G06644g       YALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDI
TDEL0B02210        YALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDI
                     :** **. **.:*****: ** :*****:****: **************: :: * * 

TBLA0E02100        KKIKDGLKLIFRSGELLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQ
TPHA0E00250        EKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAK
Kpol_1043.68       ERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISK
AFR284W            EKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAK
Ecym_4020          EKVQNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAK
KLLA0A00638g       QKVQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAK
TBLA0I01680        DNIKSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAK
SAKL0E14872g       QKVQNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAK
KLTH0E01100g       QKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAK
Kwal_55.19707      AKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAK
TPHA0D04590        DKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAK
KAFR0D02240        TKIRSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAK
Kpol_2001.74       DKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVAR
KNAG0L02110        DKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAK
CAGL0H06567g       AKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAK
NDAI0F00310        SKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK
NCAS0G00250        AKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK
Suva_9.41          NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK
Skud_9.21          NKIRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAK
Smik_9.22          NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK
YIL147C            NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK
ZYRO0G06644g       DKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAK
TDEL0B02210        DKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAK
                    .:. .****:*******:*:*********:*:.. **   * : ::: *:::**.*: .

TBLA0E02100        LQEVKLFIRLLPKKFLKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEY
TPHA0E00250        DQGVNFSILISP-NLIRTMVFFGDSNRIIQVIMNLVSNALKFTP-IDGNVDVRIKLLGEY
Kpol_1043.68       DQHVKLSIFILP-NKLRSMVLWGDQNRILQVIMNLVSNALKFTP-VDGKITVNIKLLGEY
AFR284W            DQHVKLSIYLMP-NAIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLVGEY
Ecym_4020          DQNVKFSIFLMP-NLIRKMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVSLRIKLLGEY
KLLA0A00638g       DQHVKLSIALTP-NFIRTLVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLLGEY
TBLA0I01680        DQHVKLSIYLIP-NEIRTLVLWGDSNRIIQIVMNLVSNALKFTP-IDGKVSVRMSLLGEY
SAKL0E14872g       DQHVNLSIILSP-NVIRTMILWGDSNRIIQIVMNLVSNALKFSP-VDGKVGVRIKLLGEY
KLTH0E01100g       DQHVNLTISIIP-NVLRTMVLWGDSNRIVQIVMNLVSNALKFTP-VDGRVNVKFTLLGEY
Kwal_55.19707      DQHVNLTISILP-NLLRSMVLWGDSNRIVQIVMNLVSNALKFTP-VDGKVDVKFRLLGEY
TPHA0D04590        DQHVKLSIILMP-NILRSYVLWGDSNRIIQVVMNLVSNALKFTP-VDGNVDVRINLLGEY
KAFR0D02240        DQHVRLSIILSP-NIMRTMVLYGDSNRIIQVVMNLVSNALKFTP-VDGKVQVKIKLLGEY
Kpol_2001.74       DQHVKLLIILMP-NRIRSMVLWGDSNRIIQIVMNLVSNALKFTP-IDGKVDVRIKLLGEY
KNAG0L02110        DQHVRLSIILSP-NMIRSMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRMKVLGLY
CAGL0H06567g       DQHVRLSISLTP-NVIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVNVRIKLLGEY
NDAI0F00310        DQRVKLSITLTP-NTIRTMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVNVKVKLIGEY
NCAS0G00250        DQRVRLSIVLLP-NIIRTMILFGDSNRIIQIVMNLVSNALKFTP-VDGKVNVRIKLMGEY
Suva_9.41          DQRVRLSISLFP-NFIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVEVRMKLLGEY
Skud_9.21          DQRVRLSISLFP-NLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEY
Smik_9.22          DQRVRLSISLFP-NLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEY
YIL147C            DQRVRLSISLFP-NLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEY
ZYRO0G06644g       DQRVRLSITLYP-NLIRTMVLFGDSNRIIQIVMNLVSNALKFTP-VDGKVNVYMSLLGEY
TDEL0B02210        DQRVKFSITLFP-NQIRKMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVSVRMRLLGEY
                    * *.: * : * : :.. :::**.***:*::***:***:**:* ::* : : . ::* *

TBLA0E02100        DEEESKTENYSKVCIKPSTQIVTESGELIKSKIRCKI-------------TKSTTNMNTA
TPHA0E00250        DEEKSSLNNYDKVYIKEGTSFT--------GDNDAIP-------------TEPISDKISF
Kpol_1043.68       DKDRSAAENYKDVYMKE----------------------------------IRNSNGDKI
AFR284W            DSARSEACNFSEVYILPGTE---------------VT-------------NSSVNNIPTV
Ecym_4020          DEEESEKCNNAEVFIKQGTE----------------I-------------SDETKNVFDT
KLLA0A00638g       DSKRSESVDYQEVFVVPGSEANDDFEFNL-TSTTPMR-------------LPFNSSSGSV
TBLA0I01680        DKEKSKAADYKEVFVKTGTE----------PEENYSK-------------ILQKLNTEKL
SAKL0E14872g       DGKKSKDSNYNDVFIKPGTEIPDASASK--SSLSTLE-------------YTKVDAIQRR
KLTH0E01100g       DESKASNGCFDRAAVVPIQESEKESSTLGPTEKGGIKDVTESASSSNATWPPSPSTSETS
Kwal_55.19707      DEEKSKASEYKEVFVLPPTE----------SRTSSTE-------------AKDEKNAESC
TPHA0D04590        DEERSKAEDYKKVYVKQGTELP--------LNISHLK-------------TEENNDISRK
KAFR0D02240        DEESSKNSKFEKVYVKGGTEFTSIP-----AELAALS-------------KRESTAGSHF
Kpol_2001.74       DEERSMNDDYKEVYIKSGTELPIGNGK---KTDMVRK-------------KIQELSEKDC
KNAG0L02110        DEALSEKYNHNKVYVKPGTEIT--------------D-------------STPSLNVKSE
CAGL0H06567g       DEEATKADNFKQIHTIADSD-------------AHQQ-------------HPVSSSPNGV
NDAI0F00310        DEALSAKNNFKEVYVKQGTELLGCSNPIEKTNESIPS-------------PKSENNNSSS
NCAS0G00250        DENLSRESNFKKVLVKSGTEFIET------KAKAILG-------------APKKDDPKTS
Suva_9.41          DKELSEKKQFKEVHVRKGTEIIEDI-----GNINKHD-------------AKKSENFKKS
Skud_9.21          DKDSSEKRQFKEVHVKKGTEITDVV-----ESIDKRD-------------LPTSLGRRKY
Smik_9.22          DKDLSEKKQFKEVHVKRGTEITEYS-----EETNKCD-------------IPISSNHRKH
YIL147C            DKELSEKKQYKEVYIKKGTEVTENL-----ETTDKYD-------------LPTLSNHRKS
ZYRO0G06644g       DAERSENENHKKVYVIPGTEPKGNDE----KDKGGIE-------------EKERFSIENT
TDEL0B02210        DKQRSENEDFKAVYVIDGTE----------PREDGLI-------------PPPVKQFEKQ
                   *   :                                                       

TBLA0E02100        ----TTNNSARIESNTNQYLSPYSHTNTRTHTHP-----------------GA-DS--RR
TPHA0E00250        ----AGGSSSIHDYCSKTDE--------------------------------------ND
Kpol_1043.68       --------KPLMTLISSKDTMSVADNISNK------------------------------
AFR284W            ----VEEEEKACEEEPTADDTPER----------------------------------KK
Ecym_4020          ----ITEEKYVSCSGESTDDTIET----------------------------------GQ
KLLA0A00638g       NTATKDGSTSPTTKTKEGSIQVESETSTEGNDND-----------------ES-SIVLES
TBLA0I01680        ----IATRSARSCDNEERHNELIGEKNDIISNNH-----------------QS-SNTTFD
SAKL0E14872g       ----LASKSSDSQKLKEEPIASSDVSSSDGKDES-----------------EA-DTDTDT
KLTH0E01100g       NGSKAETTSGKLTESSEEDEKEEKLDHDDKDEGDEESEEEEYRGEAEVSGKDDTNNETQR
Kwal_55.19707      ----VDSDTNVLSLPSTAESTDEKNVKIGQRSES-----------------EAIDSEAIE
TPHA0D04590        -------SETELNNDENETHTISKDDTADSSIKI-----------------GN-----ED
KAFR0D02240        SGSSSHIKEKLDGIPANVFASDSDSDDPSEGTTI-----------------NT----SQQ
Kpol_2001.74       ----IEGDTASSGSHMSGSSKIDKLIEDEEKNSF-----------------SD-------
KNAG0L02110        ----GQGKDKFTSDTASKNNTSSDTAYDATPTTD-----------------RV-----AQ
CAGL0H06567g       ------LVKHLSTSSDSNSNLSDSDKYNEKTYDE-----------------DD-DE--HS
NDAI0F00310        TTSGKDTTNSETSFEDEKSADDLDDEKIATKDAE-----------------NENTDDTEN
NCAS0G00250        TESVVQIKENLNSNTSSSSNDIISTTSDEKKYDE-----------------KE-DE--GE
Suva_9.41          ----MDSESTTTSMTSNRDTSTIQEEITKRNTAA-----------------NE-NIYKKT
Skud_9.21          ----VNLESTTASITSCRDNSAIQEEITKRNTAA-----------------NE-NIYKKA
Smik_9.22          ----VDLESTTTSITSNRDTSIIQEEITKRNTAA-----------------NE-NIYKRM
YIL147C            ----VDLESSATSLGSNRDTSTIQEEITKRNTVA-----------------NE-SIYKKV
ZYRO0G06644g       ----PNDTSSNSSNKHSDTETTPGLNDTDEKQAS-----------------DD-----MD
TDEL0B02210        ----EDLEKEKISEKHNEEE---ASTSDSEKTNL-----------------DD-----KT
                                                                               

