MUSCLE (3.8) multiple sequence alignment

TPHA0D04640        -------------------------MSAYTGNMNKDNKRILQSI----------------
CAGL0H06611g       -MGSSPIEHSIKGKHVYDRKSKLTDNNFNSNNFINNNNSIPGFTQGLH------------
TBLA0E01710        -------------------MFKSIFPNDQSVNVNLFHNNHNNS-----------------
Suva_9.37          -------MVDI--------MAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLH----
Skud_9.17          -------MVDP--------MAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLH----
Smik_9.18          -------MVDL--------MVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLH----
YIL151C            -------MVDL--------MVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLH----
CAGL0G02541g       -------MPQTFIQQ----PFGLPDSDTGLSRNNSNSPSARDILLEKNVTNE--------
TPHA0E00190        MTLHLHNTIDLNFQTGHSTHLLVAKNYNTDKAMMQNNTSVEHDNVG--------------
Kpol_1043.73       ---MSIPLPNLNLRRDEGQDLSASQSNEQISLNIRNERLRKNNIQDLRDQTKQMNLQSTN
Suva_11.333        -------MPEISVQN----PLRLSENGNARSMFLSASQP---------------------
Skud_11.336        -------MPEASVQN----PLRLSENGNTRSMFLSASQP---------------------
Smik_11.360        -------MPKTSVQN----PIRLSENENTRSIFLSISQP---------------------
YKR096W            -------MPETSVQN----PLRLSENENTRSMFLSASQQ---------------------
ZYRO0B16412g       -------MIETFNHAKRRQTDKNTNDSSMIGMTPSFTNEINNSTGGVGDASAAAQSVFGT
TDEL0B02140        -------MIETFNHT----SDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGR----
KNAG0C06630        -------MPQLLAAQLI--PNNSTGNNNNSNSNVRNNGSASGFVHQQNNSVIFPRDSKKT
KAFR0H00180        -------MPQISIQT----PFDIITNSFTAMHSSETQDNNNNIDIFRPISPSAALR----
NDAI0E05070        -------MPQASSST----LRNLVRLPPTNTATATATATNTTTVDPAYNNENNNNNNF--
NCAS0A03170        -------MPQLATHN----FIQLSNNPNSESNLPSPNPIIQLGMDSNNNTNNESNNAFIQ
KLLA0A00528g       ------------------------MDPGSASMAGHSGLH---------------------
AFR290W            --------------------MQVNEVAMEESGTRMDTAL---------------------
Ecym_4015          -----------------------MEDPSTTSLQSQLH-----------------------
SAKL0E15004g       -------M-----------GDTTTTDYSTVAFTSPANSRIQMASHPTLH-----------
KLTH0E00968g       -------------------MEFMRDIPTGISGVNVEASPAQ-------------------
Kwal_55.19678      -------------------MEVMRDIPTETSGSVFGANTVQ-------------------
                                                                               

TPHA0D04640        -----------------------------------------------DEPWFSLKFRKVS
CAGL0H06611g       -----------------------------------------------QKRHNSSANNHTR
TBLA0E01710        -----------------------------------------------ITKATTTKNNFLN
Suva_9.37          -----------------------------------------------QKRHSSSSHNDTP
Skud_9.17          -----------------------------------------------QKRHSSSSHNDTP
Smik_9.18          -----------------------------------------------QKRHSSSSHNDTP
YIL151C            -----------------------------------------------QKRHSSSSHNDTP
CAGL0G02541g       -----------------------------------------------QRYPRKDGYNYSH
TPHA0E00190        -----------------------------------------------QKRHGSNSYKYLQ
Kpol_1043.73       QNTKNLG----------------------------------------QKRHGSSSYYITP
Suva_11.333        -----------------------------------------------QRPSTASSFPMSV
Skud_11.336        -----------------------------------------------QRP----PFPMSV
Smik_11.360        -----------------------------------------------QRPSNISSFPRLV
YKR096W            -----------------------------------------------QRPSATPSFPRLV
ZYRO0B16412g       ITGDLTREDSDNNNSNNNGEMNNSNNMSSSINPNVNPSINASNINPRLKRSSSNTYNYVS
TDEL0B02140        -----------------------------------------------QKRHSSNPYNSAE
KNAG0C06630        LDGISCIIASVEKEMEAHCQGDDGANHSG------------------QKRHGSASYSFAN
KAFR0H00180        -----------------------------------------------QKRHGSNSYIY--
NDAI0E05070        -----------DDNSINDGIINNTNNTIDSINNNITNSIGNIAR---PKRHSSNSYNNYK
NCAS0A03170        ENIR-------------------------------------------QKRHSSNSYSNAK
KLLA0A00528g       -----------------------------------------------QKRHNSNSVDYYD
AFR290W            -----------------------------------------------HQKRHSSALGGCR
Ecym_4015          -----------------------------------------------QKRQYSTNFDCYN
SAKL0E15004g       -----------------------------------------------QKRHNSNSYDYYD
KLTH0E00968g       -----------------------------------------------QKRQHSRSCDYMG
Kwal_55.19678      -----------------------------------------------QKRQHSRSYEYMG
                                                                               

TPHA0D04640        P----------------------------------------------SVKEYGSQSKGDL
CAGL0H06611g       DT-IVKRRLPVQSDENP------------------------------IGNFLDSFSKNSS
TBLA0E01710        NIAMVTTPISK------------------------------------SKLNTNSNTFGTA
Suva_9.37          ESSFAKRRVPGVVEPV-------------------------------GKGFIDGITTSQI
Skud_9.17          ESSFVKRRVPGVVEPV-------------------------------GKGFIDGIASGQV
Smik_9.18          ESSFAKRRVPGVVEPV-------------------------------GKGFIDGVTNGQI
YIL151C            ESSFAKRRVPGIVDPV-------------------------------GKGFIDGITNSQI
CAGL0G02541g       NISKTNTSINTNTNTTNLREKFSKIGK--------------------DTSRYNRTALHIL
TPHA0E00190        PG-IVKRRLAGNNNGDIHIQ---------------------------ESSSNFDPKYSSF
Kpol_1043.73       N--YIKKRVAKNSYNSA------------------------------TGNFLDSGSNGGG
Suva_11.333        HN-AARLDLSNFQVLNSS-----------------------------AKRQNSNSVNEDI
Skud_11.336        RNATTRLDLSNFQVLNPS-----------------------------AKRQNSSSVYNDI
Smik_11.360        HNATTRLELSDFQVLNPS-----------------------------FKRQNSNSVNDDI
YKR096W            RNTTANLSLSDFQVLNPS-----------------------------SKRQNSNSVYDDI
ZYRO0B16412g       AN-FVKRRLPNQEEIFPQ-----------------------------QSQFLDTSLTGAI
TDEL0B02140        ST-GVKRRVANHDDG--------------------------------ITQFLDNGAI---
KNAG0C06630        ANFPSKRRIANAEEDSKR-----------------------------ISSYSDNLLLQ--
KAFR0H00180        ---KNQKRIARPDDKILN-----------------------------ANININYIDHNSI
NDAI0E05070        TIPFTKRRIAACTPININNNNDNYNNNENMILMNNNNNNNNINNSFIDNLDYLSNTNNNT
NCAS0A03170        NNPAVKRRIAKPEEVSLKYI---------------------------DNMEYGTATTGNN
KLLA0A00528g       SN-IIKRRTGDGVPENVD--------------I--------------SVAEIPQEPCQYL
AFR290W            DG-LAKRRGPRGGLTA-------------------------------CGLVVDA------
Ecym_4015          HN-IVKRRLAEHGIASPSLN---------------------------EAEANDIDTPVDL
SAKL0E15004g       SG-YAKRRPNTLSQNVS------------------------------QNDELAASAACFL
KLTH0E00968g       SG-VNKRRLGSGISGAAAAA---------------------------AALFLDS------
Kwal_55.19678      SG-VSKRRVGSGVSGTTAAA---------------------------AASFLDCEGSP--
                                                                               

TPHA0D04640        DSKKCS--ETEPVT----------------------------------------------
CAGL0H06611g       PLQQ----CRTPGSRPHSVTKKTSNIDN------------------------TDMVGRSN
TBLA0E01710        ANSSKR--QHSTSINSDVKRRTPKK---------------------------IEDLTSAS
Suva_9.37          SM------QNIPFKAEDISRRPSISRKA------------------------METTPQLH
Skud_9.17          SV------QNTPSKTDDISRRPSISRKA------------------------METTPKVN
Smik_9.18          SA------QNTPSKVDDVSRRPSISRKV------------------------MESTPQAK
YIL151C            SA------QNTPSKTDDASRRPSISRKV------------------------MESTPQVK
CAGL0G02541g       DSLKKNKLLLQGQLQDKSSRRSSLEGENNFEVY-------------------TYQNPIDE
TPHA0E00190        AYSRKDPINLTTVDAPFIDLRPYVTENT------------------------PIASPKRN
Kpol_1043.73       DISNQTSLQNTPLASP----KPSIAKNNIIN---------------------TSTTPQPT
Suva_11.333        NSSKRR--ISRPNFLDIEYTNN------------------------------ASSQSEKT
Skud_11.336        NSSKRR--INESRFLDVEDNT-------------------------------NDSTPSER
Smik_11.360        NCSKRR--ISRSKFSNSEDRN-------------------------------DDSTQSEK
YKR096W            NSSKRR--ISRPRFSDIEGKNN------------------------------DHTYPERT
ZYRO0B16412g       NQSISV--PNTPSKAP-TSRRPSLPKKA------------------------IDTSSASN
TDEL0B02140        --------PNTPCKEPVSSRRPSATRRT------------------------VNRTPRST
KNAG0C06630        --------QNTPRRSRDVARKSASG---------------------------SASGCRSA
KAFR0H00180        VN------ENATPVKSVLSRRPSLSKKS------------------------NNVTPQPS
NDAI0E05070        NMSTMA--QYTPSKGTTISRRPSIIIRKQQQQQQQSHFTTATTIKSPSNHTSVNITPQAS
NCAS0A03170        SIICQ---QQTPSKGT-LSRRPSLIKKQ------------------------MNSTPQPM
KLLA0A00528g       DTSL----LTSPSKIRHHEKTPSITKPHTLQ---------------------MEQTPQPR
AFR290W            ----------------------------------------------------IGAEPGS-
Ecym_4015          ISHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKL
SAKL0E15004g       DS------NLTPSKHQECT--PSSFQRA------------------------TDETPQPF
KLTH0E00968g       --------GGSPVRRKDAQS----------------------------------------
Kwal_55.19678      --------LRRREVTPTLGRGPTIGMPH------------------------SVMSADNA
                                                                               

TPHA0D04640        ------------------------PESETVSPIA--------------------------
CAGL0H06611g       AIGGYSDNANMSNKS---------PAEFNAGPVN-KNHTGNSLLDNIANSANRVDIPGSP
TBLA0E01710        QFAISS-------RS---------NSLFNKTQSQLQLQLQMQLQIQSQSQSQ--------
Suva_9.37          TSSNSAMDIP---KS---------PYYVNRTAIT--------------------------
Skud_9.17          TASISTIDVP---KS---------PYYMNKSAIT--------------------------
Smik_9.18          TASISTMDVP---KS---------PYYVNRTAVA--------------------------
YIL151C            TSSIPTMDVP---KS---------PYYVNRTMLA--------------------------
CAGL0G02541g       NKQNGEESAS--------------PKLMLSRSTSKVNDLNDSILVQFDDRSKLNSRRSSI
TPHA0E00190        AIKKHQNNIAVTPQQSLVGNDIATLLSMDQKVLSNPEILKATEPIIDDSMINNISLKNSL
Kpol_1043.73       YITQDSMTS---------------PFVLNSNLPS---NLD---IVSNENLEDSIRKDQDF
Suva_11.333        TLYNSRPNPS--------------ARYLGSPKRALQRENSVEVTRSSPLISK--------
Skud_11.336        TIICHS-RPK---PS---------PRYSNSPKRSLKRENSVEVTGSYPLISK--------
Smik_11.360        TTTNHS-RSN---KS---------FKFMGRQKLSMQEENLVEVTQSSALLSK--------
YKR096W            TVKESEKNPS--------------PRYVSSSKRALKRENSVGITQSSALISK--------
ZYRO0B16412g       YGGAGG-GGTYALGS---------PYCSLPNVSTFVSNVDLASKAAIENSVQKLPCLERN
TDEL0B02140        TSYVADASAS--------------PYCYSPNNSNLRIDHLSRMVNSSGV-----------
KNAG0C06630        SGSGSAPQES--------------PFCMEFTSLA---NVDPLPTTGGAATG---------
KAFR0H00180        FLVT---EPP---KS---------PFYVTNQSYT---NIDVALSANNNGITNNNNQ----
NDAI0E05070        NYDPAS-EPP---NS---------PYYLTTNSYSNMKNNNNANTTNTNNTIQPSPLPL--
NCAS0A03170        SYVVSEVPAS--------------PFYLPANSFSNNYERSPALLTNNNNININ-------
KLLA0A00528g       GVDTSG-EFP---QS---------PFYLPTTSQT---NFEAATTVNENSSIRRSDSVT--
AFR290W            ------------------------PSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDTR
Ecym_4015          AQQPPYECTP---RS---------PYYLPTTSSSNMEAAAKAIDSSSIKQVSGTTLHDSR
SAKL0E15004g       YPADTPQS----------------PFYLPTTSSSNLEAASKVITNDNSSV----------
KLTH0E00968g       ------------------------PSYMPTTSSS---NLEAAAVENENSSV---------
Kwal_55.19678      YS----------------------PSYLPTTSSS---NLEAAVTENENGSVNFPDI----
                                                                               

