MUSCLE (3.8) multiple sequence alignment

KLLA0A00572g       -MSYDLTDPREITAFDPYEELS-DDESEIER----------------------VKRRIVE
AFR287W            MLSTTLNDPREIVPTSNYDILS-DEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQ
SAKL0E14938g       -----MEDPREPREIDIFDELS-CDEDDD------------------------LHKRLDE
KLTH0E01034g       --MGQETDPREVLQLDVHDIVT-SDEDEDTK----------------------IKQQLDE
Kwal_55.19691      ------------------------------------------------------------
TBLA0G01020        -----MNDPREVFENDLFDNIS-PDEDEELE----------------------LQKQIEL
KNAG0L02150        ----MELDPRDVITADPYDNIT-SDEDEESK----------------------IQRELEE
Kpol_1043.71       -----MNDPREHAKEDLYSNLS-SDEGEQDE----------------------ISEQLKA
TPHA0E00210        ------------------------------------------------------------
CAGL0H06589g       MVHIIDNDPREVKLLDPYTDLSEDDKEQESD----------------------IQRELEM
ZYRO0G06578g       -----MRDPREVLNNDLYDVLT-SEGEEENE----------------------IEAQIAE
TDEL0B02170        -----MNDPREVVQTDPFGELT-SDEEDQRE----------------------LEDQIVE
KAFR0D02210        -----MSDPREIAPNDLYQNIT-PDKEDARR----------------------IELELEK
NDAI0F00280        -----MNDPRECSPEDPFADLS-DKEENEDA----------------------VLEELED
NCAS0G00220        -----MNDPREVLTTDPYDNVS-SDEQDEEA----------------------ILRDLEN
Skud_9.18          -----MDDPREFLVADPYNNVT-SDEDDEQT----------------------IAKELEF
Suva_9.38          -----MDDPREILAVDPYNNVT-SDEEDEQA----------------------IAKELEF
Smik_9.19          -----MDDPREILAVDPYNSVT-SDEEDEQA----------------------IAKELEF
YIL150C            -----MNDPREILAVDPYNNIT-SDEEDEQA----------------------IARELEF
                                                                               

KLLA0A00572g       IDTEKRDLTNRLL--ELEKKRNLKDPNF-----------D-SI------DVPESPKKSDN
AFR287W            IESERSDLLARLE--ELKHRSKKKAKKS-----------P-TV------EVPRSPTKAKC
SAKL0E14938g       LEREKKDLKQRLQ--DISQRKKKIDPNF-----------S-GV------EVPRSPSKSKH
KLTH0E01034g       LERQQRDLRDRLE--QKASRKKAQRQSL-----------E-RV------EVPASPKEERK
Kwal_55.19691      ------------------------------------------------------------
TBLA0G01020        IERQKRDLQERLE--YKRKVSRAVDPNFISTEGNVDATSESRI------QVPGSPEKIKR
KNAG0L02150        MERRKKDLEKRLK--LKRAHVKPTDLNL-----------QLDV------QVPSSPQKRSV
Kpol_1043.71       IERQKQDLLERLK--KKKERKSKLDPNF--------------V------QVPSSPKKSRV
TPHA0E00210        --------MKRLK--AKKEDQKKLDPNF-----------T-DI------QIQRSPEKKK-
CAGL0H06589g       IERKKQDLISRLKENKRKLLSKQLDPNM-----------K-NINSRGRVEVPRSPKR---
ZYRO0G06578g       IERQKKDLLQRLN--VKKTNPKPLDPNL-----------S-HI------QVESSPKKVTN
TDEL0B02170        IERQKRDLVERLK--SKRQLKS-KDPNF-----------D-AI------QVESSPVKK--
KAFR0D02210        IENVKRDLLERLH--RKKIEIERRDPNF-----------T-GV------QVPASPVKKHE
NDAI0F00280        LDRRKSDLLGRLK--ELKERQKRRDPNF-----------D-EV------QIPGTPEEKNT
NCAS0G00220        VERKRQDLLNRIK--EKQESKKLLDPNF-----------Q-QL------QVPCSPVKKTE
Skud_9.18          MERKKQALVERLK--RKQEFKRAEDPNF-----------E-AI------EVPQSPAKNRN
Suva_9.38          MERKKQALMERLK--RKQDFKKPEDPNF-----------E-AV------EVPQSPAKKSI
Smik_9.19          MERKRQALMERLK--RKQAFKKPNDPNF-----------E-AI------EVPQSPTKSRV
YIL150C            MERKRQALVERLK--RKQEFKKPQDPNF-----------E-AI------EVPQSPTKNRV
                                                                               

KLLA0A00572g       ATKGIEDIKHIAPVADIEEAT---------FNVNEDYVREK--VK------KLGTTSYFT
AFR287W            VE--DEPAPSTSASTTYVEEP--------EENENERYLLSA----------NTPTTSYFA
SAKL0E14938g       V---AVKETSRSKDDRESCFPA-------HENLNELQVQKK--ASL-----SSISTPYFA
KLTH0E01034g       S---KASPQSQKSSKGITLAA--------NSNNDSIEVPWK--NG------PSNTTSYFV
Kwal_55.19691      -----------------------------------------------------------M
TBLA0G01020        ----KHTQLAATPVTKKNTGI--------QDNPNELKLKNQIEPASV----PAGSTAYFM
KNAG0L02150        SAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQL--DGDDGKQSVNATTSYFL