TBLA0E02100        NSNVSTVNNSSI----SLDSESSKM-YDNLMFNRLIKREGDGDINDIK----ALEQIEGN
TPHA0E00250        NIKTEIKSDD------STISD-----YSEENIMGSY--YENKNPGQEL----LGVPIPKP
Kpol_1043.68       ----------------SVASDTERS-TNNTIYSNKFKNGSNFQDTDDA----IGVPLDKK
AFR284W            KDSETVDDADAI----SISSSVATS-YDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKP
Ecym_4020          EGAQKPDKADNI----SVVSSGTSS-YDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKK
KLLA0A00638g       KHEENEDEKEKM----SILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEEN--TFRDLKVP
TBLA0I01680        ISIHNRTRDDTL----SLLSTSTSS-YDETVFNDQFKKITGLQDHDEER---LGVEIKEP
SAKL0E14872g       DKRSNSEISDSL----SLVSSNNSS-YDDAILHAQLRKVPSCGNGEDSGDS-LGRKLEIS
KLTH0E01100g       EDSNENQNEDAR----SIESENASS-YDDAIFHSRLRKGNSGENED-------GRPLEHP
Kwal_55.19707      SSDEDDENEDTK----SIGSGNTSS-YDDAIFQTRLRKDSSNEENEE------GRALESP
TPHA0D04590        VEISEVDKMGMA----SLVTTSSKS-YDDTALMKQLIKSTDLDDDENK----LGVELKEQ
KAFR0D02240        RTSSNEDYVDNI----SIASTSTSS-YDDAIFNSQFKKTPDLYEDEDGN---LGEELSQQ
Kpol_2001.74       -NEDTNNDIEIL----SMTTSSTRS-YDDAALQRQFKKTPDLDDKEET----LGVELSEP
KNAG0L02110        ESDEDNMYEDNE----SMISSTTSS-YDDAIFNSQFKKTTNLYDEDDESE--MGVELETP
CAGL0H06567g       ITNISDHSDDLS----SLVSSSTSS-YDNALFNTQFKKTPDLYEDSNDG---LGTELADQ
NDAI0F00310        LDEQTDSVCDNI----SLVSTSTSS-YDDAIFNSQFKKSPGLYDDDENND--AGVLIEDP
NCAS0G00250        EDNSDNDNDDTSMETQSIVSTSTSS-YDDAVFNNQFKKTPELYEDEDGN---LGIELTNP
Suva_9.41          RDREKSSNDDIS----SIVSTSTSS-YDDAIFNSQFNKALGSDDDEGGD---LGKPIENP
Skud_9.21          NDREKSSNDDVS----SIVSTTTSS-YDDAIFNSQFNKALDSDSDESGN---VGRPIENP
Smik_9.22          NDAEKLSSDDVS----SIVSTTTSS-YDDAIFNSQFNKAPGSDEDEGGN---LGKPIENP
YIL147C            NDREKASNDDVS----SIVSTTTSS-YDNAIFNSQFNKAPGSDDEEGGN---LGRPIENP
ZYRO0G06644g       GGEEDVEDADEV----SSFSTSTSS-YNDTVFHSQFKKTPKVCDDSSEE---LGVEVKDK
TDEL0B02210        PDSKRSDADDQV----SLISISTSS-YDDTIFHTQFKKHTSSSGDEN------GHLLEHP
                                   *  :       .:                .              

TBLA0E02100        KKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTL
TPHA0E00250        KKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTM
Kpol_1043.68       RKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTM
AFR284W            RSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTM
Ecym_4020          KVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTM
KLLA0A00638g       KTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM
TBLA0I01680        KTWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM
SAKL0E14872g       KTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM
KLTH0E01100g       RRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSM
Kwal_55.19707      KKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM
TPHA0D04590        KTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTM
KAFR0D02240        KTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTM
Kpol_2001.74       KTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTM
KNAG0L02110        KTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKM
CAGL0H06567g       KTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM
NDAI0F00310        KTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
NCAS0G00250        KTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTM
Suva_9.41          KTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
Skud_9.21          KTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
Smik_9.22          KTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTM
YIL147C            KTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
ZYRO0G06644g       KKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM
TDEL0B02210        KNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM
                   .  .: . * *.*.**   *:.:** *******:***************.**. :*:*.:

TBLA0E02100        ELESELGKGSKFIYTIPLLQVGGTKKDNDD-----NEEDHNDNTNSSVDIDIIEDTPV--
TPHA0E00250        ELDSTTGLGSKFTFTVPLLQERKIIFSETEKA---FEDEFNFNSKKNRKVNFK----T--
Kpol_1043.68       KLESEVGVGSKFIFTVPLLQTREIEFNGNELV---FEDEFNINSKKNREVKFQEI-----
AFR284W            KLESKVGSGSKFTFTVPLQQTGTVKFNDGDTL---FEDEFNIFSKKNRKVKFQ-L--N--
Ecym_4020          KLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDL---FEDEFNAQSKINRRVKFK-L--N--
KLLA0A00638g       KLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQ---FEDEFNIHSRKNRKVKFK-INSS--
TBLA0I01680        VLESKVGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFA-IPSSPG
SAKL0E14872g       KLESKVGVGSKFTFTVPLTQTREVSFDDVENP---FEDEFNAHSKKNRKVKFK-M--N--
KLTH0E01100g       SLDSKVGVGSKFTFTVPLTQTKELCFEEDENP---FEDEFNPDSKKNRKVKFK-V--S--
Kwal_55.19707      KLDSQVGVGSKFSFTVPLTQTKELLFEDVENP---FEDEFNPDSKKNRKVKFR-M--G--
TPHA0D04590        ELESEVGVGSKFIFTLPLKQTREISIPDDE-L---FNDEFNAVSKKNRKVKFK-FSGS--
KAFR0D02240        TLESTVGSGSKFIFTVPLTQTRVIKLDESEHP---YEDEFNPKSKMNRKVKFN-V--A--
Kpol_2001.74       KLESTVGVGSKFIFTVPLKQTREIHFDDEK-----FEDEFNAESKKNRRIKFK-I--Y--
KNAG0L02110        LLESKVGVGSKFTFTLPLTQTREINFANVEDP---FEDEFNAKSKKNRKVKFR-M--A--
CAGL0H06567g       KLESKVGVGSKFTFTVPLKQTRVIKFDEEEDL---FEDEFNPESKKNRRVKFKDS--T--
NDAI0F00310        KLKSEVGVGSTFTFTVPLKQTREINFDDMEHP---FEDEFNPESRKNRKVKFK-L--A--
NCAS0G00250        ELKSEVGVGSTFTFTVPLMQTRELELNEDDHP---FEDEFNPASRKNRRVKFK-L--A--
Suva_9.41          KLESKVGVGSKFTFTLPLHQTKEISFANMNFP---FEDEFNPESRQNRRVKFN-V--A--
Skud_9.21          KLESQVGVGSKFTFTLPLHQTKEISFANIEFP---FEDEFNPESKKNRRVKFS-V--A--
Smik_9.22          RLESKVGVGSKFTFTLPLPQTKEISFANMDFP---FEDEFNPESRKNRRVKFN-V--A--
YIL147C            KLESKVGVGSKFTFTLPLNQTKEISFADMEFP---FEDEFNPESRKNRRVKFS-V--A--
ZYRO0G06644g       DLKSKLGVGSRFTFTVPLTQTREINFDDIPAA---FEDEFNPDSKKNRKVKFK-I--A--
TDEL0B02210        KLDSKLGVGSKFTFTLPLTQTREIEFED-ENA---FEDEFNPLSKKNRKVKFK-V--A--
                    * *  * ** * :*:** *                :::.*  :. .  :.:        