TPHA0D04640        ----------------------------------PIKPVNSS------------------
CAGL0H06611g       F---------------------------------YLPTRTHSNILETTQADAPLHPV--N
TBLA0E01710        ----------------------------------SQSDISRDTSNNDATTNNIFFAK--D
Suva_9.37          ----------------------------------RNMEVVSKESH---------------
Skud_9.17          ----------------------------------RNMEVVSRGNYA--------------
Smik_9.18          ----------------------------------RNMEVVSKESYD--------------
YIL151C            ----------------------------------RNMKVVSRDTYE--------------
CAGL0G02541g       FEPANVDMGINNDLASKEIGIDNVTKSISRLANSNDYVVSRSHNEEISQIAGNPRVK--K
TPHA0E00190        SRERS-----------------------------LNPGVNNIEDIFKIAASNFPSPE--N
Kpol_1043.73       SQINQAIKDK------------------------MMRPLSVRNDSFVYQVSNFPSPE--N
Suva_11.333        ----------------------------------PASHNGKHIAYDKHTTGSNSLLNMSK
Skud_11.336        ----------------------------------PASQSGKNNAYDKRSSKNLSLLNPSK
Smik_11.360        ----------------------------------PLNKQSKNTTYEKRGSQNVVKPK--N
YKR096W            ----------------------------------SFSENGGSIAHEKWSPENMIKPL--N
ZYRO0B16412g       SSNYLQTTPSRLDTP-------------------YLSQDQNSNKYYHHGISAYPPVNSGD
TDEL0B02140        ----------------------------------SIPNVCRDPSFLSKEAHIV-------
KNAG0C06630        ----------------------------------VNTPGGLGVDNISSGKQTVFIDK--S
KAFR0H00180        ----------------------------------YTNMNTYNSINNNYNNIEGYSGN--A
NDAI0E05070        ----------------------------------PLPMDIPTNNSNNNNNNNITRSN--N
NCAS0A03170        ----------------------------------NNNNSNNNLRFNSMNASSIPREN--N
KLLA0A00528g       ----------------------------------RLTTVGNNTQLASNGNNYIKPQH--Y
AFR290W            LELPS-----------------------------RLSSSPVQVALDPYLTCADGQSCIVD
Ecym_4015          LQVPSKF---------------------------SQSPSCVTRLHRALSSHNLFPVG--N
SAKL0E15004g       ----------------------------------QLPDICIDNKQQPERRQQQRLEK--R
KLTH0E00968g       ----------------------------------RLSDICIDPRMDSSADHNCKMRG---
Kwal_55.19678      ----------------------------------CIERQRTDPHSVRYTRTEQGNVR--P
                                                                               

TPHA0D04640        ------------------------------------------------------------
CAGL0H06611g       ------------------------------------------------------------
TBLA0E01710        KVKEIEKTVPDDKVNTTLNPMHNFSSP-----NDFQTTTFQDNHPQGT------------
Suva_9.37          ------------------------------------------------------------
Skud_9.17          ------------------------------------------------------------
Smik_9.18          ------------------------------------------------------------
YIL151C            ------------------------------------------------------------
CAGL0G02541g       YLSKRGALKGDSIDNKADQKLYMYGNGENRIESHTETGHFEQHAFGNCNDV---------
TPHA0E00190        ETMIMNNININSTTKNGMAQNKIYSNESINKLNRKYNEELLPYSIIDNSSENQKSLNI--
Kpol_1043.73       TEPHLHTFE-----------------------KNTSIQNYSSNDNIVP------------
Suva_11.333        SSLAYVEAEP----------------------DGQSSNEIIENFQHKE------------
Skud_11.336        SSLAFVDAEA----------------------DGQSNNDIIGNFQHKS------------
Smik_11.360        ISKSSFAFVDGES-------------------DGQSNNGIVSNFQR--------------
YKR096W            VSQNSLAFVDAGS-------------------DEQSKSEIVGGFQRKS------------
ZYRO0B16412g       NSNHHNNMNTNSNTTNNDNDNNNNNTNYYNNHNNRRQNETSKIADIQNSVSVANTNNNNN
TDEL0B02140        ------------------------------------------------------------
KNAG0C06630        IGATHRY-----------------------------------------------------
KAFR0H00180        VLPGNDDMFINTQ-------------------SNKYRNNSTSTAIIND------------
NDAI0E05070        NNPQSRYFSPSPLPPPLQQ-------------NHHQQQQTSHLNPISL------------
NCAS0A03170        DVPAIEQLTLPQ--------------------PMSRTMNYSTEIPINSNS----------
KLLA0A00528g       QEDGVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHSPAK-----------------
AFR290W            RVEHFGYPQEEPSPRMGARPKEGVPQSLWSPHSKSGFNTHSKAVASNSGRRGYPCTGSRF
Ecym_4015          EQHSMIDKGVSCGYFQEAQIQRQSPMKNFVFTQQQCSFGESRCNDANA------------
SAKL0E15004g       VNHDDKKITRNA------------------------------------------------
KLTH0E00968g       ----------------------------CDLASKNQHQTFSNCIQTASA-----------
Kwal_55.19678      QSHESL--------------------------SNHQHHTLPNSIQGGSS-----------
                                                                               

TPHA0D04640        ---QHSKPVADIEKSIEIDHMLNADEK---------------------------------
CAGL0H06611g       ---SSEVEQESIGPELNLIEEQYNSNL------------------ENGEINYNT------
TBLA0E01710        ---SQSIPAHNSNNNNLSASNESTNQQ-------------------NYQDNNAN------
Suva_9.37          ---DENGPQTRADDSLTTSTGIYANSQ---------------------------------
Skud_9.17          ---ENTTSQMRTDESMATSNGIYSNSQ---------------------------------
Smik_9.18          ---ENANPQMRIDESLVASNGIYNNSQ---------------------------------
YIL151C            ---DNANPQMRADEPLVASNGIYSNSQ---------------------------------
CAGL0G02541g       ---VKGNPDINGYENIDDDDGQYPNEP--------EDCSNE----FNNDDTDTT------
TPHA0E00190        ---NNNDYRGNGSDSGQINNFDYNTDNNETIDNDNGNNNHSNDSNMRNNVNNSSTGTHND
Kpol_1043.73       ---DNDMDIGNENANNESNDSNNNNNN----------------NDFNGESGNNGTVE---
Suva_11.333        ---TESDDIHNEDGDDGADPNDLSNSE-------------------NNNNYNNN------
Skud_11.336        ---NNREHIHDGDNNANNQSYNNSNNN----------------NNNNNNNNNNN------
Smik_11.360        ---ESSNSENVCDEYKGEKNDDNNENR---------------------------------
YKR096W            ---NNSQEINDKDNSARDQDFNNSGNN-----------NNNNNHSSNNNDNNNN------
ZYRO0B16412g       FDIKENRGNGDCNQDGNNNNGNTNENN----------------FNMNNNGNNNNSINNRS
TDEL0B02140        ---SDGQDTGTISINSGEVNDQSQDNS------------------ANDEGRDDN------
KNAG0C06630        ---ATETQQGEIDNNGEGEVAGNNDNA--------------------DNDGLPT------
KAFR0H00180        ---VSDNFVNNMNTDIQQNENIYQDQN------------------FNDDTGNNNAES---
NDAI0E05070        ---SNSTSTSNPNINSSALNNNNNNNN------------------NNTNTDNNNS-----
NCAS0A03170        ---NNIDDQSAIIPNNEHKNGENQESE------------------NYKNTNNNN------
KLLA0A00528g       ---NNSDNEMNLPSGSNAGSGQNHDHN-------------------NSNPNDHN------
AFR290W            ADAAGGEQLDDQGPSSNGNNGSSNNGD----------------ASGEGAGHPGGGKSSAG
Ecym_4015          ---NDNIDNNDEGNNITSNNNNSNSSD-----------------TTNINTNSNT------
SAKL0E15004g       ---ANGEQKESITDELQGTDNTPHEQS------------------SNTHADTNQ------
KLTH0E00968g       ---VPGAPAGNAPAYSEHSVPNNAAQT------------------ESGEARAPV------
Kwal_55.19678      ---SAGLPTGDQDFREGSTPENSSRSS-------------------RHGPHDNQ------
                                                                               

TPHA0D04640        ---------------------------------------------------LDPLAGLLP
CAGL0H06611g       -----EVSDFESLPTKDANSVTSTEYEKGTRTAMTSH-QSILPTTWNRST-QALISKLQD
TBLA0E01710        -----NNSQNDQQDSSQGNNNNNNNNNSNNNN------NNNQQNSIKKSN-QNLIQKLQN
Suva_9.37          -----PQSQITLSDTRAAPIVANSLP------------SVTRQLPSAQPN-QTFIKKLQE
Skud_9.17          -----PQSQVTLSDFRTAPAFATSPP------------PVTRQLPSAQPN-QTFIKKLQE
Smik_9.18          -----PQSQVTLPDIRKAPVVASSPP------------PVVRQLPSAQPN-QTFIKKLQE
YIL151C            -----PQSQVTLSDIRRAPVVAASPP------------PMIRQLPSAQPN-QTFIKKLQE
CAGL0G02541g       -----DTNQRKNNEESKDDEEEDEDQGNNSN-------SNDKANNSNKPT-QALVQKLQD
TPHA0E00190        GNGSGNNNNNNINNNSSSDENNNNNPEENNNSNGNNNEIPSVSVPLRKSS-QVLVQKLQD
Kpol_1043.73       -----DFNDMSHNVGGNGDEDKDNKDNGDNND------VPSVSVPPRKSS-QALVQKLQD
Suva_11.333        -----NNNNINNNNNNNTNNNNINNNEDDDNNEQEES-NVYRPANNKKSS-IALIQKLQE
Skud_11.336        -----NNNNSSNNNNNNNNNNNNNNINNNDDNNEAEEDDACRSANSKRSS-IALIQKLQE
Smik_11.360        -----NDDNDDSNNGNHDNNINNNDDENERDEN-----DACKPANNKRSG-IALIQKLQE
YKR096W            -----NNDDNNNNNNSNSRDNNNNSDDSNEREEN----DSCKPASNKRSG-IALIQKLQE
ZYRO0B16412g       G----NNDGRDSNNNSNSNSNNNNNDNNNNNGNRA---VPSVVVPSKRSS-QALVQKLQD
TDEL0B02140        -----NENDSIRNKNSNNDNDNNRENNKDNNGN-----VPSVVVPSKKSS-QALVQKLQD
KNAG0C06630        -----NGNGDNNEKNLSNDNDNSNNNSNNNNNYPADQSDAQNTSVTRKSS-QALVQKLQD
KAFR0H00180        -----DNNQNNSNDESNNQNSEDNNDNPNNNNN-----NVEETSVTKKTS-RVLIEKLQN
NDAI0E05070        -----NNNNSNNNKTTNNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQD
NCAS0A03170        -----EQDTNNNINNTNRDRNNNNNNNNNNNNS-----SSSTSSSSKKTG-EALVRKLQD
KLLA0A00528g       -----NSISDDHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQE
AFR290W            GASNGSRGNSDNSANNNSNGNNSGNSNDSDNNGNSDSSVPTVAVTAKQSS-QALMEKLQE
Ecym_4015          -----SREGNNNVGINSSSESNEDGDNGDNNHN-----VSTVAVPSKPSS-QTLVEKLQE
SAKL0E15004g       -----QSDQHNSVQQGSSGGSDDGENNRENSG------IPIVNVPPKHTS-QALVQKLQD
KLTH0E00968g       -----NSGGLTGRNDRGNDHDNNNNNPNEN--------TPAAGQTSSQTS-QALVQKLQD
Kwal_55.19678      -----ESKGYANSDERSNNNHENNNNNPNEN-------SQAVSPSSSPTS-QALVQKLQD
                                                                         :  *  

TPHA0D04640        LFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNIN
CAGL0H06611g       IYKSILVQEVELQNCCSA---ITSSQTTDLKKIWEV--YKINVELVNNYVIFITTALLPS
TBLA0E01710        IYKLIVSQELELQDKCNK---LSTSQSTKLKYLWSI--YKLNHDLINNYILFILTSLSPS
Suva_9.37          IYKIIVVQETELQQRCLY---LTTSQTTELKSLWAI--YKLNTELIKNYINFIITALLTT
Skud_9.17          IYRIIVVQETELQQRCLF---LTTSQTTELKSLWAI--YRLNTELIKNYINFIITALLTT
Smik_9.18          IYKIIVVQETELQQRCLY---LTTSQTTELKSLWAI--YRLNTELIKNYINFIITALLTT
YIL151C            IYKIIVVQETELQQRCLY---LTTSQTTELKSLWAI--YRLNTELIKNYINFIITALLTT
CAGL0G02541g       IYKNIVRQEVELQEKCAQ---LTSSQTTDLNSIWSI--YRINVELVTNYVTFISTALLSS
TPHA0E00190        IYKTIVKQEIELQERCGR---LTNSQTTELKNLWTI--YRVNSELVDNYITFITTAIHPT
Kpol_1043.73       IYKIILKQEVELQERCSQ---LTNSQTTEIKNLWVI--YKLNADLINNYVTFITTALFPS
Suva_11.333        LYKVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YRINTELVNNYVTFITTALLPS
Skud_11.336        LYKVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YRINTELINNYVTFITTALLPS
Smik_11.360        LYRVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YKINTELVNNYVTFITTALLPS
YKR096W            LYKVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YKINTDLVNNYVTFITTALLPS
ZYRO0B16412g       IYKVIVKQEIELQERCSQ---LTTSQTTELKNLWTI--YKINSDLINNYVTFLTTALLPS
TDEL0B02140        IYKVIVKQEIELQERCSQ---LTNSQTTELKQLWVI--YKVNSDLINNYVTFITTALLPP
KNAG0C06630        IYKVIVKQEIELQERCSQ---LTTSQTTELKNLWTI--YKINTDLINNYTTFITTALLPS
KAFR0H00180        IYKIIVKQEMELQQRCSQ---LTTSQTTELKNLWSI--YKLNTDLINNYITFITTALLPS
NDAI0E05070        IYKLIVKQEIQLQDRCSQ---LTTSQTTDLKNLWTI--YKINLDLINNYINFITNALLPT
NCAS0A03170        IYKVIVKQEIELQERCSQ---LTTSQTTDLKNLWTI--YKVNIDLINNYVTFITTALLSS
KLLA0A00528g       IYKSIVKQETELQERCSN---LTTQQTTDLKNLWLA--YKINAELIDNYILFITTALLPS
AFR290W            IYRNIVRQETELQQRCSQ---LTTSQTTDLKNLWII--YKVNAELIDNYFMFITTALLPT
Ecym_4015          IYKNIVKQETELQERCSQ---LTTSQTTDLKNLWVI--YKLNAELIDNYFTFITTALLPT
SAKL0E15004g       IYRSIVKQEIELQERCSQ---LTNSQTTDMKNLWVI--YKVNAELINNYISFITTALLPS
KLTH0E00968g       IYRNIVKQEVELQERCSQ---LTHSQTTDLKNLWII--YKVNTELINNYVAFITTALLPS
Kwal_55.19678      IYRNIVKQEVELQERCAQ---LTTSQTTDLKNLWII--YKINIELINNYVAFITTALLPS
                   ::  *   * .::  .     :  . . .:   :    :.:: .:: .*  *:  ::   