Kpol_1043.71       ----VELKPTSKPIDNNEEEE--------EENPNEVALMTK--DDS-----NYGTTSYFM
TPHA0E00210        ----SNPNTTVNPIPLKRLVE--------DVNPNEAKVVSN--ANL-----PANTTSYFM
CAGL0H06589g       ----ESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRK--ELD-----VVATTSYFQ
ZYRO0G06578g       ----SVLPPTVQQQEPRGEVR--------NENLNELKAQSQ--EQI-----PANTTSFFI
TDEL0B02170        ----PAESIKVEPSRTKRVLD--------IENLNEKKVESR--SQI-----PANTTSYFI
KAFR0D02210        LQLVEQKDQKLKNINRFEES---------NENPNELCLQQRFQKQTARLNDSNASTEYFM
NDAI0F00280        NIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVRER--EENLEKL-PSNTTSYFM
NCAS0G00220        ----TNVPVAMKKSTNEMEIP--------HENPNELRIREK--SGQL----PSNTTTYFM
Skud_9.18          ----IMKSQNTMKRDMRPAAS----------NINDLKLSQL--QQKQEL--PSNTTGYFM
Suva_9.38          ----VKKSQDALKQAIRPVAS--------NINESMLSQQSQ--ES------PSNTTTYFM
Smik_9.19          ----KSGSQNAVKQVTRLETS--------NANESNLSQIQK--QPEL----PINTTTYFM
YIL150C            ----KVGSHNATQQGTKFEGS--------NINEVRLSQLQQ--QPKP----PASTTTYFM
                                                                               

KLLA0A00572g       EKLRSINTNEHEAIKRKKELLAHRVYTFN-G-DMFD-----EYEPITVDEKDDLSGLVID
AFR287W            EKFARARDSSASTMRRKQELLKRRVYTFS-DRDTAI-----EYTTFAVDEVETYSNMRIN
SAKL0E14938g       QNFSSSKKAQEVESRRKMEMLNCRVHTFD-GPDFVR-----EYSPIAVNEEEEFSGKWIS
KLTH0E01034g       ENFVNARKVEEQKIQHRSSLLSCRVHTFK-GIDSLK-----GSQPVNVDEKELYSGFNIS
Kwal_55.19691      ENFANSRKAEESRIKHRGEMLDSRVHTFR-GLKATK-----SRKPIAVEEKEPASGLWVS
TBLA0G01020        NNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQK-----ESQIINVEEKEKYSGLWIS
KNAG0L02150        EKFQQSKKTEKLEIEAQETMLSARVHTFQ-GVDK-------EFQLEAVNELEQFSDLWIS
Kpol_1043.71       EKFYNSKKDHERKVVAYSSMMSSRVHTFS-GTGSKK-----EFKPTDVDELDQYSNLWLR
TPHA0E00210        QNFLKAKKEETKQVKEYQQKMSSRVHSFA-GANLSK-----KYQSIIVEELEEYSRFNIS
CAGL0H06589g       NKFKNSKTDENRMVTAYQQMMSARTHTFN-GSTSLS-----DNKTIQCDELEPYSNFHIK
ZYRO0G06578g       EKYSTSKRKQDYEVRAQEDLLSNRVHTFQ-GARRQD-----EYKPIPTNELEEFSNLWIS
TDEL0B02170        DNFRNSKKEEQKSQQERQELLSKRVHTFR-GIDGNH-----KFKAVAVEEVEEYSDLWVK
KAFR0D02210        EKFRDAKRKEKVHIEKHESMMKSRVHTFN-GIEPKN-----EYQHVIVDELEQYSNLWIN
NDAI0F00280        EKFQHVKKKEEIENVRNEKMLKARVHMFQ-GLNKSSKIHKIEYQPEAANEVEEYSMLRIQ
NCAS0G00220        EKFQKSKKEEEGKIQKMENMMNARVHTFQ-DQGGKQ-----EFKPIQVNEIEEYSNIWLK
Skud_9.18          QKFQNAKRNEEKQRAKYENMMNARVHTF--GTDKK------EYRATIANELEEFSNIWVK
Suva_9.38          QKFQDAKRNEDKQIAKYEGMMNARVHTF--GTDNK------EYKPIITNELESFSNLWVK
Smik_9.19          QKFQNAKKDEDRQIAKFESMMDARVHTF--GTDNK------KYKPIIANELEGFSNLWVK
YIL150C            EKFQNAKKNEDKQIAKFESMMNARVHTF--STDEK------KYVPIITNELESFSNLWVK
                   ::    .             :  *.: *                    :* :  *   : 

KLLA0A00572g       RRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVK
AFR287W            KRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEK
SAKL0E14938g       KRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTK
KLTH0E01034g       RRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSK
Kwal_55.19691      RRYIASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSK
TBLA0G01020        RRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNT
KNAG0L02150        KRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKN
Kpol_1043.71       SRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSK
TPHA0E00210        KRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKT
CAGL0H06589g       KRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAAK
ZYRO0G06578g       KRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAAS
TDEL0B02170        QRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGK
KAFR0D02210        KRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNK
NDAI0F00280        KRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGSIKFTSSDK
NCAS0G00220        KRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDK
Skud_9.18          KRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDK
Suva_9.38          KRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEK
Smik_9.19          KRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEK
YIL150C            KRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEK
                    **             *:*** ***:*:..*.*  * *.**   . :  *   . :   .

KLLA0A00572g       PVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGA----S
AFR287W            PAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETAR
SAKL0E14938g       PSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQ
KLTH0E01034g       PSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSG
Kwal_55.19691      PTKYFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSG
TBLA0G01020        PRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE--E----N
KNAG0L02150        PQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ---T
Kpol_1043.71       PTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE--NSGGSG
TPHA0E00210        PVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEF--K----G
CAGL0H06589g       PVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSG--C----V
ZYRO0G06578g       PKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG--T----K
TDEL0B02170        PMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE--K----G
KAFR0D02210        PQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSG--K----Q
NDAI0F00280        PKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSNNKN----G
NCAS0G00220        PKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSG--K----G
Skud_9.18          PAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG--Q----G
Suva_9.38          PVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG--R----G
Smik_9.19          PVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG--R----G
YIL150C            PVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG--R----G
                   * .:: : : :*   :.  .*.   : .**:*. **:: :**. : * .           

KLLA0A00572g       PSYATFSLKVSKDTNNILELGHSKEFGLCQFYMK-NKGKLCGAPINKLHDNYCAYHKEAK
AFR287W            TTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNK-TKGAPCGAPINKLKEQVCSYHQETH
SAKL0E14938g       AVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNK-LQGKTCGTPINKSVEDRCYYHQEVQ
KLTH0E01034g       PVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNK-ATRKACGAPINRAATDRCEYHQDVR
Kwal_55.19691      ASVKSFNLSIRGNYDCVLEIGTSRDLGFCQIYNK-AKGKVCGAPINRAAVDRCDYHQEIR
TBLA0G01020        GYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETE
KNAG0L02150        TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKK-FSNEKCGSAINLARDRTCEYHRELQ
Kpol_1043.71       STIKSFNLRISHKFDCILEIGASRDLGWCPIPNA-SKNTLCKTPINKSKEDKCQYHREIQ
TPHA0E00210        NSIKSFNLRISHKFDCILEIARSKDIAWCQQINR-KTGAKCNTPINKSKQDVCDYHKEMQ
CAGL0H06589g       NGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNH-GQSKICNSPINTKTDRCCEFHRELQ
ZYRO0G06578g       AHIKSFNLRISHKFECILEIGASRDLGWCPMFNK-SKNEICRAPINKDKEDCCEYHRELK
TDEL0B02170        NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNK-SQNKACGTPINKTKEKCCDFHREIQ
KAFR0D02210        NYIKSFNLRISHPYKCILEIGKSRDLARCPIVVR-STSKECGVPINKKVDRCCEYHREME
NDAI0F00280        TGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYHQEIR
NCAS0G00220        QFIKSFNLRINHDFKCILEIGSSKDLGFCKVTSR--NGTLCNTPINMSKEDRCDYHQEIR
Skud_9.18          NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNR-KKNENCGSPINIALHKCCDYHREVQ
Suva_9.38          NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNK-KTHKSCGSPINTNVHMCCDYHREVQ
Smik_9.19          NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNT-KTHKKCGSPINISLHKCCDYHREVQ
YIL150C            NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNK-KTHKKCGSPINISLHKCCDYHREVQ
                       :*.* :      ::*:. *.::  *           *  .*:      * :*.:  

KLLA0A00572g       MRQNSSRRVEISSSVAMRAPVVKGYQQTIVKS------QHNNGK---TSIRYQQNPDKPF
AFR287W            LRSVNAKRVELNGNISLRAPTRDGIQQAGYMT------RNS------HGTKIGLLPDVYA
SAKL0E14938g       FRQVNAKRLELNGNKSLRSPTKNGVKHILYGK------N--------KSGKYDLLPDRYA
KLTH0E01034g       FRHVNAQRVELNGSTSLRSPVKNGKKQALYGT------SG-------VKRKLQLLPDKHA
Kwal_55.19691      FRQVNAQRVELNGSMSLRSPVKNGKKQALYGS------SG-------VKRKLNLLPDKHA
TBLA0G01020        FRNAAAKRIELNGSFALGAPTKADTNPSLYKK------KTNNIY---SKNQFNVVRRRNA
KNAG0L02150        MRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNS
Kpol_1043.71       FRKTTSNRVELSGTYALGAPTKVDARPALYQN------RGTSNNSR-VQKSYNMVSDSHY
TPHA0E00210        FRSANAKRVELSGTYALGAPTQIDSRPALYRS------KNTSNLK--PGNNFNIVADRRY
CAGL0H06589g       MRSTASKRIELSGSYALGAPTKVGTQPSIYKD------NNKSRNTNPAKHKMFSITGHGS
ZYRO0G06578g       FRSTNAKRVELSGTYALGAPTRIDAQPALYRG------GSSQ-----KNLNYNIITNGAD
TDEL0B02170        FRSNHAKRIELNGSFALGAPTKVDSGPALYRE------KSAG-----AHRNFKVLPNHYQ
KAFR0D02210        IRKGPSKRLDLSGQYALGAPTKLESQPALYRG------HTAQNV---KIQNFKLTPSYSQ
NDAI0F00280        FRNNGSKRIELNGSFALGAPVKVGAQPQLYRN------NNVPVRGVYHGNRFNVVKGSEI
NCAS0G00220        FRDNNSKRIELNGSFALGAPTKVENNPTLYRK-----KNGETRHSRKNRQNFSVSASFGS
Skud_9.18          FRGTSAKRIELNGGYALGAPTKVDAQPTLYRA------KG--------ENNFNLVRSIRK
Suva_9.38          FRGTGAKRIELNGGYALGAPTKVDSQPSLYRA------KG--------ENQFNIVRSTRK
Smik_9.19          FRGTSAKRIELNGGYALGAPTKVNSQPSLYKA------KG--------ENRFNIIRDARK
YIL150C            FRGTSAKRIELNGGYALGAPTKVDSQPSLYKA------KG--------ENGFNIIKGTRK
                   :*   :.*:::..  :: :*.                                       

KLLA0A00572g       VR-----EPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEK
AFR287W            PR-----APGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINK
SAKL0E14938g       PQ-----TQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQK
KLTH0E01034g       PQ-----AQDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQN
Kwal_55.19691      PQ-----QQDRESQNTLYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQV
TBLA0G01020        R------KEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIK
KNAG0L02150        RHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR
Kpol_1043.71       QKRK---DSNKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVK
TPHA0E00210        MKKK---ENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQR
CAGL0H06589g       KKEQ---EKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLK
ZYRO0G06578g       GGSNK--EINPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNR
TDEL0B02170        KS-----VGKNSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQ
KAFR0D02210        NNPH---LIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNR
NDAI0F00280        RKNE---SKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQ
NCAS0G00220        I------NKDQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDK
Skud_9.18          TLSE---EEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSR
Suva_9.38          GLSE---EEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSR
Smik_9.19          GLSE---EEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNR
YIL150C            RLSE---EEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSR
                                     * . .   *:*:. : :*. : **: ****         :  

KLLA0A00572g       KLKGLS------DKLLSKKEDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEY
AFR287W            QLSLVLGKN---HTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMA-AVLYQ
SAKL0E14938g       QLQQVIGKSN--SNLF-KNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMS-SVLKN
KLTH0E01034g       QLNSAIGKTG--YQSF-NNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMR-EVLKF
Kwal_55.19691      QLSRALGKDG--QQRF-SEKTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMR-DVLKV
TBLA0G01020        ELNKTLTKEDNVSKNL-EGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMK-YLMKK
KNAG0L02150        KLKRLLSKDE--DRAT-LDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAA-SVMKK
Kpol_1043.71       ALKNTV------------DKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLS-SVIRN
TPHA0E00210        ALRESVGN----SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIK-VVLEK
CAGL0H06589g       ALNGE------------DASQSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIA-KVLDK
ZYRO0G06578g       ELKKNS------ELDI-KHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIA-SVFKH
TDEL0B02170        QLKRINSR----HAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIG-NVLKQ
KAFR0D02210        ELDRLLRK----DQDL-EGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKIS-RILKN
NDAI0F00280        ELSKAIENKS--SNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIA-KVLQT
NCAS0G00220        ELSKAIGNRA--SDDL-GERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIA-NVLRT
Skud_9.18          ELGKIMRRKG--SSGL-EDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKIS-KVLKS
Suva_9.38          ELGKIMRRKD--SSGL-EDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKIS-KVLKS