TBLA0E02100        -----SITSSSQTHSDLNSLQS--------------------------------------
TPHA0E00250        -----DKVTSRGIPSKAA------------------------------------------
Kpol_1043.68       ------------------------------------------------------------
AFR284W            -----RSGKSRKGKMNNSNGAG--------------------------------------
Ecym_4020          -----KGGKSRQSSLSVPEIS---------------------------------------
KLLA0A00638g       ----RKSVQTKKSKSSIDG-----------------------------------------
TBLA0I01680        TTLANSSLKSRKSKGSLNSSFVGEIQNVNEAEEDAYNSKDI-------------------
SAKL0E14872g       -----KNSGGSKSRPSVNTSLN--------------------------------------
KLTH0E01100g       -----KNNKRKKSHSSS-------------------------------------------
Kwal_55.19707      -----KSNKRSKSRSESSGTEGNGGNS---------------------------------
TPHA0D04590        -----SSAKSIKTRNSIGSSLNNRHS----------------------------------
KAFR0D02240        -----RSINSRRSRSSLITSNSSRIATVREESRLETRSNH--------------------
Kpol_2001.74       -----DSSKSHDSNDEDEEGIKSSRD----------------------------------
KNAG0L02110        -----RSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGEN
CAGL0H06567g       -----RSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVG
NDAI0F00310        -----RSIRSKKSRASTVTFGTVTDLNHVPENEEEIKNGSQASVGSSGSSSSDGEESNNS
NCAS0G00250        -----KSLRSRKSRSSTTTFSTTNSLHNVQEEKEEDKLGDNEETKDGGKEEDA-------
Suva_9.41          -----RSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELD
Skud_9.21          -----KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENG
Smik_9.22          -----KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIG
YIL147C            -----KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNG
ZYRO0G06644g       -----KSLKSKRSKSSLMTVGPKS------------------------------------
TDEL0B02210        -----KSIKSRKSKSSLSNSSGKG------------------------------------
                                                                               

TBLA0E02100        --------------------NSTNEVGLDDSFSEAENDSTV-----ASLDKSVLQKTRMD
TPHA0E00250        --------------------EKNDDANTNGQTTLNAEAKSK-----------TLKPTHIT
Kpol_1043.68       --------------------TDEVDQVNIEGNSGVEVEPGK-----CTEPKKSTESESQA
AFR284W            --------------------SIAESAIESFGKSESEASFGS-----VRVDRPFLQSTGTA
Ecym_4020          --------------------GVPDSPLNSMGRSESELSVSS-----VRVDRPFLQSTGTA
KLLA0A00638g       --------------------HSDNNVSERKASNSTENSVGN-----VRVDRPFLQSTGTA
TBLA0I01680        --------------------NSSGELKIRHISTSTSNNNSI-----PSLDRPFLQSTGTA
SAKL0E14872g       --------------------SGTDSTAEKMALSESEVSVGS-----VRVDRPFLQSTGTA
KLTH0E01100g       --------------------SGQNSSVGTPTVSESEVSVGS-----VRVDRPFLQSTGTA
Kwal_55.19707      --------------------PGVEGSGGNSPGTGSEVSVGS-----VRVDRPFLQSTGTA
TPHA0D04590        --------------------TTSIDSSSSDSDEEDNVRPSS-----VRLNRPFLQSTGTA
KAFR0D02240        --------------------SDVSTSNKNESASPQPESGSN-----LNLDRPFLQSTGTA
Kpol_2001.74       --------------------IDSSNNEHKDENGTSPDNHSK-----VRLDRPFLQSTGTA
KNAG0L02110        ITFRS---------------ESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTA
CAGL0H06567g       DE------------------NDSKASSSSSKSDNIKEKEEK-----VHLDRPFLQSTGTA
NDAI0F00310        NNSTTHHSEDRTNTSENTNNNNIHEKEHKHKHEHTHNHSHNHGDYPVSLDRPFLQSTGTA
NCAS0G00250        --------------------HQERRHSHDKNNEHNNHLLGT-----VNMDRPFLQSTGTA
Suva_9.41          EAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGS-----VNLDRPFLQSTGTA
Skud_9.21          KAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGS-----VNIDRPFLQSTGTA
Smik_9.22          RIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGS-----VNLDRPFLQSTGTA
YIL147C            GLEQ-LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGS-----VNLDRPFLQSTGTA
ZYRO0G06644g       --------------------SSSDKSLSQLKLTDSDRS--------VRLDRPFLQSTGTA
TDEL0B02210        --------------------GSSDKSSKQLKGSESEFSVGN-----VSLDRPFLQSTGTA
                                                                         :     

TBLA0E02100        -AQKVEANEID-------------------DIDH---------------------CNKGI
TPHA0E00250        -ISEDNIDQHD-------------------------------------------------
Kpol_1043.68       VVPSKSSQEMG-------------------NSIK------------------------YD
AFR284W            -TSTRSVPTLS-------------------SAES--------------------------
Ecym_4020          -TSTRSIPTVG-------------------SLES--------------------------
KLLA0A00638g       -TSTRSISSVA-------------------SEVT--------------------------
TBLA0I01680        -TSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEE
SAKL0E14872g       -TSTRSITTVK-------------------SLER--------------------------
KLTH0E01100g       -LSTRSVTTTS-------------------VANK--------------------------
Kwal_55.19707      -LSTTLVTTSS-------------------LADR--------------------------
TPHA0D04590        -TSTQNVPTLN-----------------AHTDDK------------------SKNKVLNK
KAFR0D02240        -ISSANVPTVA-------------------TLGK--------------------------
Kpol_2001.74       -TSSQKIPTLI-------------------NKED-----------------------TNI
KNAG0L02110        -TSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKK----------------------TSEG
CAGL0H06567g       -TSSRNVPTMA-------------------DVTM--------------------------
NDAI0F00310        -TSSRNVPVLS-------------------ESNK----------------------DEDP
NCAS0G00250        -TSTRTIQTVP-------------------DAGK--------------------------
Suva_9.41          -TSNRNIPTVS-------------------NSDK-------------------------S
Skud_9.21          -TSSRNVPTVQ-------------------GGDK-------------------------D
Smik_9.22          -TSSRNVPTIQ-------------------DNDK-------------------------N
YIL147C            -TSSRNIPTVK-------------------DDDK-------------------------N
ZYRO0G06644g       -SSNTNLGTTS-------------------TINK--------------------------
TDEL0B02210        -SSSKNVTVVS-------------------NVNK--------------------------
                                                                               

TBLA0E02100        PSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLL-----SYKKYD
TPHA0E00250        ---FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKIS-----EKDKFD
Kpol_1043.68       VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQS-----RGEYYG
AFR284W            --SLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVE-----QGEHYD
Ecym_4020          --NFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTN-----QYDHYN
KLLA0A00638g       --RHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILK-----NGESYS
TBLA0I01680        DEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYD
SAKL0E14872g       --PFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQE-----ANDHYR
KLTH0E01100g       ---CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNE-----AGKFYD
Kwal_55.19707      ---RKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDA-----TGKHYD
TPHA0D04590        MDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSE-----NNGNYD
KAFR0D02240        --TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKE-----RGEFYD
Kpol_2001.74       EKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLAD-----NEEYYD
KNAG0L02110        NGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQD-----KGSRYN
CAGL0H06567g       --RFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVE-----QNDSYD
NDAI0F00310        AQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSE-----QNDSYN
NCAS0G00250        --KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVE-----QGEHFD
Suva_9.41          DSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTS-----RGESYN
Skud_9.21          GTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTS-----KGENYN
Smik_9.22          DTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTS-----KGGNYN
YIL147C            ETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTS-----KGENYN
ZYRO0G06644g       -----ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVE-----NGEHYN
TDEL0B02210        --SYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQE-----KGEHYE
                        :*:.*** *** *: *:* **    .  . ** :*                  : 

TBLA0E02100        IIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKR
TPHA0E00250        IIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKR
Kpol_1043.68       LVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKR
AFR284W            LIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKR
Ecym_4020          IVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKR
KLLA0A00638g       MIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKR
TBLA0I01680        LIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKR
SAKL0E14872g       IIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKR
KLTH0E01100g       LIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRR
Kwal_55.19707      LIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKR
TPHA0D04590        IIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKR
KAFR0D02240        MIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKR
Kpol_2001.74       IIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKR
KNAG0L02110        LIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKR
CAGL0H06567g       MIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKR
NDAI0F00310        IIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKR
NCAS0G00250        MIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKR
Suva_9.41          MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Skud_9.21          MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Smik_9.22          MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
YIL147C            MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
ZYRO0G06644g       LIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKR
TDEL0B02210        LIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKR
                   :::**:***.:**  :*  :* .*     ****:*:..: * . * . **: *: ***.*