TPHA0D04640        NTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFI
CAGL0H06611g       QSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFM----------DPEICCQFI
TBLA0E01710        QSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFM----------DPEILSQFI
Suva_9.37          QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFM----------DPEVCCQFI
Skud_9.17          QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFI
Smik_9.18          QPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFI
YIL151C            QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFI
CAGL0G02541g       QSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFM----------DPEVCSQFI
TPHA0E00190        QPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFM----------DPEVCCQFI
Kpol_1043.73       QSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
Suva_11.333        QPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
Skud_11.336        QPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
Smik_11.360        QPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
YKR096W            QPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
ZYRO0B16412g       QTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFM----------DPEVCCQFI
TDEL0B02140        QSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCAQFI
KNAG0C06630        QPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCSQFI
KAFR0H00180        QSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCSQFI
NDAI0E05070        QSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFM----------DPEVCCQFI
NCAS0A03170        QSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
KLLA0A00528g       QSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
AFR290W            QPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
Ecym_4015          QPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFM----------DPEVCCQFI
SAKL0E15004g       QPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
KLTH0E00968g       QPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFM----------DPEVCCQFI
Kwal_55.19678      QPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFM----------DPEVCCQFI
                   :.  .   *:* :    :  **  :   .:*:::: : ..*          : :   :**

TPHA0D04640        QSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVA
CAGL0H06611g       IHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWY-----GEA
TBLA0E01710        THVFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWY-----IES
Suva_9.37          TYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
Skud_9.17          IYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
Smik_9.18          IYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
YIL151C            IYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
CAGL0G02541g       THVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWY-----NQA
TPHA0E00190        FHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWY-----MAA
Kpol_1043.73       THVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWY-----MAA
Suva_11.333        THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
Skud_11.336        THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
Smik_11.360        THVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
YKR096W            THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
ZYRO0B16412g       THVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
TDEL0B02140        THVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
KNAG0C06630        THVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
KAFR0H00180        THVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
NDAI0E05070        SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----NEA
NCAS0A03170        THVFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWY-----MEA
KLLA0A00528g       AYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWY-----RES
AFR290W            IYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----HEA
Ecym_4015          VYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----QEA
SAKL0E15004g       SHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----SQA
KLTH0E00968g       THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----TQA
Kwal_55.19678      THVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWY-----SQA
                      :  :: :   :*  .   *  .:***.*:   *   .   :.*.:  .*       :

TPHA0D04640        VNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAID
CAGL0H06611g       MKYTYGVGK----------LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVID
TBLA0E01710        MKFTFSHGK----------LYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVID
Suva_9.37          MKYIYGCGK----------LYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIE
Skud_9.17          MKYIYGCGK----------LYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIE
Smik_9.18          MKYIYGCGK----------LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIE
YIL151C            MKYIYGCGK----------LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIE
CAGL0G02541g       LKYTYGYGK----------LYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVID
TPHA0E00190        MEFTYGHGK----------LYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIG
Kpol_1043.73       MEYSYGYGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVID
Suva_11.333        MKYVYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
Skud_11.336        MKYIYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
Smik_11.360        MKYTYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
YKR096W            MKYIYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
ZYRO0B16412g       MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVID
TDEL0B02140        MKYIYGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVID
KNAG0C06630        MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVID
KAFR0H00180        MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVID
NDAI0E05070        MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVID
NCAS0A03170        MKFTYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVID
KLLA0A00528g       LKFTFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVID
AFR290W            LKYTFGHGK----------LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVID
Ecym_4015          LKYNFGHGK----------LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVID
SAKL0E15004g       LIYTYGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVID
KLTH0E00968g       LSHIFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVID
Kwal_55.19678      LSHIFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVID
                   : .  . **           *::::.:*:..*  ::.*.*.:   :         ** * 

TPHA0D04640        KIISKLLNKQVNLKQSMGGT-------------------------TILMKYF-----TLL
CAGL0H06611g       NIYQRAY-----ISRG-EES------SSNV---------------Q-ILDYLKHNEIMVL
TBLA0E01710        NIYQRAF-----IERNSNSSSSNNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLL
Suva_9.37          NIYQSAF-----IDRSSGNTNNNETAHRNS---------------Q-LIDYLKHTEVMLL
Skud_9.17          NIYQSAF-----IDRSSAGTNNNETAHRNS---------------Q-LIDYLKHTEVMLL
Smik_9.18          NIYQSAF-----IDRGSSGTNNNETAHKNS---------------Q-LIDYLKHTEVMLL
YIL151C            NIYQSAF-----IDRSSGSANNNEIAHRNS---------------Q-LIDYLKHTEVMLL
CAGL0G02541g       NIYQRAF-----IERG-SNN------TRNS---------------Q-LIEYLKHSEVMLL
TPHA0E00190        NIYQRAY-----ADSNNSNN------GRND---------------QLLVDYIKHCEVTLL
Kpol_1043.73       NIYQRAF-----ADRNSSSN------SRNC---------------QLLVDYLKHSEVMLL
Suva_11.333        NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
Skud_11.336        NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
Smik_11.360        NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
YKR096W            NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
ZYRO0B16412g       NIYQRAF-----VERN-NGN------HRNT---------------Q-LIEYLKHSEVMLL
TDEL0B02140        NIYQRAF-----VERN-NGN------HRNS---------------Q-LIEYLKHSEVMLL
KNAG0C06630        NIYQRTF-----VDRNTGGN------YRNP---------------D-LIDYLKHSEVMLL
KAFR0H00180        NIYQRTF-----VDRNKNGN------VRNS---------------D-LIDYLKHSEVMLL
NDAI0E05070        NIYQRAF-----VERN-NGN------HRNL---------------Q-LIEYLKHTEVMLL
NCAS0A03170        NIYQRAF-----VERN-NGN------NRNL---------------Q-LIEYLKHSEVMLL
KLLA0A00528g       NIYQRAF-----AERD-SSG------NRTN---------------H-IVDYLKHTEVMLL
AFR290W            NIYQRAF-----AERN-SGH------HRNA---------------H-LVEYLKHTEVMLL
Ecym_4015          NIYQRAF-----AERN-SGH------HRYS---------------H-IVEYLKHTEVMLL
SAKL0E15004g       NIYQRAF-----AERS-GGS------SRNF---------------P-IVEYLKHSEVMLL
KLTH0E00968g       NIYQRAF-----AERN-GGN------QRNS---------------L-MVEYLKHSEVMLL
Kwal_55.19678      NIYQRAF-----AERN-GGN------HRNS---------------L-MVEYLKHSEVMLL
                   :* .         . .                               ::.*:      :*

TPHA0D04640        SLFFGSTSSSQLSGMERSSLHYFWNEFAN-------------------------------
CAGL0H06611g       PNFMENFE------LQRMAYVYFSEKFGQ-------------------------------
TBLA0E01710        PNFLENDH------LKTVVLNYFTNSFGKIAIQSNLSDPSNPNLNTNSGSNTSISGQANI
Suva_9.37          PSFLENLD------LQHVVLLYFKDKFGK-------------------------------
Skud_9.17          PSFLENMD------LQHVVLMYFKDKFGK-------------------------------
Smik_9.18          PSFLENMD------LQHVVLMYFKNKFGK-------------------------------
YIL151C            PSFLENMD------LQHVVLMYFKDKFGK-------------------------------
CAGL0G02541g       PNFIGNEN------LQKVVMTYFEHKFGT-------------------------------
TPHA0E00190        PNFKESQE------LQQVVLMYFIDKFGV-------------------------------
Kpol_1043.73       PNFMESPD------LQQVVLLYFMEKFGI-------------------------------
Suva_11.333        PSFLESPD------LQNVVLSYFVEKFGI-------------------------------
Skud_11.336        PSFLESPD------LQNVVVSYFVEKFGI-------------------------------
Smik_11.360        PSFLESPD------LQNVVLSYFIEKFGI-------------------------------
YKR096W            PSFLESPD------LQNVVLSYFIEKFGI-------------------------------
ZYRO0B16412g       PSFLESAD------LQQVVLIYFKAKFGC-------------------------------
TDEL0B02140        PSFLESTD------LQQVVLIYFRDKFGM-------------------------------
KNAG0C06630        PSFLGSKD------LQQVVLNYFQDRFGI-------------------------------
KAFR0H00180        PSFLENED------LQQVVLNYFNDRFGV-------------------------------
NDAI0E05070        PTFLESLD------LQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTT
NCAS0A03170        PTFLENSE------LQQVVLLYFQEKFGILE------------------VTIP---STSE
KLLA0A00528g       PSFLESSE------LQNVVIHYFQHKFGV-------------------------------
AFR290W            PSFLESSE------LQDVVLAFFEQKFGV-------------------------------
Ecym_4015          PSFLENVE------SQGVVLAFFDQKFGA-------------------------------
SAKL0E15004g       PSFLESPE------LQKVVLTFFQQRFGV-------------------------------
KLTH0E00968g       SSFLESPE------LQKVVLSFFQNKFGI-------------------------------
Kwal_55.19678      SSFLESPE------LQKVVLSFFQHKFGV-------------------------------
                   . *  .         :     :*   *.                                

TPHA0D04640        ----EYHL---------NY--------SSLRKPVNCKYRQKEINYSMFYFNNAPLFSLIS
CAGL0H06611g       ----DFVG---------NN--------FFDTRSMFVQ-NLESVK---FYFRHSPLFAQAH
TBLA0E01710        ENINNGHNIPSSSNVITSESLQINAINLFNFRNIFKQKNSDILK---YFFKNSATFAESH
Suva_9.37          ----DFNG---------ND--------VFSTKDMFCQ-NPESLR---YYFRHAPAFAESQ
Skud_9.17          ----DFNG---------ND--------IFDTKDMFCQ-NPESLR---YYFRHAPAFAESQ
Smik_9.18          ----DFNG---------ND--------VFDTKDMFCQ-NPESLR---YYFRHAPAFAESQ
YIL151C            ----DFNG---------ND--------VFDTKDMFCQ-NPESLR---YYFRHAPAFAESQ
CAGL0G02541g       ----DLHD---------LN--------IFQPRDIFLQ-NPENLK---YFFRHAPAFAESH
TPHA0E00190        ----DYNN-------SSNN--------MFISRKMFVQ-NNDQFK---CFYRYSAAFAESQ
Kpol_1043.73       ----DYNN---------NN------VKMFQPRQMFIQ-NNDQLK---FYFRHANAFAEAQ
Suva_11.333        ----DANG---------CN--------IFNPEDMFIQ-NPDFFK---YFFRHAPSFAQSH
Skud_11.336        ----DANG---------CN--------IFNPEDMFIQ-NPDFFK---YFFRHAPSFAQSH
Smik_11.360        ----DANG---------CN--------IFNCEDMFIQ-NPDFFK---YFFRHGPSFAQSH
YKR096W            ----DANG---------CN--------IFNAEDMFVQ-NPDFFK---YFFRHGPSFAQSH
ZYRO0B16412g       ----DSNN---------VN--------IFDTRKMFCQ-NPDYLR---YFFRHAPAFAESH
TDEL0B02140        ----DTNE---------NN--------IFDTRQMFDQ-NPDQLK---YFFRHAPAFAESH
KNAG0C06630        ----DYSE---------NN--------IFDTQDMFFQ-PPSCLR---FFFRHAPAFAESH
KAFR0H00180        ----DYND---------NN--------IFETQDMFFQ-VPASLR---FYFRHAPAFAESH
NDAI0E05070        TSSSSSSD---------NTTRSFTTIDIFRNQDMFIQ-NPDHLK---YFFRHSGTFAQSH
NCAS0A03170        TISINTMN---------NNTR---TIDMFRSRDMFIQ-NPEQLK---YFFRHAPAFAESH
KLLA0A00528g       ----SSSG----------N--------FFDPNLIFIQ-DAERLK---HFFRHSSLFSQSH
AFR290W            -----TSN---------VD--------FFDPRLVFVQ-DSERLK---HFFRHASLYAESH
Ecym_4015          -----TGS---------AN--------FFDPSLIFVQ-DCERLK---HFFRHASLYAESH
SAKL0E15004g       ----WPNN---------VD--------FFDHKQIFIQ-DGEKLR---YFFSHAPAFAESH
KLTH0E00968g       ----SSNN---------TD--------YFSHQAIFLQ-DGERTK---YFFRHAPAFAESH
Kwal_55.19678      ----STSN---------TD--------FFNPRDMFLQ-DGERVK---YFFRHAPAFAESH
                                                    :  :      .    ::  .  ::   

TPHA0D04640        IVETIIMNKKLNPFFCVYK-----------------------------------------
CAGL0H06611g       ILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKS------------------------
TBLA0E01710        ILQLIGFGDPKNPFALLFQLPKYLKERKTKRKSKASNSNSNMNTNTTVNANISSNTIPSS
Suva_9.37          ILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKS------------------------
Skud_9.17          LLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKS------------------------
Smik_9.18          LLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS------------------------
YIL151C            LLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS------------------------
CAGL0G02541g       ILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS---------------------
TPHA0E00190        ILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTM---------------------
Kpol_1043.73       ILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKN----------------------
Suva_11.333        ILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNE--------------------
Skud_11.336        ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND--------------------
Smik_11.360        ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNND--------------------
YKR096W            ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND--------------------
ZYRO0B16412g       ILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKS----------------------
TDEL0B02140        ILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKS----------------------
KNAG0C06630        ILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTS--------------------
KAFR0H00180        ILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKS----------------------
NDAI0E05070        ILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNN
NCAS0A03170        ILQLVGFGDPKNPFALLFELPKYLKERKDKKEKKKSKS----------------------
KLLA0A00528g       ILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS------------------------
AFR290W            LLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKS------------------------
Ecym_4015          ILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKS------------------------
SAKL0E15004g       ILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSK-----------------------
KLTH0E00968g       ILQMVGFGNPKNPFALLFELPKFLKERKERKERRKS------------------------
Kwal_55.19678      ILQTVGFGDPKNPFALLFELPKFLKERKERKERRKS------------------------
                   :::    ..  ..*  ::.                                         