Smik_9.19          ELAKIMRRKE--SSGL-EDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEIS-KVLKS
YIL150C            ELGKIMRRRE--SSGL-EDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKIS-QVLKS
                    *                     .       *   :  *. . :*:**  *     ::  

KLLA0A00572g       S-------TENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGS
AFR287W            --------GDHGPADTVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEE
SAKL0E14938g       --------NSKGLKEQAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKKE
KLTH0E01034g       GKN-----VNSGL--NSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTE
Kwal_55.19691      GKN-----SKNST--DTKSIQVREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETK
TBLA0G01020        SNG-----KDPSY-TSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQ
KNAG0L02150        RDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK
Kpol_1043.71       SNSETE--VTNKY-QMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQ
TPHA0E00210        SADKS---TQSKL-QKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSI
CAGL0H06589g       SRGTK---TDDPT-ISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDT
ZYRO0G06578g       QRSD----SDKKP-LTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSG
TDEL0B02170        AAKDK---SNNGQ-LNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDK
KAFR0D02210        KERSKD--GEPKF-LSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQN
NDAI0F00280        GKDS----GKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSG
NCAS0G00220        THSKEEKDTLSEQ-MSGKKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQK
Skud_9.18          SVPGGE--PRNKV-MGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK
Suva_9.38          SVPGGE--SMPNR-INGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSK
Smik_9.19          SVPGGE--SKNNL-LNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPK
YIL150C            SVSGSE--PKNNL-LGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK
                                    .   : .:   ..    * *       .   *   :       

KLLA0A00572g       QERLDKDE-----------GSSDDLEII------------
AFR287W            AVATPQGSCETAQLSSAD-SSDEELEIVN-----------
SAKL0E14938g       ENPNPGVESS---------DGDSELEIV------------
KLTH0E01034g       KLANQKQKKTPSSE-----SSDSDLEIV------------
Kwal_55.19691      TDPTANNQIPSD-------SSDSDLEIV------------
TBLA0G01020        SKSNRDIILSS--------GDDSDLEIV------------
KNAG0L02150        GTPVDSQPVDN--------DDSDDLEIV------------
Kpol_1043.71       QSSIDNND-----------DSGSDLKILHNSSTKDQKYQL
TPHA0E00210        IAAENRDRKSASTKND---TDSDDLEII------------
CAGL0H06589g       N------------------DSDSDLEIV------------
ZYRO0G06578g       GDEKD--------------DSDSDLEIVS-----------
TDEL0B02170        SVNLSS-------------DSDSDIEIV------------
KAFR0D02210        KSNDNS-------------ESDSDLEIV------------
NDAI0F00280        KRLAEQPLNDDVD------TSESDLEIV------------
NCAS0G00220        RKPISANDLLAIEGSSSDSSSDSELEII------------
Skud_9.18          DTDEVSD------------ASTSDLEIV------------
Suva_9.38          ETEVASD------------ASGSDLEIV------------
Smik_9.19          GEAEEASD-----------ASASDLEII------------
YIL150C            ETKETSD------------GSASDLEII------------
                                       . .:::*:            

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0A00572g
-MSYDLTDPREITAFDPYEELS-DDESEIER----------------------VKRRIVE
IDTEKRDLTNRLL--ELEKKRNLKDPNF-----------D-SI------DVPESPKKSDN
ATKGIEDIKHIAPVADIEEAT---------FNVNEDYVREK--VK------KLGTTSYFT
EKLRSINTNEHEAIKRKKELLAHRVYTFN-G-DMFD-----EYEPITVDEKDDLSGLVID
RRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVK
PVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGA----S
PSYATFSLKVSKDTNNILELGHSKEFGLCQFYMK-NKGKLCGAPINKLHDNYCAYHKEAK
MRQNSSRRVEISSSVAMRAPVVKGYQQTIVKS------QHNNGK---TSIRYQQNPDKPF
VR-----EPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEK
KLKGLS------DKLLSKKEDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEY
S-------TENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGS
QERLDKDE-----------GSSDDLEII------------
>AFR287W
MLSTTLNDPREIVPTSNYDILS-DEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQ
IESERSDLLARLE--ELKHRSKKKAKKS-----------P-TV------EVPRSPTKAKC
VE--DEPAPSTSASTTYVEEP--------EENENERYLLSA----------NTPTTSYFA
EKFARARDSSASTMRRKQELLKRRVYTFS-DRDTAI-----EYTTFAVDEVETYSNMRIN
KRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEK
PAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETAR
TTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNK-TKGAPCGAPINKLKEQVCSYHQETH