TBLA0E02100        VALHTLLEEFQQDL----------------------------------------------
TPHA0E00250        FELKEIIKEFQNPPNDL-------------------------------------------
Kpol_1043.68       EQLKGILTEFCPKA----------------------------------------------
AFR284W            PMLKKILLEHTSQLKT--------------------------------------------
Ecym_4020          EKLRKILLEYCPVLNKSVSTTTNRGLED--------------------------------
KLLA0A00638g       PLLKKIIAQYC-------------------------------------------------
TBLA0I01680        PKLKDILNEFCPGYH----------LQN--------------------------------
SAKL0E14872g       PKLKSVLSEFCPDFVEKR-------NSN--------------------------------
KLTH0E01100g       PKIKEILSEYCPTYFKAD-------GEK--------------------------------
Kwal_55.19707      PKIKAILKEYCPRPI----------DEK--------------------------------
TPHA0D04590        PDLKIILKKYIEDFQ---------------------------------------------
KAFR0D02240        PQLKTILLEYCPKVDSMGR------ATS--------------------------------
Kpol_2001.74       PKLKQILQEYIDTEKQIN------------------------------------------
KNAG0L02110        TKLKTILKEFC--------------SDE--------------------------------
CAGL0H06567g       PKLKMILEEYCPNWIEMKKSKENKDGDK--------------------------------
NDAI0F00310        PKLRTIIKEYCPGWKSPTE-----------------------------------------
NCAS0G00250        PKVKTILEEYCPNWQMKV-------AED--------------------------------
Suva_9.41          PKLKTILIEFCAAYQGKKK-----------------------------------------
Skud_9.21          PKLNTILSEFCAAYQGKKNKK---------------------------------------
Smik_9.22          PKLKTILTEFCAAYQGKKIT-----SEE--------------------------------
YIL147C            PKLKTILTEFCAAYQ---------------------------------------------
ZYRO0G06644g       AQLRKIIEEFCPDKQPQEQDKEPKSSENDNSQLLQQDPQQSKEQKQQQQLLPIITTTTSS
TDEL0B02210        PKLKTIIAQYCHDDSKVVDKE---------------------------------------
                     :. :: :.                                                  

TBLA0E02100        -------------
TPHA0E00250        -------------
Kpol_1043.68       -------------
AFR284W            -------------
Ecym_4020          --PLFVNSGL---
KLLA0A00638g       ---SKKEKQREE-
TBLA0I01680        --NTDTNKGLQK-
SAKL0E14872g       --KAK--------
KLTH0E01100g       --KGKTEGQA---
Kwal_55.19707      --EGEVKNESEK-
TPHA0D04590        -------------
KAFR0D02240        --TGEESKHTKSN
Kpol_2001.74       -------------
KNAG0L02110        --REEDSKPVET-
CAGL0H06567g       --KVEENKPKKE-
NDAI0F00310        -------------
NCAS0G00250        --NKSKNE-----
Suva_9.41          -------------
Skud_9.21          -------------
Smik_9.22          --PKKAKTE----
YIL147C            ---GKKNNK----
ZYRO0G06644g       SSSGRETKNKDPQ
TDEL0B02210        -------------
                                