TPHA0D04640        ------------------------------------------------------------
CAGL0H06611g       -------------------------------------------KTGVDNMSID-------
TBLA0E01710        DVSMKYETNSDSSNPTNSKSSLYKSSNSNIVMSSSTTSFATAISTTNNSISSNMDVDTEL
Suva_9.37          -------------------------------------------GAAEIPHYRD-------
Skud_9.17          -------------------------------------------GATEVPQYRD-------
Smik_9.18          -------------------------------------------SATETPQYRD-------
YIL151C            -------------------------------------------EATETSSYTD-------
CAGL0G02541g       ----------------------------------------GEPTSNESVMSLD-------
TPHA0E00190        ----------------------------------------LILKITQPRLYHR------W
Kpol_1043.73       ----------------------------------------QIVGEDGSSTTFS-----SV
Suva_11.333        ----------------------------------------SSITESSTSNSRN---ENDD
Skud_11.336        ----------------------------------------SSVTESSTGNSRN---DNND
Smik_11.360        ----------------------------------------SSVTESSTGNSRN---GNED
YKR096W            ----------------------------------------SSVTESSTGNSRN---DNED
ZYRO0B16412g       ----------------------------------------TTVTETSSTMAID-------
TDEL0B02140        ----------------------------------------SVTTETSSAMAID-------
KNAG0C06630        ----------------------------------------TADVSSTAPKTVD-DQATDN
KAFR0H00180        -------------------------------------------STEISTMSID---TNDS
NDAI0E05070        IVNMTDNNINTNNDNDNG----------------------NCPSKDGSMMSIDYINNINL
NCAS0A03170        ---------NSNSNNNNN----------------------ASTAGDGSMMSID-NSEMGE
KLLA0A00528g       -------------------------------------------TKSTSEGSLD-------
AFR290W            ----------------------------------------KSSTSTQYDTSID-------
Ecym_4015          ----------------------------------------KSTASNQSDMSID-------
SAKL0E15004g       -------------------------------------------SSPPLPTNLD-------
KLTH0E00968g       -------------------------------------------KSSNSFTSME-------
Kwal_55.19678      -------------------------------------------KSSHSFTSIE-------
                                                                               

TPHA0D04640        ---------------S---SDDF--EIKSVSLSN-----------WKILIEQMDDTLLHS
CAGL0H06611g       ---TLSFQVSGNEIHD---VGEYFNSLENIDKEF-TLPPNV--DIWIQSLQYTNTTGIFC
TBLA0E01710        QNNGMEDEDEMLDNLS---PQDFFNNLESLKLSF-FLPNSL--EIWNESLKYINIISLNC
Suva_9.37          ---------PFDDQGS---SESYFQNIDTLNSDFNDPPTNI--GIWLDSLNYINMTSIQC
Skud_9.17          ---------PFDDQIS---SESYFQNIDSLTSNFDDIPTNL--NIWLDSLNHINMTSIQC
Smik_9.18          ---------PFHDKKS---PESYFQNIDALSSNFDDIPTNL--NIWLESLNHINMTSIQC
YIL151C            ---------PFDVQIS---SESYFQNIDALNSSFNDIPTNL--NIWLDSLNHINMTSIQC
CAGL0G02541g       -------NISTDSLIS---SDQYFSNLESMQHPY-LPPPRY--DIWLKSLSYLNLTAVQC
TPHA0E00190        VGTTLPTMPNNNVFLT---AEEFFENIDTINYPS-FMPNSV--DIWNHSLQYANHVSIKC
Kpol_1043.73       SGMEYMVNMETNVFLG---SEDFFNNIDKLAINN-FMPNSI--SLWNDSLKYHNFTATKC
Suva_11.333        NDEIMSSTTSISERDS---LIEFFNDIDTLRRPI--VSSMLTNEAWLESLKFLNMTSLKC
Skud_11.336        DDEIMSSTASISDHDF---LAEFFNDIDTLRRPI--LPSMLTSEAWLETLKFLNMTSLKC
Smik_11.360        DDETMSSTTSMSDPDL---LVEFFNDIDTLRRPI--LPSMLTNEAWLETLKFLNMTSLKC
YKR096W            DDEIMSSTTSISDHDL---LAEFFNDIDTLRRPI--LPSMLTNEAWLETLKFLNMTSLKC
ZYRO0B16412g       -----DLEDEQSDRMST--PEGFFGNIETLRFPY-SVPSNL--EIWNESLNYINMTSLKC
TDEL0B02140        --EEEYIDSSFSLGAQ---VQQFFDNIDSLTSPY-LFPPSL--EVWNCSLKYLNITSLHC
KNAG0C06630        VNEGTNDDHELTATLS---GPEYLDNIETLKYAI-ETPDIC---TWIKSLDFINMTSLKC
KAFR0H00180        RGPILNTSAYVNEGNI---VTEYFDNIDSLRLPI-DHPNIL---VWLKSLEHLNMTSLKC
NDAI0E05070        NSNSSNINQLFDNNYSNILCEEFFENIDLLQFPY-KIPQTI--EIWLESLKNINLISLKC
NCAS0A03170        DDINNLFSDNVMNQVT---SEEFFQNIEQLRFDY-FIPNSL--EIWMASLNHINLISLKC
KLLA0A00528g       -----PVEFSSQQQAS---TEDFFSTIDSPKVPY-EFPLDL--GVWKRSLHYINVTSMKC
AFR290W            ---------DDCAFAA---PSEFFETIDSTKYIY-KFPDDI--NIWKESLSYANVTAMKC
Ecym_4015          ----------DTFLGD---PVQFFETLNSTKTAY-RFSQDL--NIWKESLNYVNKTSMRC
SAKL0E15004g       -------DGNGSSSIS---VDHYFENIDSHRVPY-SFPQDI--QIWQQSLSYLNLTSMEC
KLTH0E00968g       ----------APSPTS---PIEYLESVDSPRFVY-EFPTDL--AIWQQSLSHINTTSIKC
Kwal_55.19678      ----------TTSHLS---PSEYLENVDSPRYAY-EFPEDL--AIWRESLSHINITSARC
                                         :   :.                 *   :   :     .

TPHA0D04640        NKLLFKKFLMLNVAISQPFILPWLLFYISVASEVAN-VTDRHVLLLWKDLLQNLLPWDDI
CAGL0H06611g       GMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIET-LRDTNSQYFWKLFIRRIFPWNTI
TBLA0E01710        SIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIES-LENIESRIFWLQFIRKIFPWNSI
Suva_9.37          SIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLET-INSEQVTAFWIHFLRRTMPWNSM
Skud_9.17          SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLET-VNSKAVSGFWIHFLRRTMPWNSM
Smik_9.18          SIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLET-INSKQVIAFWIHFLRRTMPWNSM
YIL151C            SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEM-VNSKQVVAFWIHFLRRTMPWNSI
CAGL0G02541g       GVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSET-LVDEESRYFWSSFMRRLLPLNSI
TPHA0E00190        SMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDK-HKNVAMNEFWVEFVRRIFPWNSI
Kpol_1043.73       SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEK-YQDTAMMEFWYAFIKRIFPWNSM
Suva_11.333        GMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQ-LSDPISKEFWIVIVKRIFPWDTM
Skud_11.336        GMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQ-LSDPTSKDFWMIIVKRVFPWDTI
Smik_11.360        GMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQ-LNDPISKEFWIVIIKRMFPWDTM
YKR096W            GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQ-LSDPVSKEFWMIIVKRAFPWDTM
ZYRO0B16412g       SMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKD-LNHESSRKFWVEFVDRIFPWNTI
TDEL0B02140        SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQH-ITDGASREFWLELVNRIFPWNTI
KNAG0C06630        SMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNE-LENEKNYKFWRILMKRIFPWDTI
KAFR0H00180        SVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQS-SKNTSSVKFWTIVMRRILPWNTL
NDAI0E05070        SIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSI
NCAS0A03170        SMIVLKKFLHGPLLIALPHLLPWCYFIISILLKREG-LTHEDSKIFWIGILKTIFPWNDI
KLLA0A00528g       GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ-VNDLTLKKFWIVFIRRIFPWDSL
AFR290W            SMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVIT-IPQDEIRRFWVALVRQLFPFNTI
Ecym_4015          SMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDA-IRNEDSKRFWIVFIRQIFPWESI
SAKL0E15004g       SMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISS-LSSDALKKFWLVFMRRIFPWNSL
KLTH0E00968g       SAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDE-LPSPELKDFWIALCRQVFPWNSI
Kwal_55.19678      SSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDS-LPSVELKSFWITLVRQIFPWNSI
                   .  :  .**   .  : .. : *  *  :                :*  .    :* : :

TPHA0D04640        VTYLNESIDMVNKHS--------INSK------TLRALIKNIKSC---SLYDLLYYMMYE
CAGL0H06611g       INFLNVLIAFLKDNS--------DSCS------LVNQLCETYSQL---SLDEILTNFSEN
TBLA0E01710        VSYLNVIISVLLDNC--------YENS------MITKLINNYSNK---NLDELLVEFNEN
Suva_9.37          VTFSNVLVCYMLDNL--------HP--------FLEKQLEKFYSL---ELDDLIEYFNEN
Skud_9.17          VNLANVLVCYMLDNI--------HP--------FLERELERFYSL---ELDDLIEYFNEN
Smik_9.18          VSLANVLVCYMLDNL--------HP--------FLKKELESFYSF---ELDDLIEHFNEN
YIL151C            VTLGNVLVCYMLDNL--------HP--------FLKKELEKFYSL---ELDDLIEYYNEN
CAGL0G02541g       VSFLNVLIAYALDNS--------YYST------LISSISEELDSM---DLQELLTKFNNN
TPHA0E00190        VKFLNVLLAYMVDNC--------WEQS------ILNELCPFYNSM---SLDELLTYFNEN
Kpol_1043.73       VRFLNVLLAYMIDNC--------WDNS------PLNELCDQYGSL---NLEELLRNFNAN
Suva_11.333        VTFMNILIACVLDNE--------MTSP------IIGSLCDEYSDL---NLAELLDVFKEK
Skud_11.336        VTFMNVLIAYLLDNE--------ALNP------IIGELCSKYGTL---NLAGLLESFNES
Smik_11.360        VTFMNVLIAYLLDNE--------TSNS------IIGDLCNEYSKL---NLSELLNSFNEN
YKR096W            VTFMNVLIVYLLDNQ--------TSNS------IIGDLCDDYDKL---SLSELLELFNEG
ZYRO0B16412g       VSFLNVLIAYMLDNS--------WKSS------LVDSLCGQYSSM---GLEDLLDYFNNN
TDEL0B02140        VNFLNVLIAYTLDNI--------HPSL------PIDPLCEELSTM---GLDQLVEHFNNN
KNAG0C06630        TSFLNVLLAYVLDNY--------GNTT------IIEELCMQYSDM---DLDDMLAHFNKS
KAFR0H00180        TSFLNVLLAYILDNF--------YQTE------SIAKLCETYSNF--ENFYELLDYFNRN
NDAI0E05070        VNFLNVLMVYLLDNI--------NDENFK----LIISLSNKYNSMSSSSLNEMLKFFNQN
NCAS0A03170        INFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFILDLCNKYSTM---GFADLLQHFNEN
KLLA0A00528g       ITFMNTLIHYCMVTG--------TKNF------DIDAHMSTYLPM---NREELLTSICEN
AFR290W            ITFLNVLLLYMNNQT--------QANF------PFDEYFEQFIDM---SLADLVGYFCEN
Ecym_4015          TNFLNVLLLYINDQK--------PTKF------PIDEYMANYINM---PLPELLEYFCEN
SAKL0E15004g       VSFLNTLMAFLLDNS--------RNMS------SVEKLCEEYNKM---DLHTLVEHFTNS
KLTH0E00968g       VNFLNMIIAFALDNA--------WKTS------SIDNLCEQFDSV---DVRTLVDHFSQN
Kwal_55.19678      VDFLNMLMAFVLDNN--------WKTS------PIDTLCEQLDSV---DARSLVEHFSEH
                       *  :                          .                 ::      

TPHA0D04640        S-NFQEISMCEGFIWFDSLASK---------------IKQASITTN--------------
CAGL0H06611g       E-ELPEVWNCWGSLWFDTIKNKS--------------ETSYSGLKT--------------
TBLA0E01710        EYELPEVWKCYGSLWFDVIAENYQ-------------IYSRDCSKN--------------
Suva_9.37          E-NLPEVWKCWGSLWFDA-------------------VKKCDVMEI--------------
Skud_9.17          E-NLPEIWKCWGSLWFDA-------------------IKKCDVMEI--------------
Smik_9.18          E-NLPEIWKCWGSLWFDA-------------------IKKCDVMEI--------------
YIL151C            E-NLPEIWKCWGTLWFDA-------------------IKKCDVMEI--------------
CAGL0G02541g       E-ELPEVWKCWGTLWFDAITDKS--------------NTDTNSYEK--------------
TPHA0E00190        E-ELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKG--------------
Kpol_1043.73       E-DLPEVWKCRGSLWFDIIDEKRN-------------SQNCDSYTE--------------
Suva_11.333        E-ELPEIWGCWGTLWFDTICQKNT-----------NSISSDDDFEE--------------
Skud_11.336        E-ELPEIWNCWGTLWFDTICQKNA-----------HSISSDDNFQE--------------
Smik_11.360        E-DLPEIWGCWGTLWFDAICQKNT-----------HSISSEDNFQE--------------
YKR096W            E-ELPEILGCWGTLWFDTICEKNT-----------HSISSEDNFQE--------------
ZYRO0B16412g       E-VLPEVWKCWGTLWFDTICNKE--------------QSHVEDLES--------------
TDEL0B02140        E-DLPEVWKCWGLLWFDAICDKD--------------KVQMDSYES--------------
KNAG0C06630        E-DLPEVWKCWGTLWYDAICNKN--------------SVDADTFAG--------------
KAFR0H00180        E-NLPEIWKCWGTLWFDVISNKR--------------ALNADTFNG--------------
NDAI0E05070        E-NLPEIWKCWGTLWFDVICNKN--------------INSDTTFLNQNNNNTTTTTKNNG
NCAS0A03170        E-DLPEVWKCWGTLWFDTISNKN--------------GMDADSFEN--------------
KLLA0A00528g       E-NLPECWSCWGSLWFNTISKKS--------------DLDVTTLES--------------
AFR290W            E-ELPEVWECWGTLWFDALNTKH--------------ITNLTDINS--------------
Ecym_4015          E-DLPEVWNCWGTLWFDVINSKH--------------VSNLVDIHS--------------
SAKL0E15004g       E-ELPEVWKCWGTLWFDTISNKS--------------ELKASSVQS--------------
KLTH0E00968g       E-DLPEVWKCWGALWFDVISDKS--------------DVVDEGATY--------------
Kwal_55.19678      E-DLPEIWRCWGALWFDVIADKS--------------NGEDGDVIN--------------
                   .  : *   * * :*::                                           

TPHA0D04640        ----------------ESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVIN
CAGL0H06611g       ----------------AGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE
TBLA0E01710        ----------------ISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMIT
Suva_9.37          ----------------PGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAK
Skud_9.17          ----------------PGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAK
Smik_9.18          ----------------PGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAK
YIL151C            ----------------PGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAK
CAGL0G02541g       ----------------IGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAE
TPHA0E00190        ----------------NGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLAE
Kpol_1043.73       ----------------CGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVE
Suva_11.333        ----------------VGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSR
Skud_11.336        ----------------IGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSR
Smik_11.360        ----------------IGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSR
YKR096W            ----------------IGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSR
ZYRO0B16412g       ----------------VGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAE
TDEL0B02140        ----------------AGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAE
KNAG0C06630        ----------------FGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISK
KAFR0H00180        ----------------LGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAE
NDAI0E05070        EDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIE
NCAS0A03170        ----------------LGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAE
KLLA0A00528g       ----------------TGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE
AFR290W            ----------------TGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALAL
Ecym_4015          ----------------TGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAY
SAKL0E15004g       ----------------TGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAK
KLTH0E00968g       ----------------NSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQ
Kwal_55.19678      ----------------SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ
                                    .  .    : . :.  :   ::   . : *    :   .    