LRSVNAKRVELNGNISLRAPTRDGIQQAGYMT------RNS------HGTKIGLLPDVYA
PR-----APGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINK
QLSLVLGKN---HTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMA-AVLYQ
--------GDHGPADTVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEE
AVATPQGSCETAQLSSAD-SSDEELEIVN-----------
>SAKL0E14938g
-----MEDPREPREIDIFDELS-CDEDDD------------------------LHKRLDE
LEREKKDLKQRLQ--DISQRKKKIDPNF-----------S-GV------EVPRSPSKSKH
V---AVKETSRSKDDRESCFPA-------HENLNELQVQKK--ASL-----SSISTPYFA
QNFSSSKKAQEVESRRKMEMLNCRVHTFD-GPDFVR-----EYSPIAVNEEEEFSGKWIS
KRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTK
PSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQ
AVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNK-LQGKTCGTPINKSVEDRCYYHQEVQ
FRQVNAKRLELNGNKSLRSPTKNGVKHILYGK------N--------KSGKYDLLPDRYA
PQ-----TQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQK
QLQQVIGKSN--SNLF-KNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMS-SVLKN
--------NSKGLKEQAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKKE
ENPNPGVESS---------DGDSELEIV------------
>KLTH0E01034g
--MGQETDPREVLQLDVHDIVT-SDEDEDTK----------------------IKQQLDE
LERQQRDLRDRLE--QKASRKKAQRQSL-----------E-RV------EVPASPKEERK
S---KASPQSQKSSKGITLAA--------NSNNDSIEVPWK--NG------PSNTTSYFV
ENFVNARKVEEQKIQHRSSLLSCRVHTFK-GIDSLK-----GSQPVNVDEKELYSGFNIS
RRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSK
PSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSG
PVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNK-ATRKACGAPINRAATDRCEYHQDVR
FRHVNAQRVELNGSTSLRSPVKNGKKQALYGT------SG-------VKRKLQLLPDKHA
PQ-----AQDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQN
QLNSAIGKTG--YQSF-NNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMR-EVLKF
GKN-----VNSGL--NSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTE
KLANQKQKKTPSSE-----SSDSDLEIV------------
>Kwal_55.19691
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
ENFANSRKAEESRIKHRGEMLDSRVHTFR-GLKATK-----SRKPIAVEEKEPASGLWVS
RRYIASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSK
PTKYFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSG
ASVKSFNLSIRGNYDCVLEIGTSRDLGFCQIYNK-AKGKVCGAPINRAAVDRCDYHQEIR
FRQVNAQRVELNGSMSLRSPVKNGKKQALYGS------SG-------VKRKLNLLPDKHA
PQ-----QQDRESQNTLYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQV
QLSRALGKDG--QQRF-SEKTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMR-DVLKV
GKN-----SKNST--DTKSIQVREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETK
TDPTANNQIPSD-------SSDSDLEIV------------
>TBLA0G01020
-----MNDPREVFENDLFDNIS-PDEDEELE----------------------LQKQIEL
IERQKRDLQERLE--YKRKVSRAVDPNFISTEGNVDATSESRI------QVPGSPEKIKR
----KHTQLAATPVTKKNTGI--------QDNPNELKLKNQIEPASV----PAGSTAYFM
NNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQK-----ESQIINVEEKEKYSGLWIS
RRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNT
PRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE--E----N
GYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETE
FRNAAAKRIELNGSFALGAPTKADTNPSLYKK------KTNNIY---SKNQFNVVRRRNA
R------KEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIK
ELNKTLTKEDNVSKNL-EGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMK-YLMKK
SNG-----KDPSY-TSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQ
SKSNRDIILSS--------GDDSDLEIV------------
>KNAG0L02150
----MELDPRDVITADPYDNIT-SDEDEESK----------------------IQRELEE
MERRKKDLEKRLK--LKRAHVKPTDLNL-----------QLDV------QVPSSPQKRSV
SAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQL--DGDDGKQSVNATTSYFL
EKFQQSKKTEKLEIEAQETMLSARVHTFQ-GVDK-------EFQLEAVNELEQFSDLWIS
KRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKN
PQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ---T
TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKK-FSNEKCGSAINLARDRTCEYHRELQ
MRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNS
RHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR
KLKRLLSKDE--DRAT-LDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAA-SVMKK
RDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK
GTPVDSQPVDN--------DDSDDLEIV------------
>Kpol_1043.71
-----MNDPREHAKEDLYSNLS-SDEGEQDE----------------------ISEQLKA
IERQKQDLLERLK--KKKERKSKLDPNF--------------V------QVPSSPKKSRV
----VELKPTSKPIDNNEEEE--------EENPNEVALMTK--DDS-----NYGTTSYFM
EKFYNSKKDHERKVVAYSSMMSSRVHTFS-GTGSKK-----EFKPTDVDELDQYSNLWLR
SRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSK
PTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE--NSGGSG