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0E02100
------MRLPSWKIKLKMNKQ--TVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYF
TTHYKDLNVNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGI
IESQSVLDKFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTI
PPLINNTGILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSV
FNDTAGLSDSTTALLSAIYTNDT-LPRYFHFVFPP-FDLDDSIIDERQTIKNGTFQYRAF
DKNKSGSKKKVKLVNK--------KNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLT
KIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDH
TYDSNDDHTYES---KLISS-TPTLKNSDSNIHDEKSGR---------------------
-------------TRGDANSGTLNSNNTITNNTN-------------NKDFNRL------
------------RRNVSVSTHVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEH
YALLEKRVHQRTKQLEAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDI
KKIKDGLKLIFRSGELLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQ
LQEVKLFIRLLPKKFLKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEY
DEEESKTENYSKVCIKPSTQIVTESGELIKSKIRCKI-------------TKSTTNMNTA
----TTNNSARIESNTNQYLSPYSHTNTRTHTHP-----------------GA-DS--RR
NSNVSTVNNSSI----SLDSESSKM-YDNLMFNRLIKREGDGDINDIK----ALEQIEGN
KKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTL
ELESELGKGSKFIYTIPLLQVGGTKKDNDD-----NEEDHNDNTNSSVDIDIIEDTPV--
-----SITSSSQTHSDLNSLQS--------------------------------------
--------------------NSTNEVGLDDSFSEAENDSTV-----ASLDKSVLQKTRMD
-AQKVEANEID-------------------DIDH---------------------CNKGI
PSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLL-----SYKKYD
IIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKR
VALHTLLEEFQQDL----------------------------------------------
-------------
>TPHA0E00250
-------------MNLKNLRL--ATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYF
TNNYKSLRAEQLFIAAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENW
VESISSVSAFLTSSSIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPL-SSDERL
PASIGTIGFLTDPVLNTSNYLMSLSLPI---FGNPSIILSDSRVYGYVTIITGASSIVAV
FNDTTALENSNVAIISAKYRNSTTYADGYHFVFPP-YGSDASVIDIFYPLSNNSFLFDAF
TEDTTGSVSSTTFFYS--------SLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLT
KIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELISRGRGLRP---------YYEN
LSDRTSQDNTST---RTTIDLSDLDGYTNEKEKSLPTCTED-------------------
-------------ERSKSLSNIASKSIFTTLRKI-------------LGFSSRS------
-----------GMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEH
SNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDN
EKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAK
DQGVNFSILISP-NLIRTMVFFGDSNRIIQVIMNLVSNALKFTP-IDGNVDVRIKLLGEY
DEEKSSLNNYDKVYIKEGTSFT--------GDNDAIP-------------TEPISDKISF
----AGGSSSIHDYCSKTDE--------------------------------------ND
NIKTEIKSDD------STISD-----YSEENIMGSY--YENKNPGQEL----LGVPIPKP
KKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTM
ELDSTTGLGSKFTFTVPLLQERKIIFSETEKA---FEDEFNFNSKKNRKVNFK----T--
-----DKVTSRGIPSKAA------------------------------------------
--------------------EKNDDANTNGQTTLNAEAKSK-----------TLKPTHIT
-ISEDNIDQHD-------------------------------------------------
---FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKIS-----EKDKFD
IIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKR
FELKEIIKEFQNPPNDL-------------------------------------------
-------------
>Kpol_1043.68
-------------MLRACNVS--IWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYF
TKNYRDLRLQQLYIAARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENW
ASTSDVLSTFLESSVVFLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPL-SGTDSL
PSYLGTTGLLTDPVLNDSTYLMSMSLPI---IANPSVTLSDSRVFGYLTVVMSAETIRAV
VNDTTALEKSIVAVISSTNTNGT-SGQEYHFVFPP-HGASDDIVNTAYPVENSTFLSDAF
SSPEGGSINKSKSLYS--------KAVAIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLT
KIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISKRDGNEVHRSNS----SSSS
RSTFSSNRRSKD---GRH------------------------------------------
-------------NSSSYNLYEDVEKYTEIGKAN-------------KSTESLS------
------KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEH
SQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDM
ERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISK
DQHVKLSIFILP-NKLRSMVLWGDQNRILQVIMNLVSNALKFTP-VDGKITVNIKLLGEY
DKDRSAAENYKDVYMKE----------------------------------IRNSNGDKI
--------KPLMTLISSKDTMSVADNISNK------------------------------
----------------SVASDTERS-TNNTIYSNKFKNGSNFQDTDDA----IGVPLDKK
RKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTM
KLESEVGVGSKFIFTVPLLQTREIEFNGNELV---FEDEFNINSKKNREVKFQEI-----
------------------------------------------------------------
--------------------TDEVDQVNIEGNSGVEVEPGK-----CTEPKKSTESESQA
VVPSKSSQEMG-------------------NSIK------------------------YD
VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQS-----RGEYYG
LVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKR
EQLKGILTEFCPKA----------------------------------------------
-------------
>AFR284W
------------MRLGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYF
TSNYRTLRADRLHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENW
IEADKILGGFLERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPL-EMDKYE
YNEALDVQVETLP-YNKTLNLMSMTLPV-----EASTIIGRGNVVGFLTIVMSADPITAV
-NDTSVLGESMVSILTGIPNDKG-NLVKYRFVFPP-GETDRSVTETEYPIKNASFLRDAF
LNRSDNYVTSTSSFYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLT
KIIIGTVLGVAVFMCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSG----RSSS
QNTSI-DRSNSR---GSDHSLPRELFEKKHHVSPFVTENHAA------------------
-------------NSGSCSSMSDHERYLHHIARY-------------HDGETST------
-----------NILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQ
YVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQ
EKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAK
DQHVKLSIYLMP-NAIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLVGEY
DSARSEACNFSEVYILPGTE---------------VT-------------NSSVNNIPTV
----VEEEEKACEEEPTADDTPER----------------------------------KK
KDSETVDDADAI----SISSSVATS-YDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKP
RSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTM
KLESKVGSGSKFTFTVPLQQTGTVKFNDGDTL---FEDEFNIFSKKNRKVKFQ-L--N--
-----RSGKSRKGKMNNSNGAG--------------------------------------
--------------------SIAESAIESFGKSESEASFGS-----VRVDRPFLQSTGTA
-TSTRSVPTLS-------------------SAES--------------------------
--SLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVE-----QGEHYD
LIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKR
PMLKKILLEHTSQLKT--------------------------------------------
-------------
>Ecym_4020
MALLFIKKHLSIPTTRRIRKH--MFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYF
TTNYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNL
DNAKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPL-SSNSPL
PSSIIDDGMLSNPVFNGSSFFMSMSLPV---SAKASILYPKSDTVGYITMVMSADQVSSV
CAGKPALNGSTVSVLAGVYDENN-ILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAF
VNRSSGSVSKTNAFYE--------PNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLT
KIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATELIAAGRGLRSYRHSS----RSSS
RTTSI-NRSNSK---GSPSP-TLREGDGLRKTPPSPYTPMH-------------------
-------------SHVEPNPSGIGREYSVDIARA-------------IGIEVPS------
-----------SHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRH
YALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDM
EKVQNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAK
DQNVKFSIFLMP-NLIRKMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVSLRIKLLGEY
DEEESEKCNNAEVFIKQGTE----------------I-------------SDETKNVFDT
----ITEEKYVSCSGESTDDTIET----------------------------------GQ
EGAQKPDKADNI----SVVSSGTSS-YDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKK
KVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTM
KLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDL---FEDEFNAQSKINRRVKFK-L--N--
-----KGGKSRQSSLSVPEIS---------------------------------------
--------------------GVPDSPLNSMGRSESELSVSS-----VRVDRPFLQSTGTA
-TSTRSIPTVG-------------------SLES--------------------------
--NFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTN-----QYDHYN
IVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKR
EKLRKILLEYCPVLNKSVSTTTNRGLED--------------------------------
--PLFVNSGL---
>KLLA0A00638g
-----MLAGLKRRCSLKALRE--RFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYF
TTNYKSVRAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNW
NSAEDSLEKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPL-SGVEPL
SSSLLTTGIVTDPVYNWTNYLLSMSLPV---STNPSIILNTNEIAGYITVIASAESLKAV
VNDTIALDKSSVSILSAVFDSNS-SLTGYHFVFPP-HGTSSFSSKVTFPIKNGTFIADAF
ENGKVGSVMKTNMVQE--------RNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLM
KIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIITSGRDLKHYSNTG----NSDS
NTAITHSRTRST---SNQNQVMKLFNKSVTKGTPSNYLNHNYNVF---------------
-------------PPSRTDSPSVSARNSQTIPRG-------------PGDLTRS------
-ATTGSTPFSNDSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRH
YALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDM
QKVQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAK
DQHVKLSIALTP-NFIRTLVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLLGEY
DSKRSESVDYQEVFVVPGSEANDDFEFNL-TSTTPMR-------------LPFNSSSGSV
NTATKDGSTSPTTKTKEGSIQVESETSTEGNDND-----------------ES-SIVLES