TPHA0D04640        -DYPELIDVSIRGQSLTNSSCIK-NSDSL----TNDYLFDWG------------------
CAGL0H06611g       -KFD-QG-LRLTNINSLNSEEENIFTKKQ-EKRNIDFLFKFDPTYDL-----------LP
TBLA0E01710        -RFNGFGGLTISSNTSVYCNRSDIPNNHI----LRTFAFKLLPDDDNYMNNSNKNSHGPD
Suva_9.37          -KFPDLG-LKVNFQASVFCRRNDISPDYF----LKNLTFKLDPY--------------EE
Skud_9.17          -KFPDLG-LKVNFQAPVFCRRNDISPDYF----LKNFTFKLDEY--------------EE
Smik_9.18          -KFPDLG-LKVNFQAPVFCRRNDIPQDYF----LRKFTFKLDAY--------------DE
YIL151C            -KFPDLG-LKVSFQASVFCRRNDIPPDYF----LKNLTFKLDAY--------------DE
CAGL0G02541g       -TFD-IG-ITLSHTAPVYCRRDDVELNHI----LGSFSFKIEQHL-------------LN
TPHA0E00190        -SYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNA-----------------
Kpol_1043.73       -RFNGFGNLAISYNAPVINRRGLGVNSH-----LVGYSFKLMA-----------------
Suva_11.333        -SFQ-IG-VIINNESSI--NRSSLQSNNI----LGNLSYKLEP---------------LS
Skud_11.336        -TFP-IG-VIVSNDPLIKCSSSQ--SSII----LRNLVYKLEP---------------LS
Smik_11.360        -SFP-LG-VIVRHDPLVNCSSLQ--SNNI----LRDLVYKLEP---------------LT
YKR096W            -SFP-IG-VIIRNDPLIY--RSSFQNTNI----LGSLVFKLEP---------------LC
ZYRO0B16412g       -NFP-IG-ITLSPVAPVYCRRNDVSPYHI----LKSFSFKLRRGSDSELVPMN-----PP
TDEL0B02140        -NFQ-TR-LVVSSQAQVHCRRTD-PMNHV----LKSFCFKLRD-----------------
KNAG0C06630        -KFD-FG-LKISHEAGVYCRNEK-AADSP----LRRFTFKLES-----------------
KAFR0H00180        -NLQ-TG-LRVSRTAPVHCRRDDIDPNHI----LKSFSFKMEG---------------FD
NDAI0E05070        -TFPNLG-LKISHETSNYCRNTKIPQNFI----LNNFAFKLTNLYDPSLIII------PQ
NCAS0A03170        -NFDSLG-LKVSYNAGTEYRNNNVPMDNI----LKMFSFKWAG---------------SN
KLLA0A00528g       WEAC-DG-Y------GHGCKKLN-PEATS----WKNLVFRFND---------------DT
AFR290W            -ECP-VG-LR------------EISGGRN----WRSLVFKFEE---------------PP
Ecym_4015          -QFP-FG-------FTEFNGSDD----------WKSLVFKFNE---------------PP
SAKL0E15004g       -EFH-YG-IRVS-DTPISTRR-DVTTLHA----LKRFSFKFEE---------------LP
KLTH0E00968g       -EFN-MG-LTLA-SVPLQSRRSL-AAGHP----LQNFCFKFED---------------PP
Kwal_55.19678      -EFS-LG-LTLSAFAPQ--SRRPMTAGHP----LQNFSFNFEE---------------IP
                                                         :                     

TPHA0D04640        ------------------------------------------------------------
CAGL0H06611g       IDEASNK-----------YFQVYSLFTEKLPA----------------------------
TBLA0E01710        NSSNQNTTTDVMVHINQDDSSIVVDEDNVMSMLDSNLDKLDSFNSNNNAINGNIMNNNGS
Suva_9.37          DAFNDNN--------------ELDELYDTIEI----------------------------
Skud_9.17          NDHNDNN--------------ELDELYDTIEI----------------------------
Smik_9.18          GNNNDNN--------------ELDELYETIEI----------------------------
YIL151C            DNYNDNN--------------ELDDLYDTIEI----------------------------
CAGL0G02541g       GNTVQVE--------------IENCLGAIIEM----------------------------
TPHA0E00190        --SSDGV--------------MLDDI---IES----------------------------
Kpol_1043.73       --KSDDI--------------MFDDM--LVSN----------------------------
Suva_11.333        TLGSSIP--------------TLNTLEGIIDV----------------------------
Skud_11.336        NIRSNTP--------------ILTALENSVDI----------------------------
Smik_11.360        NIRSSVP--------------VLSTLESIFDI----------------------------
YKR096W            NIHNNIP--------------VLGALESIIDI----------------------------
ZYRO0B16412g       QPSTTAI--------------DLDHLKNTLEI----------------------------
TDEL0B02140        TFYNSNS--------------VLQNT---IEV----------------------------
KNAG0C06630        ---YDEP--------------TSSKFNEFIPL----------------------------
KAFR0H00180        ESSYSGQ--------------PFSTINKLLPL----------------------------
NDAI0E05070        TEQNIENENENENDDLEFNKSILSNIMEFFQI----------------------------
NCAS0A03170        ADYVDAN---LGDELEIYTNTIINRITEFVDI----------------------------
KLLA0A00528g       NDQLSVE--------------LYPEENESFPFEK--------------------------
AFR290W            SEWCDMY---------------LEPFTLVFDT----------------------------
Ecym_4015          AEWKEQY---------------LGSFSKEYGE----------------------------
SAKL0E15004g       QEWDNE---------------VFLQSDNFIKV----------------------------
KLTH0E00968g       VDSESYA--------------LISTQ---MPA----------------------------
Kwal_55.19678      AQSQ-----------------IQSFVRNQIPL----------------------------
                                                                               

TPHA0D04640        ------------------------------FELNNNNAVIIDDTLH------GRNRIFKF
CAGL0H06611g       ------------------------------FESISENNIILDAVPQ-LSVIDG-ESIFDY
TBLA0E01710        ISIDNSDENTIQNVIINDSNTERNIDTWIPFEKNSIQNTDLNCEPG-LSLIEN-ESLFEY
Suva_9.37          ------------------------------NELIETVNIDLQATPK-LSVVSG-ESIFEY
Skud_9.17          ------------------------------NEKIERVNRDLRATPN-LSVVSG-ENIFEY
Smik_9.18          ------------------------------NEKIDNVNLDLRATPN-LSVVFG-ESIFEY
YIL151C            ------------------------------NEEIEAVNMDPQATPN-LSVVSG-ESIFEY
CAGL0G02541g       ------------------------------TEMPNEVNITMDATPP-MSLQEN-ENIFEY
TPHA0E00190        ------------------------------FETPDEVNYDTHKTPM-LSMVDG-DSIFDY
Kpol_1043.73       ------------------------------FEEIDSNNSDFNAIPL-LSMIYG-ENIFEY
Suva_11.333        ------------------------------FETRSENNIDLHAVPE-LSVIKG-GSIFNY
Skud_11.336        ------------------------------SEARSKNNIDLYAVPE-LSVNSG-DNIFHY
Smik_11.360        ------------------------------SEARSEINTDLHAVPE-LSVING-DNIFHY
YKR096W            ------------------------------SEARSENNTDLHAVPE-LSVNEG-DNIFHY
ZYRO0B16412g       ------------------------------FEEASWENIHMDTIPM-LSVIEG-ESIFDY
TDEL0B02140        ------------------------------FEEGSDANKDMQMTPQ-LSVLEN-ESIFGY
KNAG0C06630        ------------------------------CEEVSAINNDALATPS-LSVVQG-ENIFEY
KAFR0H00180        ------------------------------FENIDETNLDFDARPM-LSVVKG-ENIFEY
NDAI0E05070        ------------------------------HEPIEEINLNLQLQPP-LSILGGNENIFNY
NCAS0A03170        ------------------------------KEPIHETNLNFEIPPL-KSMIAN-EDIFDY
KLLA0A00528g       ------------------------------FEIISNLNCSDNLQDGSKSMIPG-VSIENL
AFR290W            ------------------------------FEQISPVNLDQRATPY-CGMTPD-IDIRTL
Ecym_4015          ------------------------------FESISFVNTDLQSPPH-KGMVLG-TDIRTL
SAKL0E15004g       ------------------------------FEPISPINSNFEAVPS-LSMIDG-ESIFEF
KLTH0E00968g       ------------------------------FENISERNLDPNAPPG-QSMLEG-KSLFEL
Kwal_55.19678      ------------------------------FEEIATGNLDPNIRPG-QSMLEG-ESIFDF
                                                  *                    .   :   

TPHA0D04640        S----YIPDFQDFDKNGDI-------TW--------------------------------
CAGL0H06611g       VGYKKLLPCYYYYDKNGNVNKGAIYSNWEAF----------------------NQLGNGL
TBLA0E01710        EGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSSNANIINTTTNANDESNNDSSAT
Suva_9.37          TGYTRLTQDYHCFDKNGGFNSAFIYTQWSNV-------------------------GNGV
Skud_9.17          TGYTRLTPDYHCFDKNGGFNSAFIYSQWSNV-------------------------GNGM
Smik_9.18          TGYTRLAPDYHCFDKNGGFNSAFIYSQWSNV-------------------------GNGV
YIL151C            TGYTRLAPDYHCFDKNGGFNSAFIYSQWSNV-------------------------GNGV
CAGL0G02541g       TGYKRIAPELQNFDKNGELRSAANYTSWYSA----------------------QEIVPKS
TPHA0E00190        VGYKRVCPNFYSFDKNGDFISTSFFNSWSIK--------------NLTNELSRNTCSSIT
Kpol_1043.73       VGYKRIHADYYSFDKNGDLISTSFYNTWSIN----------------------QDTGVNG
Suva_11.333        TGYKKLCPNYTCFDKNGEFLSASLYTSWYVP--------------------------NGS
Skud_11.336        TGYKKLRPDYTCFDRNGEFLSASLYTRWYLP--------------------------NGN
Smik_11.360        VGYKKLRPDYTCFDKNGEFLSASLYTSWYVP--------------------------NCN
YKR096W            VGYKKLRADYTCFDKNGEFLSASLYTTWYVP--------------------------NSN
ZYRO0B16412g       AGYRRLHPDYFSYDKNGEFLSASLYTSWYAN-----------------------NNTNNT
TDEL0B02140        VGYKRLLSDLSCYDRGGEFVSTSLYTSWGNE--------------------------TSK
KNAG0C06630        MGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGT
KAFR0H00180        VGYKKLFLNNHSFDRNGELVSSSIYTAWVID-------------NDNSLNNSQGNQYTSN
NDAI0E05070        LGYKRLNFNIQSFHENGEIISGSIYSSWPID---------------YNKFKEQQQQQQQQ
NCAS0A03170        TGYKKLEPNSRSFDKNGEFSSGSIYTAWPMD-------------------------YDQL
KLLA0A00528g       QGFKLMYPDYFCFNKNGDLITASLYTKGPLE----------------TANIQGGDDFNAN
AFR290W            QGYRILLPDYYCFNRNGDMITGSLYTIGTLE----------------SSGIHGGDDFNGK
Ecym_4015          QGYKQLVPDYLCFNKNGDLITGSLYTSGMSE--------------GGSGVPNDSEDFGST
SAKL0E15004g       QGYRRMYPDYYCFNKNGDLITGSLYTSGLLE----------------RVAIQGGDDFNVK
KLTH0E00968g       PGYRQLHADHTCFNKTGTLITCSLYTSGSLE----------------KGPIHGGDDFNTE
Kwal_55.19678      PGYRQMYADYTCFNKSGSLISCSLYTSGKLE----------------RGPIQGGDDFNTE
                               :   * .                                         

TPHA0D04640        GYSLISNYDYIYSN----------DFNSEEDGNFFQRYSRR-------------------
CAGL0H06611g       KPRMENGSSFIIDGLDDS------KNFEIREKRLFAKYLECDESQESSDHLAEVEREGDE
TBLA0E01710        AGSNQNKESSNSTTNIDN------KELFLMEKEIFNKILDP-------------------
Suva_9.37          TLDVSSESLYDSTTN---------DLSLHWAKILFDKVFTI-------------------
Skud_9.17          VLDVSSESMYDAANN---------NLSPHWEKIFFDRITTA-------------------
Smik_9.18          PIDVSNEPIYDVTDN---------DLSLHWEKIFFDRIAAA-------------------
YIL151C            TLDVSGESIYDVANN---------NLSLHWEKIFFDKIAAA-------------------
CAGL0G02541g       AASPENSVAGSSPGRS--------FQSQDVEENIFSVFTNE-------------------
TPHA0E00190        DDAISSGSGNDSAAAST-------NNDPMNELLVFNECFDP-------------------
Kpol_1043.73       GPLSNNSSSSNAA-----------SSDPMNEKELFNKCFDP-------------------
Suva_11.333        N-NPETNINSNCE---------------KENEGQFLECLKS-------------------
Skud_11.336        N-ISEALVNSDIE---------------KGDEDLFLECMKP-------------------
Smik_11.360        N-NLETNISYANE---------------RENEALFLECMKS-------------------
YKR096W            NTNIEDNINYNSE---------------KENEGLFLECIKS-------------------
ZYRO0B16412g       GVIPAHGSDVDSQRD---------AVQSVQEMHIFNQIMEP-------------------
TDEL0B02140        NEIPQSEPT---------------QQQTANEADLFIEGINT-------------------
KNAG0C06630        PISASLSAAGKTTTSHVTDD----QDPGLNENDLFKKFMSL-------------------
KAFR0H00180        MQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNP-------------------
NDAI0E05070        EHLVNDSTMKNENVT---------VGDITPEDASFKEFMKL-------------------
NCAS0A03170        ILAQNNNNNTNATDEMTDLF----TGTLSIDELSFRQLKRP-------------------
KLLA0A00528g       KILDNGRLVVQDRLEYS-------SAIDKLEQPWLEAFMNP-------------------
AFR290W            RLLENGELVSTERRDYN-------SLIDREEQPIMDEFLRH-------------------
Ecym_4015          KRLLENELLVTSERRDYN------NLLDKEETPIIDEFLKW-------------------
SAKL0E15004g       RHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDP-------------------
KLTH0E00968g       RYSRSDELNKADNPQI--------KELDKMERMWLDTCMNP-------------------
Kwal_55.19678      RYGRSEDSNKPENAQI--------TELERLERDWLDNCMNP-------------------
                                                     :                         