STIKSFNLRISHKFDCILEIGASRDLGWCPIPNA-SKNTLCKTPINKSKEDKCQYHREIQ
FRKTTSNRVELSGTYALGAPTKVDARPALYQN------RGTSNNSR-VQKSYNMVSDSHY
QKRK---DSNKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVK
ALKNTV------------DKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLS-SVIRN
SNSETE--VTNKY-QMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQ
QSSIDNND-----------DSGSDLKILHNSSTKDQKYQL
>TPHA0E00210
------------------------------------------------------------
--------MKRLK--AKKEDQKKLDPNF-----------T-DI------QIQRSPEKKK-
----SNPNTTVNPIPLKRLVE--------DVNPNEAKVVSN--ANL-----PANTTSYFM
QNFLKAKKEETKQVKEYQQKMSSRVHSFA-GANLSK-----KYQSIIVEELEEYSRFNIS
KRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKT
PVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEF--K----G
NSIKSFNLRISHKFDCILEIARSKDIAWCQQINR-KTGAKCNTPINKSKQDVCDYHKEMQ
FRSANAKRVELSGTYALGAPTQIDSRPALYRS------KNTSNLK--PGNNFNIVADRRY
MKKK---ENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQR
ALRESVGN----SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIK-VVLEK
SADKS---TQSKL-QKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSI
IAAENRDRKSASTKND---TDSDDLEII------------
>CAGL0H06589g
MVHIIDNDPREVKLLDPYTDLSEDDKEQESD----------------------IQRELEM
IERKKQDLISRLKENKRKLLSKQLDPNM-----------K-NINSRGRVEVPRSPKR---
----ESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRK--ELD-----VVATTSYFQ
NKFKNSKTDENRMVTAYQQMMSARTHTFN-GSTSLS-----DNKTIQCDELEPYSNFHIK
KRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAAK
PVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSG--C----V
NGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNH-GQSKICNSPINTKTDRCCEFHRELQ
MRSTASKRIELSGSYALGAPTKVGTQPSIYKD------NNKSRNTNPAKHKMFSITGHGS
KKEQ---EKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLK
ALNGE------------DASQSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIA-KVLDK
SRGTK---TDDPT-ISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDT
N------------------DSDSDLEIV------------
>ZYRO0G06578g
-----MRDPREVLNNDLYDVLT-SEGEEENE----------------------IEAQIAE
IERQKKDLLQRLN--VKKTNPKPLDPNL-----------S-HI------QVESSPKKVTN
----SVLPPTVQQQEPRGEVR--------NENLNELKAQSQ--EQI-----PANTTSFFI
EKYSTSKRKQDYEVRAQEDLLSNRVHTFQ-GARRQD-----EYKPIPTNELEEFSNLWIS
KRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAAS
PKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG--T----K
AHIKSFNLRISHKFECILEIGASRDLGWCPMFNK-SKNEICRAPINKDKEDCCEYHRELK
FRSTNAKRVELSGTYALGAPTRIDAQPALYRG------GSSQ-----KNLNYNIITNGAD
GGSNK--EINPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNR
ELKKNS------ELDI-KHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIA-SVFKH
QRSD----SDKKP-LTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSG
GDEKD--------------DSDSDLEIVS-----------
>TDEL0B02170
-----MNDPREVVQTDPFGELT-SDEEDQRE----------------------LEDQIVE
IERQKRDLVERLK--SKRQLKS-KDPNF-----------D-AI------QVESSPVKK--
----PAESIKVEPSRTKRVLD--------IENLNEKKVESR--SQI-----PANTTSYFI
DNFRNSKKEEQKSQQERQELLSKRVHTFR-GIDGNH-----KFKAVAVEEVEEYSDLWVK
QRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGK
PMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE--K----G
NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNK-SQNKACGTPINKTKEKCCDFHREIQ
FRSNHAKRIELNGSFALGAPTKVDSGPALYRE------KSAG-----AHRNFKVLPNHYQ
KS-----VGKNSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQ
QLKRINSR----HAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIG-NVLKQ
AAKDK---SNNGQ-LNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDK
SVNLSS-------------DSDSDIEIV------------
>KAFR0D02210
-----MSDPREIAPNDLYQNIT-PDKEDARR----------------------IELELEK
IENVKRDLLERLH--RKKIEIERRDPNF-----------T-GV------QVPASPVKKHE
LQLVEQKDQKLKNINRFEES---------NENPNELCLQQRFQKQTARLNDSNASTEYFM
EKFRDAKRKEKVHIEKHESMMKSRVHTFN-GIEPKN-----EYQHVIVDELEQYSNLWIN
KRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNK
PQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSG--K----Q
NYIKSFNLRISHPYKCILEIGKSRDLARCPIVVR-STSKECGVPINKKVDRCCEYHREME
IRKGPSKRLDLSGQYALGAPTKLESQPALYRG------HTAQNV---KIQNFKLTPSYSQ
NNPH---LIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNR
ELDRLLRK----DQDL-EGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKIS-RILKN
KERSKD--GEPKF-LSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQN
KSNDNS-------------ESDSDLEIV------------
>NDAI0F00280
-----MNDPRECSPEDPFADLS-DKEENEDA----------------------VLEELED
LDRRKSDLLGRLK--ELKERQKRRDPNF-----------D-EV------QIPGTPEEKNT
NIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVRER--EENLEKL-PSNTTSYFM