KHEENEDEKEKM----SILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEEN--TFRDLKVP
KTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM
KLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQ---FEDEFNIHSRKNRKVKFK-INSS--
----RKSVQTKKSKSSIDG-----------------------------------------
--------------------HSDNNVSERKASNSTENSVGN-----VRVDRPFLQSTGTA
-TSTRSISSVA-------------------SEVT--------------------------
--RHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILK-----NGESYS
MIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKR
PLLKKIIAQYC-------------------------------------------------
---SKKEKQREE-
>TBLA0I01680
------------MGPSRMFRS--ILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYF
TVNYKHMRVDRLSIAAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVW
YDSQVVVEKFLSSSDIFSISRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPL-SSSDPL
PASLGSSGMLTDPVLNSTTYLMSMSLPI---LANPSIILTDSKVYGYITIIMSAESLMSV
YNDTTALEKSNVAIVSGEYSDYSASLTEYHFVFPP-YGATPKIIDIYYPLQNGSFLYDAM
NNQKKGSIMKTKFFYN--------NDVAIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLT
RIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATELIAEGRGLRS--SSN----RTLS
RNGSLKFGRYSID--SPIIPISPTFLHNNNNHHRNSSNESHD------------------
-------------PEKLSHLSNDISKSSNSSSTG-------------SRFHFVC------
------IFFSSHKSSNTPPPPMST--ILETKVPVYRRLFLDELSELTDTFNTMSDALDQH
YALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDI
DNIKSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAK
DQHVKLSIYLIP-NEIRTLVLWGDSNRIIQIVMNLVSNALKFTP-IDGKVSVRMSLLGEY
DKEKSKAADYKEVFVKTGTE----------PEENYSK-------------ILQKLNTEKL
----IATRSARSCDNEERHNELIGEKNDIISNNH-----------------QS-SNTTFD
ISIHNRTRDDTL----SLLSTSTSS-YDETVFNDQFKKITGLQDHDEER---LGVEIKEP
KTWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM
VLESKVGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFA-IPSSPG
TTLANSSLKSRKSKGSLNSSFVGEIQNVNEAEEDAYNSKDI-------------------
--------------------NSSGELKIRHISTSTSNNNSI-----PSLDRPFLQSTGTA
-TSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEE
DEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYD
LIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKR
PKLKDILNEFCPGYH----------LQN--------------------------------
--NTDTNKGLQK-
>SAKL0E14872g
------------MTVIGHLRS--KLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYF
TANYKSLRADRLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENW
SEAEIVLEKFLGSSDLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPL-STDDPL
ASSLQTSGILTDPVLNDTVYVMSMSLPI---FASPSIMLTNSEISGYITVVMSAESLKIV
FNDTTALDKSDVAILSAEYSNQS-LPVSYHFVFPP-HGVGADIIDYSFTIENGSFIQSAF
DDRKSGSVKRTSFFYG--------KDVAVGYSPCLFKQVQWVAVISQPENVFLSPSTRLT
NIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEIITARRGLRSYNQSA-----PAS
RTNSFRKRPSTSSSIGSVFR-TITDRPHERDNGHSNFELHHR------------------
-------------TSNSVDSQEARMELEISGALP---------------DTNPT------
----TPTSYTNDQHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRH
YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDM
QKVQNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAK
DQHVNLSIILSP-NVIRTMILWGDSNRIIQIVMNLVSNALKFSP-VDGKVGVRIKLLGEY
DGKKSKDSNYNDVFIKPGTEIPDASASK--SSLSTLE-------------YTKVDAIQRR
----LASKSSDSQKLKEEPIASSDVSSSDGKDES-----------------EA-DTDTDT
DKRSNSEISDSL----SLVSSNNSS-YDDAILHAQLRKVPSCGNGEDSGDS-LGRKLEIS
KTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM
KLESKVGVGSKFTFTVPLTQTREVSFDDVENP---FEDEFNAHSKKNRKVKFK-M--N--
-----KNSGGSKSRPSVNTSLN--------------------------------------
--------------------SGTDSTAEKMALSESEVSVGS-----VRVDRPFLQSTGTA
-TSTRSITTVK-------------------SLER--------------------------
--PFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQE-----ANDHYR
IIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKR
PKLKSVLSEFCPDFVEKR-------NSN--------------------------------
--KAK--------
>KLTH0E01100g
------MARLKKFDLGAYAKR--KLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYF
TSSFKSMRAERLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENW
ADAVTTLDKFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPL-STNVSL
PSSLEVKGMLTDPVLNDTGYLMSMSLPI---FANPSIILSTSKVYGYITVVISAEGLKTV
FNDTTALEDSSVILVSTVYDNRE--LAGYHLVFPP-YGMPSDIIDKRYTIGNDSFLMDAF
KQSKGGSIKSTHFLYS--------KAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLA
RIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSS
TAESF-SSALHP---ASIRRSGSVARSSKHKYIPESAKGTL-------------------
-------------NKNDFEEIQPDGIENNEDAAL-------------QKVHSPT------
-----PGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRH
YALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDM
QKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAK
DQHVNLTISIIP-NVLRTMVLWGDSNRIVQIVMNLVSNALKFTP-VDGRVNVKFTLLGEY
DESKASNGCFDRAAVVPIQESEKESSTLGPTEKGGIKDVTESASSSNATWPPSPSTSETS
NGSKAETTSGKLTESSEEDEKEEKLDHDDKDEGDEESEEEEYRGEAEVSGKDDTNNETQR
EDSNENQNEDAR----SIESENASS-YDDAIFHSRLRKGNSGENED-------GRPLEHP
RRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSM
SLDSKVGVGSKFTFTVPLTQTKELCFEEDENP---FEDEFNPDSKKNRKVKFK-V--S--
-----KNNKRKKSHSSS-------------------------------------------
--------------------SGQNSSVGTPTVSESEVSVGS-----VRVDRPFLQSTGTA
-LSTRSVTTTS-------------------VANK--------------------------
---CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNE-----AGKFYD
LIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRR
PKIKEILSEYCPTYFKAD-------GEK--------------------------------
--KGKTEGQA---
>Kwal_55.19707
------MVRLNNIDLGAFFQR--RLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYF
TSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENW
SDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPL-STDVAL
PSSLERTGMLTDPVLNGSVYLMSMSLPI---FANPSIILSTAKVYGYITVVISAEGLKSV
YNDTTALDDSSVIIVSTVYDDHE--LAGYHLVFPP-YNMYPDVINEHYQIENGSFLEDAI
KDGKGGSIKSTRFFNN--------KKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLA
KIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTS
TAESF-SSIFGT---GSVRRSGSVARAGRDKYIPDSSKEVP-------------------
-------------RGNSSDAIHEVNQENIEDIEM-------------QKVNSPT------
-----PYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRH
YALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDT
AKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAK
DQHVNLTISILP-NLLRSMVLWGDSNRIVQIVMNLVSNALKFTP-VDGKVDVKFRLLGEY
DEEKSKASEYKEVFVLPPTE----------SRTSSTE-------------AKDEKNAESC
----VDSDTNVLSLPSTAESTDEKNVKIGQRSES-----------------EAIDSEAIE
SSDEDDENEDTK----SIGSGNTSS-YDDAIFQTRLRKDSSNEENEE------GRALESP
KKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM
KLDSQVGVGSKFSFTVPLTQTKELLFEDVENP---FEDEFNPDSKKNRKVKFR-M--G--
-----KSNKRSKSRSESSGTEGNGGNS---------------------------------
--------------------PGVEGSGGNSPGTGSEVSVGS-----VRVDRPFLQSTGTA
-LSTTLVTTSS-------------------LADR--------------------------
---RKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDA-----TGKHYD
LIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKR
PKIKAILKEYCPRPI----------DEK--------------------------------
--EGEVKNESEK-
>TPHA0D04590
--------------MQLIPKK--FWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYF
TANYKNLKTGRLYIAAQLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNW
YESSLVLEKFLTSSDLFSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTL-SLNISL
PSSLETIGICTDPVLNGSNFLMSMSLPI---FANPSIILSDSRIYGYLSVIMSAEGLKSV
FNDTTALENSEVFVISADYSITT-NLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGL
VNGKGGAVKKTNGFLG--------TAAAVGYSSCSFSLVNWLAIVAQPEAAFSESATKLE
RIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATERIAEGRGLRP--PQPTVG-SSVS
RNSSI-KWRNSL---ENHVRSSLGFNANKLSDSGSITANNFK------------------
-------------NNTSSSNSITSSHIYGNNNSS-------------HSSMGIN------
---------PDDDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQH
YCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDV
DKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAK
DQHVKLSIILMP-NILRSYVLWGDSNRIIQVVMNLVSNALKFTP-VDGNVDVRINLLGEY
DEERSKAEDYKKVYVKQGTELP--------LNISHLK-------------TEENNDISRK
-------SETELNNDENETHTISKDDTADSSIKI-----------------GN-----ED
VEISEVDKMGMA----SLVTTSSKS-YDDTALMKQLIKSTDLDDDENK----LGVELKEQ
KTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTM
ELESEVGVGSKFIFTLPLKQTREISIPDDE-L---FNDEFNAVSKKNRKVKFK-FSGS--
-----SSAKSIKTRNSIGSSLNNRHS----------------------------------
--------------------TTSIDSSSSDSDEEDNVRPSS-----VRLNRPFLQSTGTA
-TSTQNVPTLN-----------------AHTDDK------------------SKNKVLNK
MDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSE-----NNGNYD
IIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKR
PDLKIILKKYIEDFQ---------------------------------------------
-------------
>KAFR0D02240
MVARVFARKRISQRLKRLAHL--NTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYF
TSSYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNW
ESTESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPL-STNIPL
SSSLETTGILTDPVLNGTSYLMSMSLPV---FANPSIILSTSRVYGYITIIMTADGLLSV
FNDTTAIEKSNVAIVSAVYNNQS-ELDAYHLALPP-YGFTASVTDINFQLKNSSFLNGAL
KQGKGGSIKKTHFLYN--------KAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLT
KIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIITEGRGLRP--TTP--GSGSVS
RTSSM-RREKSP---RTSIV-SSRKSTATGNSNSLNENSASLSSHPMVL-----------
-------------TSENVLVTNHSGLSRIPVNMN-------------QELLDRA----SA
STVNTLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEH
YTLLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDI
TKIRSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAK
DQHVRLSIILSP-NIMRTMVLYGDSNRIIQVVMNLVSNALKFTP-VDGKVQVKIKLLGEY
DEESSKNSKFEKVYVKGGTEFTSIP-----AELAALS-------------KRESTAGSHF
SGSSSHIKEKLDGIPANVFASDSDSDDPSEGTTI-----------------NT----SQQ
RTSSNEDYVDNI----SIASTSTSS-YDDAIFNSQFKKTPDLYEDEDGN---LGEELSQQ
KTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTM
TLESTVGSGSKFIFTVPLTQTRVIKLDESEHP---YEDEFNPKSKMNRKVKFN-V--A--
-----RSINSRRSRSSLITSNSSRIATVREESRLETRSNH--------------------
--------------------SDVSTSNKNESASPQPESGSN-----LNLDRPFLQSTGTA
-ISSANVPTVA-------------------TLGK--------------------------
--TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKE-----RGEFYD
MIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKR
PQLKTILLEYCPKVDSMGR------ATS--------------------------------
--TGEESKHTKSN
>Kpol_2001.74
--------------MRQSWRK--AFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYF
TENYKELRSGRLNIAAKLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENW
IESENVVQKFLSSSDLFYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPL-STNQSL
PSSLNNDGILTDPVLNGSIYLMSMSLPI---LTNPSIILSSSRVYGYITIVMSADGLKNV
YLNNTALENSNVTVISAIYNDQG-KVDGFHFVFE--VENDDFSTLIEYPIQNGTYLSSAL
VEGKSGSIKKTKYPFN--------RELAIGYSPCSFSLSNWVALVTQPEAVFLSPSTKLE
KIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELISQGRGLKP--TSNF---SNGD
SSSTSDNWRESV---ESHVRASLGIFKSLRNNGSNE------------------------
-------------LQSNDDMNEINERSSKNNSTG-------------DNIKSSD------
-----------NDSSSSFQRYTTS-NLVQARVPVYGRFLQDELSELTDTFNAMTNALDQH
YTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDS
DKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVAR
DQHVKLLIILMP-NRIRSMVLWGDSNRIIQIVMNLVSNALKFTP-IDGKVDVRIKLLGEY
DEERSMNDDYKEVYIKSGTELPIGNGK---KTDMVRK-------------KIQELSEKDC
----IEGDTASSGSHMSGSSKIDKLIEDEEKNSF-----------------SD-------
-NEDTNNDIEIL----SMTTSSTRS-YDDAALQRQFKKTPDLDDKEET----LGVELSEP
KTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTM
KLESTVGVGSKFIFTVPLKQTREIHFDDEK-----FEDEFNAESKKNRRIKFK-I--Y--
-----DSSKSHDSNDEDEEGIKSSRD----------------------------------
--------------------IDSSNNEHKDENGTSPDNHSK-----VRLDRPFLQSTGTA
-TSSQKIPTLI-------------------NKED-----------------------TNI
EKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLAD-----NEEYYD
IIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKR
PKLKQILQEYIDTEKQIN------------------------------------------
-------------
>KNAG0L02110
------------MWFRLRSFT--P-KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYF
TSNYKNLRSDRLYIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANW
MDSQSVLEKFLGSSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPL-STNVPL
PSSLETNGIVTNPVKNGSSYLMSMSLPI---FANPSIILTDSRVYGYVTVVMSAEGLLSV
FNDTTALERSYVAIVSAVYTNAT-KLDAYRFVFPP-FGSTSSILNETFPLNNNTFLSSAL
RQGKGGALKSTRLFYR--------LKLAVGYSPSTSNLANWVAIVAQAESVFISPATKLA
KIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELITESRGLRP--TTP----TSGS
RANSI-LRDKSS---LISFPLHPVSTNNINNNNSNEKAQ---------------------
-------------PPSDQDTNTNNSSSSIAVSNI-------------REEHSPHADGVFS
GISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQH
YALLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDI
DKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAK
DQHVRLSIILSP-NMIRSMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRMKVLGLY
DEALSEKYNHNKVYVKPGTEIT--------------D-------------STPSLNVKSE
----GQGKDKFTSDTASKNNTSSDTAYDATPTTD-----------------RV-----AQ
ESDEDNMYEDNE----SMISSTTSS-YDDAIFNSQFKKTTNLYDEDDESE--MGVELETP
KTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKM
LLESKVGVGSKFTFTLPLTQTREINFANVEDP---FEDEFNAKSKKNRKVKFR-M--A--
-----RSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGEN
ITFRS---------------ESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTA
-TSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKK----------------------TSEG
NGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQD-----KGSRYN
LIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKR
TKLKTILKEFC--------------SDE--------------------------------
--REEDSKPVET-
>CAGL0H06567g
---------MDSTESAPRRRR--FLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYF
TSNYKNLRSDRLYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENW
EESTNVIQKFLSSSNLFFLSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPL-STDVPL
PSSLMTNGMLTDPVLNGTDYLMSMSLPI---FANPSIIFSDLKVYGYITVVMSAEGLRSV
FNDTTALEKSNVAIVSARYSNYT-KIDSYRFVFPP-YGVSPSILNRTFELDDSSFLNGAF
KQAKGGSIKKTKFFYT--------KDVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLT
KIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEGRGLRP--AGAGSGSRSGS
RTSSMKKDINDL---NFISRLSLSEK----------------------------------
-------------NHRPAYDSASDSNYATDGSLS-------------HDLQTSQ------
---ASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQH
YALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDI
AKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAK
DQHVRLSISLTP-NVIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVNVRIKLLGEY
DEEATKADNFKQIHTIADSD-------------AHQQ-------------HPVSSSPNGV
------LVKHLSTSSDSNSNLSDSDKYNEKTYDE-----------------DD-DE--HS
ITNISDHSDDLS----SLVSSSTSS-YDNALFNTQFKKTPDLYEDSNDG---LGTELADQ
KTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM
KLESKVGVGSKFTFTVPLKQTRVIKFDEEEDL---FEDEFNPESKKNRRVKFKDS--T--
-----RSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVG
DE------------------NDSKASSSSSKSDNIKEKEEK-----VHLDRPFLQSTGTA
-TSSRNVPTMA-------------------DVTM--------------------------
--RFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVE-----QNDSYD
MIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKR
PKLKMILEEYCPNWIEMKKSKENKDGDK--------------------------------
--KVEENKPKKE-
>NDAI0F00310
--------------MKIPDKF--VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYF
TANYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENW
ADSASILQKFLSSSNLFSVAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPL-STNIPL
SSSLETTGILTDPVLNSSTYLMSMSLPI---FANPSVILAESRVYGYLTVVMSAEGLRTV
FNDTTALEKSNVAIVSAVYNNVS-ALTAYRFVFAP-MGAPSYIINSTYRLTNGSFLSSAL
REGKGGSLKSTKFFYS--------KNVAIGYSPCTFSFVNWVAVVSQAESVFLSPSTKLA
KIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELISEGRGLKS--TNP--DSRSVS
RNNSL-KLPSRN---TSHYR-NRSSASSVQQYTGEKQIYPTHSYQHNTIRNMSPQRLSPS
PLGLSINRHNH--NNDINNNNNNNNNISPDNNLNLPLHGNNFQSDSVSNLSPRQGTPELR
RSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQH
YALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDI
SKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK
DQRVKLSITLTP-NTIRTMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVNVKVKLIGEY
DEALSAKNNFKEVYVKQGTELLGCSNPIEKTNESIPS-------------PKSENNNSSS
TTSGKDTTNSETSFEDEKSADDLDDEKIATKDAE-----------------NENTDDTEN
LDEQTDSVCDNI----SLVSTSTSS-YDDAIFNSQFKKSPGLYDDDENND--AGVLIEDP
KTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
KLKSEVGVGSTFTFTVPLKQTREINFDDMEHP---FEDEFNPESRKNRKVKFK-L--A--
-----RSIRSKKSRASTVTFGTVTDLNHVPENEEEIKNGSQASVGSSGSSSSDGEESNNS
NNSTTHHSEDRTNTSENTNNNNIHEKEHKHKHEHTHNHSHNHGDYPVSLDRPFLQSTGTA
-TSSRNVPVLS-------------------ESNK----------------------DEDP
AQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSE-----QNDSYN
IIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKR
PKLRTIIKEYCPGWKSPTE-----------------------------------------
-------------
>NCAS0G00250
------------MKVNLSKWY--VLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYF
TSNYKNLRSDRLYIAAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENW
ADSEQVIQKFLTSNNLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPL-ATNQPL
SSSLETIGILTDPVLNGSTYIMSMSLPI---FANPSIILTDSKVYGYITIVMSAEGLKTV
FNDTTALEQSNVAIVSGVYNNES-TLNAYHFVFAP-YGAPSYVINSTFRIMNNSFLNTAL
REGKGGSVKKTKFFYT--------KNIAVGYSPCTFSFVNWIAIVSQDESVFLSPSTKLA
KIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELMSEGRGLKS--TTP--GSKNVS
RSSSIKHYVRSN---IPSTA-SSVHNFSGDNLSTTTNGHLNQRGLTPTPM----------
-------------PTTDLPSPSDSNFATEMISNA-------------NTSQRAN------
---SISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQH
YALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDI
AKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK
DQRVRLSIVLLP-NIIRTMILFGDSNRIIQIVMNLVSNALKFTP-VDGKVNVRIKLMGEY
DENLSRESNFKKVLVKSGTEFIET------KAKAILG-------------APKKDDPKTS
TESVVQIKENLNSNTSSSSNDIISTTSDEKKYDE-----------------KE-DE--GE
EDNSDNDNDDTSMETQSIVSTSTSS-YDDAVFNNQFKKTPELYEDEDGN---LGIELTNP
KTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTM
ELKSEVGVGSTFTFTVPLMQTRELELNEDDHP---FEDEFNPASRKNRRVKFK-L--A--
-----KSLRSRKSRSSTTTFSTTNSLHNVQEEKEEDKLGDNEETKDGGKEEDA-------
--------------------HQERRHSHDKNNEHNNHLLGT-----VNMDRPFLQSTGTA
-TSTRTIQTVP-------------------DAGK--------------------------
--KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVE-----QGEHFD
MIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKR
PKVKTILEEYCPNWQMKV-------AED--------------------------------
--NKSKNE-----
>Suva_9.41
------------MRFRLPSRS--VFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYF
TSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNW
VDSVSIVQKFLSSSNLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPL-STDMAL
PSSLETTGILTDPILNSTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSV
FNDTTALEKSNVAIISAVYNNQS-KAYAYHFVFPP-YGTSSSITKTIFPIKNNTFISSAF