TPHA0D04640        --------------LLSAHNDYSEDKSKKY--------LPKLENNYFMVDTLAWLKHSNK
CAGL0H06611g       TEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEM--RVAYYSTYFIFDATTWLRHFAH
TBLA0E01710        --------------DYKNIDEIWRGEMFHD--T-----SIQFSDTYFVLDATSWLRHFAH
Suva_9.37          -------------------GKNTD--------------DDGSCSVYFVIDATSWLRHFAH
Skud_9.17          -------------------GHNGD--------------KNGNCSVYFVIDATSWLRHFAH
Smik_9.18          -------------------YKNCD--------------ENDNCTIYFVVDATSWLRHFAH
YIL151C            -------------------SKGSD--------------ENYNCTLYFVIDATSWLRHFAH
CAGL0G02541g       -------------------EENSTSLLD----------GLNLETTSFVLDATSWLRHSAH
TPHA0E00190        --------------KYKTLEEFWSQEIYPD--SQTN--ISLQGKTYFILDATSWLRHFAH
Kpol_1043.73       --------------EYDSVDEFWNKEIYDD--IGRKFGMELYEDTYFILDATSWLRHFAH
Suva_11.333        -------------------------DDR----------EIDLNTTYFVFDATSWLRHSAR
Skud_11.336        -------------------------DCP----------GIDFETTYFVFDATSWLRHSAR
Smik_11.360        --------------------VHPEIAYP----------EIDFKTTYFVFDATSWLRHSAR
YKR096W            -------------------------DYP----------EIDFKTTYFVFDATSWLRHSAR
ZYRO0B16412g       --------------GYC--GGFADDLFLRD--ALYQ--TAHSSTTYFVLDTTTWLRHFGH
TDEL0B02140        ------------------SLTEFNIDFPEC--------KMNGKDTFFVLDATSWLRHFAH
KNAG0C06630        ---------GDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAH
KAFR0H00180        --------------EKL--NKNMDQASIWT--TAND--EINRNITYFVFDATSWLRHFAH
NDAI0E05070        -------------SFHLKLSTRSNNSQTQNTHKMGV--SINKHRTFFVFDATSWLRHFAH
NCAS0A03170        --------------EFRDKSTLLSSTSTE---------PFNRYKTYFVFDATSWLRHFAH
KLLA0A00528g       --------------DFRQ-RELLNRSFLGN---LNC--QADTNVTFFVLDATTWLRHFAH
AFR290W            --------------THCKNDVRWEQMLPRG--DLHC--FADTHVTYFVLDATTWLRHFGH
Ecym_4015          --------------RYSSTNSRWEQCLPRG--DLQY--FTDTHVTYFVLDATTWLRHFGH
SAKL0E15004g       --------------AFM--ESLRDSRFPHG--DLAC--NADSNVTYFVLDATSWLRHFAH
KLTH0E00968g       --------------EFI--EQTYDMKFPFG--DLSC--NCDSGVSYFVPDATSWLRHFAH
Kwal_55.19678      --------------EFI--EQAYEMKFPFG--DLSC--NCDSGVSYFVLDATSWLRHFAH
                                                                 *: *: :**.*  .

TPHA0D04640        LKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEF
CAGL0H06611g       IYKIAYSGLLNFVICLTTFQELRFLRR-SRDENVMEAATRAVIVIRLLYKLKKVIPLRFN
TBLA0E01710        VYKLATNGILKFAICLTTFQELRFLRK-SKDENVMEAATRAIITLRQLYSEKRLLPLRFT
Suva_9.37          IFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDEKKIIPMRFT
Skud_9.17          IFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDEKKIIPLRFT
Smik_9.18          IFKLAKNSILDFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDERKIIPMRFT
YIL151C            IFKLAKNNTLKFAICLTTFQELRYLRG-SKDDTVVEAATRSVITIRQLYDEKKIIPMRFT
CAGL0G02541g       IYKLASNSFLVFSICLTTFQELRFLRK-SKDENVMEAAARAIIIIRQLYSDGKVIPLRFT
TPHA0E00190        IYKIATSKILKFAICLTTFQELRYLRK-SKDHNVVEAATRAIITLRQLYHENNLLPLRFT
Kpol_1043.73       VYKIATNSILKFSICLTTFQELRFLRK-SKDENVVEAATRAIITLRQLFSEGKLLPLRFT
Suva_11.333        IFKLAQNRLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFT
Skud_11.336        IFKLAQNRLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYEDKVLPLRFT
Smik_11.360        IFKLAQNRLLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYCEDKVLPLRFT
YKR096W            IFKLAQNRLLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFT
ZYRO0B16412g       IYKLASSGVLKFAICLTTFHELRFLRK-PKDENVVEAATRAIITVRQLYSEGKLLPLRFT
TDEL0B02140        VYKLASNQVLQFAICLTTFQELRFLRK-SKDENVVEAATRAVITVRQLYTENRILPLRFT
KNAG0C06630        IYKIATNGVLKFGVCLTTFQELRFLRK-SKDENVVEAAARAIITMRQLYRENRLLPLRFT
KAFR0H00180        IYKLSTNNVLNFAVCLTTFQELRFLRK-SKDENVVGAAARAIITMRQLYSEGKLLPLRFT
NDAI0E05070        IYKLSKNGFLKFAVCLTTFQELRFLRK-SKDGNVVEASTRAIITMRQLYKEGKLLPLRFT
NCAS0A03170        IYKLASNHVLKFAVCLTTFQELRFLRK-SKDANVVEASTRAIITMRQLYSDGNLLPLRFT
KLLA0A00528g       IYKLATSSVLKFAICLTTFQELRFLRK-SKDESVLEAATRAVIAVRQLYYERKLLALRFT
AFR290W            VYKLAANNILKFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLYYERKLLPLRFT
Ecym_4015          VYKLATSNLLKFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLYYERKLLPLRFT
SAKL0E15004g       VYKLATNNVLKFAICLTTFQELRFLRK-SKDESVVEAATRAVITARQLYYERKLLPLRFT
KLTH0E00968g       VYKLATNGVLRFAICLTTFQELRFLRK-SKDESVVEAATRAVITVRQLYSEKRLLPLRFT
Kwal_55.19678      VFKLATNNVLRFGICLTTFQELRFLRK-SKDESVVEAATRAVITVRQLYSDKKLLPLRFT
                   : .:  .  : . :.:: :::*. *.  .   .*  :::* :*  . *:   .:  :.  

TPHA0D04640        ESPISKALKNIDGSQILNFNG---KFKNDLLTKENGP--G-----------QQLNMIEL-
CAGL0H06611g       GKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF-----------DELHNESAK
TBLA0E01710        GNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLK--R------RDNRNQEDSNVTSS
Suva_9.37          GNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQN--F-----------QTERTIDKN
Skud_9.17          GNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQN--F-----------QTERLIDKN
Smik_9.18          GNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQN--F-----------QTERMIAEN
YIL151C            GNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR--F-----------QAERLTDEN
CAGL0G02541g       GNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKK--F----------LQPFVQNPVD
TPHA0E00190        GNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK--R----------TDRLNDINMD
Kpol_1043.73       GNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK--R-----------KEQEMHNM-
Suva_11.333        GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK--L-----------ENANQLPVS
Skud_11.336        GNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEK--L-----------ENAGQPHVT
Smik_11.360        GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK--L-----------ENAKQPNIS
YKR096W            GNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEK--L-----------ESASEPRLS
ZYRO0B16412g       GNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSK--F-----------QEMNQLQLE
TDEL0B02140        GNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQAR--L-----------SQEN-----
KNAG0C06630        GNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDK--F-----------TTAGETKQP
KAFR0H00180        GNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNK--F-----------ISANESVTL
NDAI0E05070        GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQER--FKTKSIQNYNLYNDDDDDDDD
NCAS0A03170        GNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEK--F----------VKSKTVENME
KLLA0A00528g       GNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK--F-----------NVLNNDAIE
AFR290W            GNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDK--F-----------NALNDDAKA
Ecym_4015          GNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSK--F-----------NQLNKDAKA
SAKL0E15004g       GNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRK--F-----------KGLNLQARD
KLTH0E00968g       GNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK--F-----------EALNAQAKE
Kwal_55.19678      GNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKK--F-----------EAINAQAKE
                    .      :::: .: :.:     :*  : : . :                         

TPHA0D04640        ---------------------------RMDNV---------------VVVSDDKLSLATF
CAGL0H06611g       ADFDAENMDTADSADTKQRGNSNASTNSKVLS---------------VLVTDDRNMDSKA
TBLA0E01710        NNNPIINNNENNGNLNV---------TDMIFV----------------LVTDDISMIKKR
Suva_9.37          KG------------------------RSKEFA---------------VLVTDDDNMNQKA
Skud_9.17          KN------------------------KNNAYA---------------VLVTDDDNMDGKA
Smik_9.18          KN------------------------KNKQFA---------------VLVTDDDNMNKKA
YIL151C            KN------------------------KGKEFA---------------VLVTDDDNMNQKA
CAGL0G02541g       --------------------------NDSRFF---------------VLVSDDENMKRKA
TPHA0E00190        TDEKE---------------------KSIFGI---------------ILVTDDITMKNKA
Kpol_1043.73       --------------------------KGFQIV----------------LVTDDSNMKNKA
Suva_11.333        S-------------------------CRFNYV---------------ILISDDDTMKKKA
Skud_11.336        P-------------------------RHSNYV---------------VLISDDDTMKKKA
Smik_11.360        S-------------------------HRFNYV---------------VLISDDDTMKKKA
YKR096W            P-------------------------RRFNYV---------------VLISDDDAMKKKA
ZYRO0B16412g       QEEQQHQLRAHDDR------------SGLKFV---------------VLVTDDSNMRKKA
TDEL0B02140        --------------------------RDFHHV---------------VLVTDDANMRRKA
KNAG0C06630        EEEGTGPPRVPLGG------------KRFHYV---------------TLVTNDQNMKRKA
KAFR0H00180        R-------------------------KGFNHV---------------VLVTDDINMKRKA
NDAI0E05070        TKTGTTTLSNTSVGVDNNVN--N---SRNTNVENELVTGFSSPTPLPIDVTADDKMN-KN
NCAS0A03170        GTSNWGEIDATTTTVSAEEEEKS---NLFKYV---------------VLITDDDSMRMKA
KLLA0A00528g       KGKDCIPLSEDGQST-----------QRFNFV---------------SLVTDDFNMRNKA
AFR290W            ASRDCIPTGAD---------------QRFNFI---------------ALVTDDLNMRNKA
Ecym_4015          SGRESITTIDD---------------GKFNFI---------------ALVTDDINMRNKA
SAKL0E15004g       QGQEYIPTDPKDD-------------DKFNFV---------------VLVTDDLNMRTKA
KLTH0E00968g       GGHDFIPTTEE---------------EPFHFI---------------ALVSDDTNMRLKA
Kwal_55.19678      AGHDFIATTDE---------------EPFHFV---------------ALVSDDTNMRVKA
                                                                    :: *     . 

TPHA0D04640        K----KKGYNVVSTKVLFSV-------ASLQ-----------------------------
CAGL0H06611g       K----ERGIRTCSTRFIFSI-------CSQL-----------------------------
TBLA0E01710        QEEKSDNDIITFSTKFVFSL-------CNMLVNKFNYPREMTPMSNNNPIDGGIHQSQES
Suva_9.37          K----DKMIKTCNTKYLFSL-------GSKL-----------------------------
Skud_9.17          K----DKMIKTCNTKYLFSL-------GSKI-----------------------------
Smik_9.18          K----DKMIKTCNTKYLFSL-------GSKL-----------------------------
YIL151C            K----DRMIKTCNTKYLFSL-------GSKL-----------------------------
CAGL0G02541g       H----EKEIRTFTTRFVFAL-------CSEM-----------------------------
TPHA0E00190        M----DRKIKTFSTRFIFSM-------ANYI-----------------------------
Kpol_1043.73       L----EKGSKTFSTRFVFAI-------SNYL-----------------------------
Suva_11.333        E----EKKIKTLSTRFVFSL-------CTKL-----------------------------
Skud_11.336        E----EKEIKTLSTKFVFSL-------CTKL-----------------------------
Smik_11.360        E----EKKIRTLSTRFVFSL-------CTKL-----------------------------
YKR096W            E----EKEIKTLSTRFVFSL-------CTKL-----------------------------
ZYRO0B16412g       Q----DQDVRTFSTKFVFSL-------CNSI-----------------------------
TDEL0B02140        Q----QHAIHTLSTRFVFAT-------CNAV-----------------------------
KNAG0C06630        Q----DQGIKTFSTDFVFSL-------CSKL-----------------------------
KAFR0H00180        Q----EQGIKTFTTHFIFSV-------CRKL-----------------------------
NDAI0E05070        Q----INDIANANATSDIDIDIDANDDEGEL-----------------------------
NCAS0A03170        Q----LKGISTFGTQVVFSV-------CSMM-----------------------------
KLLA0A00528g       Q----QLGIRTFSTRFVFAI-------CREL-----------------------------
AFR290W            G----AQNIKAFSTRFMFSV-------CNEL-----------------------------
Ecym_4015          R----AQSIRAFSTKFMFAI-------CHEI-----------------------------
SAKL0E15004g       E----AHDIHIFSSRFMFAF-------CNQL-----------------------------
KLTH0E00968g       H----AQRIRTFSSRFMFAV-------CNQI-----------------------------
Kwal_55.19678      H----TQRIQTFSTRFMFAV-------CNQI-----------------------------
                                :   :                                          