EKFQHVKKKEEIENVRNEKMLKARVHMFQ-GLNKSSKIHKIEYQPEAANEVEEYSMLRIQ
KRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGSIKFTSSDK
PKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSNNKN----G
TGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYHQEIR
FRNNGSKRIELNGSFALGAPVKVGAQPQLYRN------NNVPVRGVYHGNRFNVVKGSEI
RKNE---SKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQ
ELSKAIENKS--SNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIA-KVLQT
GKDS----GKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSG
KRLAEQPLNDDVD------TSESDLEIV------------
>NCAS0G00220
-----MNDPREVLTTDPYDNVS-SDEQDEEA----------------------ILRDLEN
VERKRQDLLNRIK--EKQESKKLLDPNF-----------Q-QL------QVPCSPVKKTE
----TNVPVAMKKSTNEMEIP--------HENPNELRIREK--SGQL----PSNTTTYFM
EKFQKSKKEEEGKIQKMENMMNARVHTFQ-DQGGKQ-----EFKPIQVNEIEEYSNIWLK
KRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDK
PKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSG--K----G
QFIKSFNLRINHDFKCILEIGSSKDLGFCKVTSR--NGTLCNTPINMSKEDRCDYHQEIR
FRDNNSKRIELNGSFALGAPTKVENNPTLYRK-----KNGETRHSRKNRQNFSVSASFGS
I------NKDQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDK
ELSKAIGNRA--SDDL-GERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIA-NVLRT
THSKEEKDTLSEQ-MSGKKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQK
RKPISANDLLAIEGSSSDSSSDSELEII------------
>Skud_9.18
-----MDDPREFLVADPYNNVT-SDEDDEQT----------------------IAKELEF
MERKKQALVERLK--RKQEFKRAEDPNF-----------E-AI------EVPQSPAKNRN
----IMKSQNTMKRDMRPAAS----------NINDLKLSQL--QQKQEL--PSNTTGYFM
QKFQNAKRNEEKQRAKYENMMNARVHTF--GTDKK------EYRATIANELEEFSNIWVK
KRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDK
PAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG--Q----G
NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNR-KKNENCGSPINIALHKCCDYHREVQ
FRGTSAKRIELNGGYALGAPTKVDAQPTLYRA------KG--------ENNFNLVRSIRK
TLSE---EEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSR
ELGKIMRRKG--SSGL-EDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKIS-KVLKS
SVPGGE--PRNKV-MGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK
DTDEVSD------------ASTSDLEIV------------
>Suva_9.38
-----MDDPREILAVDPYNNVT-SDEEDEQA----------------------IAKELEF
MERKKQALMERLK--RKQDFKKPEDPNF-----------E-AV------EVPQSPAKKSI
----VKKSQDALKQAIRPVAS--------NINESMLSQQSQ--ES------PSNTTTYFM
QKFQDAKRNEDKQIAKYEGMMNARVHTF--GTDNK------EYKPIITNELESFSNLWVK
KRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEK
PVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG--R----G
NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNK-KTHKSCGSPINTNVHMCCDYHREVQ
FRGTGAKRIELNGGYALGAPTKVDSQPSLYRA------KG--------ENQFNIVRSTRK
GLSE---EEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSR
ELGKIMRRKD--SSGL-EDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKIS-KVLKS
SVPGGE--SMPNR-INGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSK
ETEVASD------------ASGSDLEIV------------
>Smik_9.19
-----MDDPREILAVDPYNSVT-SDEEDEQA----------------------IAKELEF
MERKRQALMERLK--RKQAFKKPNDPNF-----------E-AI------EVPQSPTKSRV
----KSGSQNAVKQVTRLETS--------NANESNLSQIQK--QPEL----PINTTTYFM
QKFQNAKKDEDRQIAKFESMMDARVHTF--GTDNK------KYKPIIANELEGFSNLWVK
KRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEK
PVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG--R----G
NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNT-KTHKKCGSPINISLHKCCDYHREVQ
FRGTSAKRIELNGGYALGAPTKVNSQPSLYKA------KG--------ENRFNIIRDARK
GLSE---EEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNR
ELAKIMRRKE--SSGL-EDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEIS-KVLKS
SVPGGE--SKNNL-LNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPK
GEAEEASD-----------ASASDLEII------------
>YIL150C
-----MNDPREILAVDPYNNIT-SDEEDEQA----------------------IARELEF
MERKRQALVERLK--RKQEFKKPQDPNF-----------E-AI------EVPQSPTKNRV
----KVGSHNATQQGTKFEGS--------NINEVRLSQLQQ--QPKP----PASTTTYFM
EKFQNAKKNEDKQIAKFESMMNARVHTF--STDEK------KYVPIITNELESFSNLWVK
KRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEK
PVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG--R----G
NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNK-KTHKKCGSPINISLHKCCDYHREVQ
FRGTSAKRIELNGGYALGAPTKVDSQPSLYKA------KG--------ENGFNIIKGTRK
RLSE---EEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSR
ELGKIMRRRE--SSGL-EDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKIS-QVLKS
SVSGSE--PKNNL-LGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK
ETKETSD------------GSASDLEII------------