MUSCLE (3.8) multiple sequence alignment

KNAG0C06580              -----------------MQI----------------------------------------
KLTH0E01078g             -----------------MQI----------------------------------------
Kwal_YGOB_Anc_5.701      -----------------MQI----------------------------------------
Kpol_1043.69             -----------------MQI----------------------------------------
SAKL0E14894g             -----------------MQI----------------------------------------
Ecym_4019                -----------------MQI----------------------------------------
AFR285C                  -----------------MQI----------------------------------------
KNAG0L02120              -----------------MQI----------------------------------------
ZYRO0G06622g             -----------------MQI----------------------------------------
KLLA0A00616g             -----------------MQI----------------------------------------
TPHA0D04600              -----------------MQI----------------------------------------
TPHA0E00240              -----------------MQI----------------------------------------
TBLA0E02110              -----------------MQI----------------------------------------
CAGL0G02475g             -----------------MQI----------------------------------------
NDAI0F00300              MLLILYQKALRNYLIFFHQVRTFNHVGPVLVRNLKLEINLCTCLLTNCCACFLLLHIHIK
Suva_9.40                ------MKFLLTFIILFFNIISFDS-----------------------------------
Skud_9.20                ------------------------------------------------------------
Smik_11.357              ------------------------------------------------------------
Smik_9.21                ------------------------------------------------------------
KAFR0D02230              -----------------MQI----------------------------------------
KAFR0H00220              -----------------MQI----------------------------------------
Suva_11.330              -----------------MQI----------------------------------------
Skud_11.333              -----------------MQI----------------------------------------
YIL148W                  -----------------MQI----------------------------------------
YKR094C                  -----------------MQI----------------------------------------
TDEL0B02200              -----------------MQI----------------------------------------
NDAI0E05030              -----------------MQI----------------------------------------
NCAS0A03210              -----------------MQI----------------------------------------
NCAS0G00240              -----------------MQI----------------------------------------
                                                                                     

KNAG0C06580              --FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
KLTH0E01078g             --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Kwal_YGOB_Anc_5.701      --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Kpol_1043.69             --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
SAKL0E14894g             --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Ecym_4019                --FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
AFR285C                  --FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
KNAG0L02120              --FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
ZYRO0G06622g             --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
KLLA0A00616g             --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
TPHA0D04600              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
TPHA0E00240              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
TBLA0E02110              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
CAGL0G02475g             --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
NDAI0F00300              YSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Suva_9.40                --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Skud_9.20                --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Smik_11.357              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Smik_9.21                ---VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
KAFR0D02230              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
KAFR0H00220              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Suva_11.330              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
Skud_11.333              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
YIL148W                  --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
YKR094C                  --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
TDEL0B02200              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
NDAI0E05030              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
NCAS0A03210              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
NCAS0G00240              --FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
                            ***********************:*********************************

KNAG0C06580              QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
KLTH0E01078g             QKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPKATNCRKRKCGHTNQL
Kwal_YGOB_Anc_5.701      QKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
Kpol_1043.69             QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQL
SAKL0E14894g             QKESTLHLVLRLRGGIIEPSLKALASKYNCEKAVCRKCYARLPPRATNCRKRKCGHTNQL
Ecym_4019                QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
AFR285C                  QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
KNAG0L02120              QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
ZYRO0G06622g             QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLPPRATNCRKRKCGHTNQL
KLLA0A00616g             QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
TPHA0D04600              QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
TPHA0E00240              QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
TBLA0E02110              QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
CAGL0G02475g             QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
NDAI0F00300              QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
Suva_9.40                QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
Skud_9.20                QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
Smik_11.357              QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
Smik_9.21                QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
KAFR0D02230              QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
KAFR0H00220              QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
Suva_11.330              QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
Skud_11.333              QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
YIL148W                  QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
YKR094C                  QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
TDEL0B02200              QKESTLHLVLRLRGGIIEPSLKVLASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
NDAI0E05030              QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
NCAS0A03210              QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
NCAS0G00240              QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
                         **********************.****:**:*::**:*******.***************

KNAG0C06580              RPRELKLICFWFSRRLCIPVISYVLYIC
KLTH0E01078g             RPK----------KKLK-----------
Kwal_YGOB_Anc_5.701      RPK----------KKLK-----------
Kpol_1043.69             RPK----------KKLK-----------
SAKL0E14894g             RPK----------KKLK-----------
Ecym_4019                RPK----------KKLK-----------
AFR285C                  RPK----------KKLK-----------
KNAG0L02120              RPK----------KKLK-----------
ZYRO0G06622g             RPK----------KKLK-----------
KLLA0A00616g             RPK----------KKLK-----------
TPHA0D04600              RPK----------KKLK-----------
TPHA0E00240              RPK----------KKLK-----------
TBLA0E02110              RPK----------KKLK-----------
CAGL0G02475g             RPK----------KKLK-----------
NDAI0F00300              RPK----------KKLK-----------
Suva_9.40                RPK----------KKLK-----------
Skud_9.20                RPK----------KKLK-----------
Smik_11.357              RPK----------KKLK-----------
Smik_9.21                RPK----------KKLK-----------
KAFR0D02230              RPK----------KKLK-----------
KAFR0H00220              RPK----------KKLK-----------
Suva_11.330              RPK----------KKLK-----------
Skud_11.333              RPK----------KKLK-----------
YIL148W                  RPK----------KKLK-----------
YKR094C                  RPK----------KKLK-----------
TDEL0B02200              RPK----------KKLK-----------
NDAI0E05030              RPK----------KKLK-----------
NCAS0A03210              RPK----------KKLK-----------
NCAS0G00240              RPK----------KKLK-----------
                         **.          ..*            

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0C06580
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPRELKLICFWFSRRLCIPVISYVLYIC
>KLTH0E01078g
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPKATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Kwal_YGOB_Anc_5.701
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Kpol_1043.69
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>SAKL0E14894g
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKAVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Ecym_4019
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>AFR285C
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>KNAG0L02120
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>ZYRO0G06622g
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>KLLA0A00616g
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>TPHA0D04600
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>TPHA0E00240
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>TBLA0E02110
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>CAGL0G02475g
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>NDAI0F00300
MLLILYQKALRNYLIFFHQVRTFNHVGPVLVRNLKLEINLCTCLLTNCCACFLLLHIHIK
YSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Suva_9.40
------MKFLLTFIILFFNIISFDS-----------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Skud_9.20
------------------------------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Smik_11.357
------------------------------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Smik_9.21
------------------------------------------------------------
---VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>KAFR0D02230
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>KAFR0H00220
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Suva_11.330
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>Skud_11.333
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>YIL148W
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>YKR094C
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>TDEL0B02200
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKVLASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>NDAI0E05030
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>NCAS0A03210
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------
>NCAS0G00240
-----------------MQI----------------------------------------
--FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
QKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL
RPK----------KKLK-----------