TPHA0D04640        ---------------DWLL
CAGL0H06611g       -------GMKYGICTN---
TBLA0E01710        DITIASPAITNKVCIN---
Suva_9.37          -------GINSGLCTN---
Skud_9.17          -------GINSGLCTN---
Smik_9.18          -------GINSGLCTN---
YIL151C            -------GINSGLCTN---
CAGL0G02541g       -------GKGRLICTN---
TPHA0E00190        --RTMEEGHNK-LAIN---
Kpol_1043.73       ---RTIDESKRQLAIN---
Suva_11.333        -------GEQRHLCTD---
Skud_11.336        -------GEKRHLCTD---
Smik_11.360        -------GEQRHLCTD---
YKR096W            -------GEQRHLCTD---
ZYRO0B16412g       -------GLRSKICTN---
TDEL0B02140        -------GNRLKICTN---
KNAG0C06630        -------GMSLDLCTN---
KAFR0H00180        -------GIQDNVCTN---
NDAI0E05070        -------FLLMKKISNMLF
NCAS0A03170        -------GIDEGVCTN---
KLLA0A00528g       -------GRETGVCTN---
AFR290W            -------GHAKNVCTN---
Ecym_4015          -------GLSKKVCTD---
SAKL0E15004g       -------GYNQKVCIN---
KLTH0E00968g       -------GLAHHACTN---
Kwal_55.19678      -------GLAHQACTN---
                                  :   