KNGKGGSLKKTNSFGI--------KNLALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLA
KIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRP--STP----RTVS
RTSSF-KRGFSS---GFAVP-SSLLQFNSGEAGSTTSASGHGCSGRGSAAVMSTDSSMKS
AMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLN-------------HDLLAPN------
----ALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH
YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK
DQRVRLSISLFP-NFIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVEVRMKLLGEY
DKELSEKKQFKEVHVRKGTEIIEDI-----GNINKHD-------------AKKSENFKKS
----MDSESTTTSMTSNRDTSTIQEEITKRNTAA-----------------NE-NIYKKT
RDREKSSNDDIS----SIVSTSTSS-YDDAIFNSQFNKALGSDDDEGGD---LGKPIENP
KTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
KLESKVGVGSKFTFTLPLHQTKEISFANMNFP---FEDEFNPESRQNRRVKFN-V--A--
-----RSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELD
EAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGS-----VNLDRPFLQSTGTA
-TSNRNIPTVS-------------------NSDK-------------------------S
DSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTS-----RGESYN
MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
PKLKTILIEFCAAYQGKKK-----------------------------------------
-------------
>Skud_9.21
------------MRFRLPSRS--DFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYF
TSNYKNLRSDRLYIAAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNW
VDSLSVVQKFLSSSNLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPL-STDIPL
PSSLETTGILTDPIVNNTDYLMSMSLPI---FANPSIILTDSRVYGYITIVMSAEGLKSV
FNDTTALEKSNVAIISATYNAQG-RASGYHFVFPP-YGTLLSITQRIFPIENNTFISSTF
RNGKGGSLKKTNNFGT--------KNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLT
KIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELITEGRGLRP--STP----RTVS
RASSF-RRGFSS---GFTAP-SSLLQFNTGEACSTTSANGHGSSGHGSGVALSTESSMKS
AINLGHEKLSPSEEENKIPNNHNDVKISMDGSLN-------------HDLLAPN------
----SLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQH
YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
NKIRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAK
DQRVRLSISLFP-NLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEY
DKDSSEKRQFKEVHVKKGTEITDVV-----ESIDKRD-------------LPTSLGRRKY
----VNLESTTASITSCRDNSAIQEEITKRNTAA-----------------NE-NIYKKA
NDREKSSNDDVS----SIVSTTTSS-YDDAIFNSQFNKALDSDSDESGN---VGRPIENP
KTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
KLESQVGVGSKFTFTLPLHQTKEISFANIEFP---FEDEFNPESKKNRRVKFS-V--A--
-----KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENG
KAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGS-----VNIDRPFLQSTGTA
-TSSRNVPTVQ-------------------GGDK-------------------------D
GTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTS-----KGENYN
MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
PKLNTILSEFCAAYQGKKNKK---------------------------------------
-------------
>Smik_9.22
------------MRLRLPSKS--EFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYF
TSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNW
VDSLSVVQKFLSSSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPL-STDTPL
PSSLETTGILTDPVVNNTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSV
FNDTTALEKSNVAIISALYNNQG-KASGYHFIFPP-YGTASTLTQSVFSIKNNTFISSAF
RNGKGGSLKQTNSFGI--------KNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLA
KIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRP--STP----RTVS
RASSF-KRGFGS---GFTVP-SSLLQFNTGESGSTISASGHGGSGHGSGAAFSTESSMKS
AINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLN-------------HDLLAPN------
----SLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH
YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK
DQRVRLSISLFP-NLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEY
DKDLSEKKQFKEVHVKRGTEITEYS-----EETNKCD-------------IPISSNHRKH
----VDLESTTTSITSNRDTSIIQEEITKRNTAA-----------------NE-NIYKRM
NDAEKLSSDDVS----SIVSTTTSS-YDDAIFNSQFNKAPGSDEDEGGN---LGKPIENP
KTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTM
RLESKVGVGSKFTFTLPLPQTKEISFANMDFP---FEDEFNPESRKNRRVKFN-V--A--
-----KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIG
RIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGS-----VNLDRPFLQSTGTA
-TSSRNVPTIQ-------------------DNDK-------------------------N
DTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTS-----KGGNYN
MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
PKLKTILTEFCAAYQGKKIT-----SEE--------------------------------
--PKKAKTE----
>YIL147C
------------MRFGLPSKL--ELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYF
TSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNW
VDSLSVIQKFLSSSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPL-STDTPL
PSSLETIGILTDPVLNSTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSV
FNDTTALEHSTIAIISAVYNSQG-KASGYHFVFPP-YGSRSDLPQKVFSIKNDTFISSAF
RNGKGGSLKQTNILST--------RNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLA
KIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRP--STP----RTIS
RASSF-KRGFSS---GFAVP-SSLLQFNTAEAGSTTSVSGHGGSGHGSGAAFSANSSMKS
AINLGNEKMSPPEEENKIPNNHTDAKISMDGSLN-------------HDLLGPH------
----SLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH
YALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV
NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK
DQRVRLSISLFP-NLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEY
DKELSEKKQYKEVYIKKGTEVTENL-----ETTDKYD-------------LPTLSNHRKS
----VDLESSATSLGSNRDTSTIQEEITKRNTVA-----------------NE-SIYKKV
NDREKASNDDVS----SIVSTTTSS-YDNAIFNSQFNKAPGSDDEEGGN---LGRPIENP
KTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTM
KLESKVGVGSKFTFTLPLNQTKEISFADMEFP---FEDEFNPESRKNRRVKFS-V--A--
-----KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNG
GLEQ-LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGS-----VNLDRPFLQSTGTA
-TSSRNIPTVK-------------------DDDK-------------------------N
ETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTS-----KGENYN
MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
PKLKTILTEFCAAYQ---------------------------------------------
---GKKNNK----
>ZYRO0G06644g
------------MWMRQLMFG--KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYF
TDNYKNLRSERLYMAAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANW
VDSGNVIQKFLTSSGLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPL-SGNKPL
PSSLQSEGILTNPVLNGTSYLMSMSLPI---FANPSIILTTSHVYGYITIVMSADSLKNV
FDDTTALEKSNVAILSAVYDQNE-TLSSYNFVFAP-LGVPSSILAETIPIKNGTFLSSAL
RQGKGGALERTKFLYT--------KKVAVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLT
KIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELITEGRGLRA--SSPGAGSSNVS
RRSSFFHRPSNC---GSSIRSRVTDNHNEK------------------------------
-------------GHDLHGEQIQHGFFAMNGSIN-------------HSLAASI------
------ASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQH
YALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDI
DKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAK
DQRVRLSITLYP-NLIRTMVLFGDSNRIIQIVMNLVSNALKFTP-VDGKVNVYMSLLGEY
DAERSENENHKKVYVIPGTEPKGNDE----KDKGGIE-------------EKERFSIENT
----PNDTSSNSSNKHSDTETTPGLNDTDEKQAS-----------------DD-----MD
GGEEDVEDADEV----SSFSTSTSS-YNDTVFHSQFKKTPKVCDDSSEE---LGVEVKDK
KKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM
DLKSKLGVGSRFTFTVPLTQTREINFDDIPAA---FEDEFNPDSKKNRKVKFK-I--A--
-----KSLKSKRSKSSLMTVGPKS------------------------------------
--------------------SSSDKSLSQLKLTDSDRS--------VRLDRPFLQSTGTA
-SSNTNLGTTS-------------------TINK--------------------------
-----ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVE-----NGEHYN
LIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKR
AQLRKIIEEFCPDKQPQEQDKEPKSSENDNSQLLQQDPQQSKEQKQQQQLLPIITTTTSS
SSSGRETKNKDPQ
>TDEL0B02210
------------MRLGTIAKE--KFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYF
TSNYKSLRSERLYVAAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANW
VDSSSVLQKFLSSSALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPL-SSNMAL
PASLESEGMLTDPVLNGTSYLMSMSLPI---YANPSIILTESRVYGYVTIIMSADSLKSV
YDDRTALEKSSVTIVSAIYKKDQ-GLGSYRFVFAP-YGTTPGILDETWPINNNSFLSAAL
RQGKAGSEQRTDLFYN--------RPSAVGYSPCSFKFVNWVAIISQSEAVFMEPSTRLT
KIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEIITEGRGLRS--GTP--GSSSVS
RNSSFIRRRFSG---SSSVR----------------------------------------
-------------SPSLADEKGAVGRASTEGSFN-------------YDQAVPS------
------LNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQH
YALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDI
DKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAK
DQRVKFSITLFP-NQIRKMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVSVRMRLLGEY
DKQRSENEDFKAVYVIDGTE----------PREDGLI-------------PPPVKQFEKQ
----EDLEKEKISEKHNEEE---ASTSDSEKTNL-----------------DD-----KT
PDSKRSDADDQV----SLISISTSS-YDDTIFHTQFKKHTSSSGDEN------GHLLEHP
KNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM
KLDSKLGVGSKFTFTLPLTQTREIEFED-ENA---FEDEFNPLSKKNRKVKFK-V--A--
-----KSIKSRKSKSSLSNSSGKG------------------------------------
--------------------GSSDKSSKQLKGSESEFSVGN-----VSLDRPFLQSTGTA
-SSSKNVTVVS-------------------NVNK--------------------------
--SYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQE-----KGEHYE
LIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKR
PKLKTIIAQYCHDDSKVVDKE---------------------------------------
-------------