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0D04640
-------------------------MSAYTGNMNKDNKRILQSI----------------
-----------------------------------------------DEPWFSLKFRKVS
P----------------------------------------------SVKEYGSQSKGDL
DSKKCS--ETEPVT----------------------------------------------
------------------------PESETVSPIA--------------------------
----------------------------------PIKPVNSS------------------
------------------------------------------------------------
---QHSKPVADIEKSIEIDHMLNADEK---------------------------------
---------------------------------------------------LDPLAGLLP
LFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNIN
NTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFI
QSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVA
VNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAID
KIISKLLNKQVNLKQSMGGT-------------------------TILMKYF-----TLL
SLFFGSTSSSQLSGMERSSLHYFWNEFAN-------------------------------
----EYHL---------NY--------SSLRKPVNCKYRQKEINYSMFYFNNAPLFSLIS
IVETIIMNKKLNPFFCVYK-----------------------------------------
------------------------------------------------------------
---------------S---SDDF--EIKSVSLSN-----------WKILIEQMDDTLLHS
NKLLFKKFLMLNVAISQPFILPWLLFYISVASEVAN-VTDRHVLLLWKDLLQNLLPWDDI
VTYLNESIDMVNKHS--------INSK------TLRALIKNIKSC---SLYDLLYYMMYE
S-NFQEISMCEGFIWFDSLASK---------------IKQASITTN--------------
----------------ESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVIN
-DYPELIDVSIRGQSLTNSSCIK-NSDSL----TNDYLFDWG------------------
------------------------------------------------------------
------------------------------FELNNNNAVIIDDTLH------GRNRIFKF
S----YIPDFQDFDKNGDI-------TW--------------------------------
GYSLISNYDYIYSN----------DFNSEEDGNFFQRYSRR-------------------
--------------LLSAHNDYSEDKSKKY--------LPKLENNYFMVDTLAWLKHSNK
LKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEF
ESPISKALKNIDGSQILNFNG---KFKNDLLTKENGP--G-----------QQLNMIEL-
---------------------------RMDNV---------------VVVSDDKLSLATF
K----KKGYNVVSTKVLFSV-------ASLQ-----------------------------
---------------DWLL
>CAGL0H06611g
-MGSSPIEHSIKGKHVYDRKSKLTDNNFNSNNFINNNNSIPGFTQGLH------------
-----------------------------------------------QKRHNSSANNHTR
DT-IVKRRLPVQSDENP------------------------------IGNFLDSFSKNSS
PLQQ----CRTPGSRPHSVTKKTSNIDN------------------------TDMVGRSN
AIGGYSDNANMSNKS---------PAEFNAGPVN-KNHTGNSLLDNIANSANRVDIPGSP
F---------------------------------YLPTRTHSNILETTQADAPLHPV--N
------------------------------------------------------------
---SSEVEQESIGPELNLIEEQYNSNL------------------ENGEINYNT------
-----EVSDFESLPTKDANSVTSTEYEKGTRTAMTSH-QSILPTTWNRST-QALISKLQD
IYKSILVQEVELQNCCSA---ITSSQTTDLKKIWEV--YKINVELVNNYVIFITTALLPS
QSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFM----------DPEICCQFI
IHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWY-----GEA
MKYTYGVGK----------LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVID
NIYQRAY-----ISRG-EES------SSNV---------------Q-ILDYLKHNEIMVL
PNFMENFE------LQRMAYVYFSEKFGQ-------------------------------
----DFVG---------NN--------FFDTRSMFVQ-NLESVK---FYFRHSPLFAQAH
ILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKS------------------------
-------------------------------------------KTGVDNMSID-------
---TLSFQVSGNEIHD---VGEYFNSLENIDKEF-TLPPNV--DIWIQSLQYTNTTGIFC
GMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIET-LRDTNSQYFWKLFIRRIFPWNTI
INFLNVLIAFLKDNS--------DSCS------LVNQLCETYSQL---SLDEILTNFSEN
E-ELPEVWNCWGSLWFDTIKNKS--------------ETSYSGLKT--------------
----------------AGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE
-KFD-QG-LRLTNINSLNSEEENIFTKKQ-EKRNIDFLFKFDPTYDL-----------LP
IDEASNK-----------YFQVYSLFTEKLPA----------------------------
------------------------------FESISENNIILDAVPQ-LSVIDG-ESIFDY
VGYKKLLPCYYYYDKNGNVNKGAIYSNWEAF----------------------NQLGNGL
KPRMENGSSFIIDGLDDS------KNFEIREKRLFAKYLECDESQESSDHLAEVEREGDE
TEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEM--RVAYYSTYFIFDATTWLRHFAH
IYKIAYSGLLNFVICLTTFQELRFLRR-SRDENVMEAATRAVIVIRLLYKLKKVIPLRFN
GKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF-----------DELHNESAK
ADFDAENMDTADSADTKQRGNSNASTNSKVLS---------------VLVTDDRNMDSKA
K----ERGIRTCSTRFIFSI-------CSQL-----------------------------
-------GMKYGICTN---
>TBLA0E01710
-------------------MFKSIFPNDQSVNVNLFHNNHNNS-----------------
-----------------------------------------------ITKATTTKNNFLN
NIAMVTTPISK------------------------------------SKLNTNSNTFGTA
ANSSKR--QHSTSINSDVKRRTPKK---------------------------IEDLTSAS
QFAISS-------RS---------NSLFNKTQSQLQLQLQMQLQIQSQSQSQ--------
----------------------------------SQSDISRDTSNNDATTNNIFFAK--D
KVKEIEKTVPDDKVNTTLNPMHNFSSP-----NDFQTTTFQDNHPQGT------------
---SQSIPAHNSNNNNLSASNESTNQQ-------------------NYQDNNAN------
-----NNSQNDQQDSSQGNNNNNNNNNSNNNN------NNNQQNSIKKSN-QNLIQKLQN
IYKLIVSQELELQDKCNK---LSTSQSTKLKYLWSI--YKLNHDLINNYILFILTSLSPS
QSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFM----------DPEILSQFI
THVFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWY-----IES
MKFTFSHGK----------LYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVID
NIYQRAF-----IERNSNSSSSNNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLL
PNFLENDH------LKTVVLNYFTNSFGKIAIQSNLSDPSNPNLNTNSGSNTSISGQANI
ENINNGHNIPSSSNVITSESLQINAINLFNFRNIFKQKNSDILK---YFFKNSATFAESH
ILQLIGFGDPKNPFALLFQLPKYLKERKTKRKSKASNSNSNMNTNTTVNANISSNTIPSS
DVSMKYETNSDSSNPTNSKSSLYKSSNSNIVMSSSTTSFATAISTTNNSISSNMDVDTEL
QNNGMEDEDEMLDNLS---PQDFFNNLESLKLSF-FLPNSL--EIWNESLKYINIISLNC
SIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIES-LENIESRIFWLQFIRKIFPWNSI
VSYLNVIISVLLDNC--------YENS------MITKLINNYSNK---NLDELLVEFNEN
EYELPEVWKCYGSLWFDVIAENYQ-------------IYSRDCSKN--------------
----------------ISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMIT
-RFNGFGGLTISSNTSVYCNRSDIPNNHI----LRTFAFKLLPDDDNYMNNSNKNSHGPD
NSSNQNTTTDVMVHINQDDSSIVVDEDNVMSMLDSNLDKLDSFNSNNNAINGNIMNNNGS
ISIDNSDENTIQNVIINDSNTERNIDTWIPFEKNSIQNTDLNCEPG-LSLIEN-ESLFEY
EGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSSNANIINTTTNANDESNNDSSAT
AGSNQNKESSNSTTNIDN------KELFLMEKEIFNKILDP-------------------
--------------DYKNIDEIWRGEMFHD--T-----SIQFSDTYFVLDATSWLRHFAH
VYKLATNGILKFAICLTTFQELRFLRK-SKDENVMEAATRAIITLRQLYSEKRLLPLRFT
GNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLK--R------RDNRNQEDSNVTSS
NNNPIINNNENNGNLNV---------TDMIFV----------------LVTDDISMIKKR
QEEKSDNDIITFSTKFVFSL-------CNMLVNKFNYPREMTPMSNNNPIDGGIHQSQES
DITIASPAITNKVCIN---
>Suva_9.37
-------MVDI--------MAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLH----
-----------------------------------------------QKRHSSSSHNDTP
ESSFAKRRVPGVVEPV-------------------------------GKGFIDGITTSQI
SM------QNIPFKAEDISRRPSISRKA------------------------METTPQLH
TSSNSAMDIP---KS---------PYYVNRTAIT--------------------------
----------------------------------RNMEVVSKESH---------------
------------------------------------------------------------
---DENGPQTRADDSLTTSTGIYANSQ---------------------------------
-----PQSQITLSDTRAAPIVANSLP------------SVTRQLPSAQPN-QTFIKKLQE
IYKIIVVQETELQQRCLY---LTTSQTTELKSLWAI--YKLNTELIKNYINFIITALLTT
QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFM----------DPEVCCQFI
TYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
MKYIYGCGK----------LYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIE
NIYQSAF-----IDRSSGNTNNNETAHRNS---------------Q-LIDYLKHTEVMLL
PSFLENLD------LQHVVLLYFKDKFGK-------------------------------
----DFNG---------ND--------VFSTKDMFCQ-NPESLR---YYFRHAPAFAESQ
ILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKS------------------------
-------------------------------------------GAAEIPHYRD-------
---------PFDDQGS---SESYFQNIDTLNSDFNDPPTNI--GIWLDSLNYINMTSIQC
SIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLET-INSEQVTAFWIHFLRRTMPWNSM
VTFSNVLVCYMLDNL--------HP--------FLEKQLEKFYSL---ELDDLIEYFNEN
E-NLPEVWKCWGSLWFDA-------------------VKKCDVMEI--------------
----------------PGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAK
-KFPDLG-LKVNFQASVFCRRNDISPDYF----LKNLTFKLDPY--------------EE
DAFNDNN--------------ELDELYDTIEI----------------------------
------------------------------NELIETVNIDLQATPK-LSVVSG-ESIFEY
TGYTRLTQDYHCFDKNGGFNSAFIYTQWSNV-------------------------GNGV
TLDVSSESLYDSTTN---------DLSLHWAKILFDKVFTI-------------------
-------------------GKNTD--------------DDGSCSVYFVIDATSWLRHFAH
IFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDEKKIIPMRFT
GNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQN--F-----------QTERTIDKN
KG------------------------RSKEFA---------------VLVTDDDNMNQKA
K----DKMIKTCNTKYLFSL-------GSKL-----------------------------
-------GINSGLCTN---
>Skud_9.17
-------MVDP--------MAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLH----
-----------------------------------------------QKRHSSSSHNDTP
ESSFVKRRVPGVVEPV-------------------------------GKGFIDGIASGQV
SV------QNTPSKTDDISRRPSISRKA------------------------METTPKVN
TASISTIDVP---KS---------PYYMNKSAIT--------------------------
----------------------------------RNMEVVSRGNYA--------------
------------------------------------------------------------
---ENTTSQMRTDESMATSNGIYSNSQ---------------------------------
-----PQSQVTLSDFRTAPAFATSPP------------PVTRQLPSAQPN-QTFIKKLQE
IYRIIVVQETELQQRCLF---LTTSQTTELKSLWAI--YRLNTELIKNYINFIITALLTT
QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFI
IYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
MKYIYGCGK----------LYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIE
NIYQSAF-----IDRSSAGTNNNETAHRNS---------------Q-LIDYLKHTEVMLL
PSFLENMD------LQHVVLMYFKDKFGK-------------------------------
----DFNG---------ND--------IFDTKDMFCQ-NPESLR---YYFRHAPAFAESQ
LLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKS------------------------
-------------------------------------------GATEVPQYRD-------
---------PFDDQIS---SESYFQNIDSLTSNFDDIPTNL--NIWLDSLNHINMTSIQC
SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLET-VNSKAVSGFWIHFLRRTMPWNSM
VNLANVLVCYMLDNI--------HP--------FLERELERFYSL---ELDDLIEYFNEN
E-NLPEIWKCWGSLWFDA-------------------IKKCDVMEI--------------
----------------PGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAK
-KFPDLG-LKVNFQAPVFCRRNDISPDYF----LKNFTFKLDEY--------------EE
NDHNDNN--------------ELDELYDTIEI----------------------------
------------------------------NEKIERVNRDLRATPN-LSVVSG-ENIFEY
TGYTRLTPDYHCFDKNGGFNSAFIYSQWSNV-------------------------GNGM
VLDVSSESMYDAANN---------NLSPHWEKIFFDRITTA-------------------
-------------------GHNGD--------------KNGNCSVYFVIDATSWLRHFAH
IFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDEKKIIPLRFT
GNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQN--F-----------QTERLIDKN
KN------------------------KNNAYA---------------VLVTDDDNMDGKA
K----DKMIKTCNTKYLFSL-------GSKI-----------------------------
-------GINSGLCTN---
>Smik_9.18
-------MVDL--------MVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLH----
-----------------------------------------------QKRHSSSSHNDTP
ESSFAKRRVPGVVEPV-------------------------------GKGFIDGVTNGQI
SA------QNTPSKVDDVSRRPSISRKV------------------------MESTPQAK
TASISTMDVP---KS---------PYYVNRTAVA--------------------------
----------------------------------RNMEVVSKESYD--------------
------------------------------------------------------------
---ENANPQMRIDESLVASNGIYNNSQ---------------------------------
-----PQSQVTLPDIRKAPVVASSPP------------PVVRQLPSAQPN-QTFIKKLQE
IYKIIVVQETELQQRCLY---LTTSQTTELKSLWAI--YRLNTELIKNYINFIITALLTT
QPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFI
IYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
MKYIYGCGK----------LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIE
NIYQSAF-----IDRGSSGTNNNETAHKNS---------------Q-LIDYLKHTEVMLL
PSFLENMD------LQHVVLMYFKNKFGK-------------------------------
----DFNG---------ND--------VFDTKDMFCQ-NPESLR---YYFRHAPAFAESQ
LLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS------------------------
-------------------------------------------SATETPQYRD-------
---------PFHDKKS---PESYFQNIDALSSNFDDIPTNL--NIWLESLNHINMTSIQC
SIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLET-INSKQVIAFWIHFLRRTMPWNSM
VSLANVLVCYMLDNL--------HP--------FLKKELESFYSF---ELDDLIEHFNEN
E-NLPEIWKCWGSLWFDA-------------------IKKCDVMEI--------------
----------------PGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAK
-KFPDLG-LKVNFQAPVFCRRNDIPQDYF----LRKFTFKLDAY--------------DE
GNNNDNN--------------ELDELYETIEI----------------------------
------------------------------NEKIDNVNLDLRATPN-LSVVFG-ESIFEY
TGYTRLAPDYHCFDKNGGFNSAFIYSQWSNV-------------------------GNGV
PIDVSNEPIYDVTDN---------DLSLHWEKIFFDRIAAA-------------------
-------------------YKNCD--------------ENDNCTIYFVVDATSWLRHFAH
IFKLAKNSILDFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDERKIIPMRFT
GNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQN--F-----------QTERMIAEN
KN------------------------KNKQFA---------------VLVTDDDNMNKKA
K----DKMIKTCNTKYLFSL-------GSKL-----------------------------
-------GINSGLCTN---
>YIL151C
-------MVDL--------MVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLH----
-----------------------------------------------QKRHSSSSHNDTP
ESSFAKRRVPGIVDPV-------------------------------GKGFIDGITNSQI
SA------QNTPSKTDDASRRPSISRKV------------------------MESTPQVK
TSSIPTMDVP---KS---------PYYVNRTMLA--------------------------
----------------------------------RNMKVVSRDTYE--------------
------------------------------------------------------------
---DNANPQMRADEPLVASNGIYSNSQ---------------------------------
-----PQSQVTLSDIRRAPVVAASPP------------PMIRQLPSAQPN-QTFIKKLQE
IYKIIVVQETELQQRCLY---LTTSQTTELKSLWAI--YRLNTELIKNYINFIITALLTT
QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFI
IYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TES
MKYIYGCGK----------LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIE
NIYQSAF-----IDRSSGSANNNEIAHRNS---------------Q-LIDYLKHTEVMLL
PSFLENMD------LQHVVLMYFKDKFGK-------------------------------
----DFNG---------ND--------VFDTKDMFCQ-NPESLR---YYFRHAPAFAESQ
LLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS------------------------
-------------------------------------------EATETSSYTD-------
---------PFDVQIS---SESYFQNIDALNSSFNDIPTNL--NIWLDSLNHINMTSIQC
SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEM-VNSKQVVAFWIHFLRRTMPWNSI
VTLGNVLVCYMLDNL--------HP--------FLKKELEKFYSL---ELDDLIEYYNEN
E-NLPEIWKCWGTLWFDA-------------------IKKCDVMEI--------------
----------------PGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAK
-KFPDLG-LKVSFQASVFCRRNDIPPDYF----LKNLTFKLDAY--------------DE
DNYNDNN--------------ELDDLYDTIEI----------------------------
------------------------------NEEIEAVNMDPQATPN-LSVVSG-ESIFEY
TGYTRLAPDYHCFDKNGGFNSAFIYSQWSNV-------------------------GNGV
TLDVSGESIYDVANN---------NLSLHWEKIFFDKIAAA-------------------
-------------------SKGSD--------------ENYNCTLYFVIDATSWLRHFAH
IFKLAKNNTLKFAICLTTFQELRYLRG-SKDDTVVEAATRSVITIRQLYDEKKIIPMRFT
GNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR--F-----------QAERLTDEN
KN------------------------KGKEFA---------------VLVTDDDNMNQKA
K----DRMIKTCNTKYLFSL-------GSKL-----------------------------
-------GINSGLCTN---
>CAGL0G02541g
-------MPQTFIQQ----PFGLPDSDTGLSRNNSNSPSARDILLEKNVTNE--------
-----------------------------------------------QRYPRKDGYNYSH
NISKTNTSINTNTNTTNLREKFSKIGK--------------------DTSRYNRTALHIL
DSLKKNKLLLQGQLQDKSSRRSSLEGENNFEVY-------------------TYQNPIDE
NKQNGEESAS--------------PKLMLSRSTSKVNDLNDSILVQFDDRSKLNSRRSSI
FEPANVDMGINNDLASKEIGIDNVTKSISRLANSNDYVVSRSHNEEISQIAGNPRVK--K
YLSKRGALKGDSIDNKADQKLYMYGNGENRIESHTETGHFEQHAFGNCNDV---------
---VKGNPDINGYENIDDDDGQYPNEP--------EDCSNE----FNNDDTDTT------
-----DTNQRKNNEESKDDEEEDEDQGNNSN-------SNDKANNSNKPT-QALVQKLQD
IYKNIVRQEVELQEKCAQ---LTSSQTTDLNSIWSI--YRINVELVTNYVTFISTALLSS
QSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFM----------DPEVCSQFI
THVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWY-----NQA
LKYTYGYGK----------LYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVID
NIYQRAF-----IERG-SNN------TRNS---------------Q-LIEYLKHSEVMLL
PNFIGNEN------LQKVVMTYFEHKFGT-------------------------------
----DLHD---------LN--------IFQPRDIFLQ-NPENLK---YFFRHAPAFAESH
ILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS---------------------
----------------------------------------GEPTSNESVMSLD-------
-------NISTDSLIS---SDQYFSNLESMQHPY-LPPPRY--DIWLKSLSYLNLTAVQC
GVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSET-LVDEESRYFWSSFMRRLLPLNSI
VSFLNVLIAYALDNS--------YYST------LISSISEELDSM---DLQELLTKFNNN
E-ELPEVWKCWGTLWFDAITDKS--------------NTDTNSYEK--------------
----------------IGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAE
-TFD-IG-ITLSHTAPVYCRRDDVELNHI----LGSFSFKIEQHL-------------LN
GNTVQVE--------------IENCLGAIIEM----------------------------
------------------------------TEMPNEVNITMDATPP-MSLQEN-ENIFEY
TGYKRIAPELQNFDKNGELRSAANYTSWYSA----------------------QEIVPKS
AASPENSVAGSSPGRS--------FQSQDVEENIFSVFTNE-------------------
-------------------EENSTSLLD----------GLNLETTSFVLDATSWLRHSAH
IYKLASNSFLVFSICLTTFQELRFLRK-SKDENVMEAAARAIIIIRQLYSDGKVIPLRFT
GNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKK--F----------LQPFVQNPVD
--------------------------NDSRFF---------------VLVSDDENMKRKA
H----EKEIRTFTTRFVFAL-------CSEM-----------------------------
-------GKGRLICTN---
>TPHA0E00190
MTLHLHNTIDLNFQTGHSTHLLVAKNYNTDKAMMQNNTSVEHDNVG--------------
-----------------------------------------------QKRHGSNSYKYLQ
PG-IVKRRLAGNNNGDIHIQ---------------------------ESSSNFDPKYSSF
AYSRKDPINLTTVDAPFIDLRPYVTENT------------------------PIASPKRN
AIKKHQNNIAVTPQQSLVGNDIATLLSMDQKVLSNPEILKATEPIIDDSMINNISLKNSL
SRERS-----------------------------LNPGVNNIEDIFKIAASNFPSPE--N
ETMIMNNININSTTKNGMAQNKIYSNESINKLNRKYNEELLPYSIIDNSSENQKSLNI--
---NNNDYRGNGSDSGQINNFDYNTDNNETIDNDNGNNNHSNDSNMRNNVNNSSTGTHND
GNGSGNNNNNNINNNSSSDENNNNNPEENNNSNGNNNEIPSVSVPLRKSS-QVLVQKLQD
IYKTIVKQEIELQERCGR---LTNSQTTELKNLWTI--YRVNSELVDNYITFITTAIHPT
QPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFM----------DPEVCCQFI
FHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWY-----MAA
MEFTYGHGK----------LYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIG
NIYQRAY-----ADSNNSNN------GRND---------------QLLVDYIKHCEVTLL
PNFKESQE------LQQVVLMYFIDKFGV-------------------------------
----DYNN-------SSNN--------MFISRKMFVQ-NNDQFK---CFYRYSAAFAESQ
ILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTM---------------------
----------------------------------------LILKITQPRLYHR------W
VGTTLPTMPNNNVFLT---AEEFFENIDTINYPS-FMPNSV--DIWNHSLQYANHVSIKC
SMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDK-HKNVAMNEFWVEFVRRIFPWNSI
VKFLNVLLAYMVDNC--------WEQS------ILNELCPFYNSM---SLDELLTYFNEN
E-ELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKG--------------
----------------NGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLAE
-SYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNA-----------------
--SSDGV--------------MLDDI---IES----------------------------
------------------------------FETPDEVNYDTHKTPM-LSMVDG-DSIFDY
VGYKRVCPNFYSFDKNGDFISTSFFNSWSIK--------------NLTNELSRNTCSSIT
DDAISSGSGNDSAAAST-------NNDPMNELLVFNECFDP-------------------
--------------KYKTLEEFWSQEIYPD--SQTN--ISLQGKTYFILDATSWLRHFAH
IYKIATSKILKFAICLTTFQELRYLRK-SKDHNVVEAATRAIITLRQLYHENNLLPLRFT
GNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK--R----------TDRLNDINMD
TDEKE---------------------KSIFGI---------------ILVTDDITMKNKA
M----DRKIKTFSTRFIFSM-------ANYI-----------------------------
--RTMEEGHNK-LAIN---
>Kpol_1043.73
---MSIPLPNLNLRRDEGQDLSASQSNEQISLNIRNERLRKNNIQDLRDQTKQMNLQSTN
QNTKNLG----------------------------------------QKRHGSSSYYITP
N--YIKKRVAKNSYNSA------------------------------TGNFLDSGSNGGG
DISNQTSLQNTPLASP----KPSIAKNNIIN---------------------TSTTPQPT
YITQDSMTS---------------PFVLNSNLPS---NLD---IVSNENLEDSIRKDQDF
SQINQAIKDK------------------------MMRPLSVRNDSFVYQVSNFPSPE--N
TEPHLHTFE-----------------------KNTSIQNYSSNDNIVP------------
---DNDMDIGNENANNESNDSNNNNNN----------------NDFNGESGNNGTVE---
-----DFNDMSHNVGGNGDEDKDNKDNGDNND------VPSVSVPPRKSS-QALVQKLQD
IYKIILKQEVELQERCSQ---LTNSQTTEIKNLWVI--YKLNADLINNYVTFITTALFPS
QSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWY-----MAA
MEYSYGYGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVID
NIYQRAF-----ADRNSSSN------SRNC---------------QLLVDYLKHSEVMLL
PNFMESPD------LQQVVLLYFMEKFGI-------------------------------
----DYNN---------NN------VKMFQPRQMFIQ-NNDQLK---FYFRHANAFAEAQ
ILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKN----------------------
----------------------------------------QIVGEDGSSTTFS-----SV
SGMEYMVNMETNVFLG---SEDFFNNIDKLAINN-FMPNSI--SLWNDSLKYHNFTATKC
SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEK-YQDTAMMEFWYAFIKRIFPWNSM
VRFLNVLLAYMIDNC--------WDNS------PLNELCDQYGSL---NLEELLRNFNAN
E-DLPEVWKCRGSLWFDIIDEKRN-------------SQNCDSYTE--------------
----------------CGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVE
-RFNGFGNLAISYNAPVINRRGLGVNSH-----LVGYSFKLMA-----------------
--KSDDI--------------MFDDM--LVSN----------------------------
------------------------------FEEIDSNNSDFNAIPL-LSMIYG-ENIFEY
VGYKRIHADYYSFDKNGDLISTSFYNTWSIN----------------------QDTGVNG
GPLSNNSSSSNAA-----------SSDPMNEKELFNKCFDP-------------------
--------------EYDSVDEFWNKEIYDD--IGRKFGMELYEDTYFILDATSWLRHFAH
VYKIATNSILKFSICLTTFQELRFLRK-SKDENVVEAATRAIITLRQLFSEGKLLPLRFT
GNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK--R-----------KEQEMHNM-
--------------------------KGFQIV----------------LVTDDSNMKNKA
L----EKGSKTFSTRFVFAI-------SNYL-----------------------------
---RTIDESKRQLAIN---
>Suva_11.333
-------MPEISVQN----PLRLSENGNARSMFLSASQP---------------------
-----------------------------------------------QRPSTASSFPMSV
HN-AARLDLSNFQVLNSS-----------------------------AKRQNSNSVNEDI
NSSKRR--ISRPNFLDIEYTNN------------------------------ASSQSEKT
TLYNSRPNPS--------------ARYLGSPKRALQRENSVEVTRSSPLISK--------
----------------------------------PASHNGKHIAYDKHTTGSNSLLNMSK
SSLAYVEAEP----------------------DGQSSNEIIENFQHKE------------
---TESDDIHNEDGDDGADPNDLSNSE-------------------NNNNYNNN------
-----NNNNINNNNNNNTNNNNINNNEDDDNNEQEES-NVYRPANNKKSS-IALIQKLQE
LYKVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YRINTELVNNYVTFITTALLPS
QPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
MKYVYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
PSFLESPD------LQNVVLSYFVEKFGI-------------------------------
----DANG---------CN--------IFNPEDMFIQ-NPDFFK---YFFRHAPSFAQSH
ILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNE--------------------
----------------------------------------SSITESSTSNSRN---ENDD
NDEIMSSTTSISERDS---LIEFFNDIDTLRRPI--VSSMLTNEAWLESLKFLNMTSLKC
GMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQ-LSDPISKEFWIVIVKRIFPWDTM
VTFMNILIACVLDNE--------MTSP------IIGSLCDEYSDL---NLAELLDVFKEK
E-ELPEIWGCWGTLWFDTICQKNT-----------NSISSDDDFEE--------------
----------------VGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSR
-SFQ-IG-VIINNESSI--NRSSLQSNNI----LGNLSYKLEP---------------LS
TLGSSIP--------------TLNTLEGIIDV----------------------------
------------------------------FETRSENNIDLHAVPE-LSVIKG-GSIFNY
TGYKKLCPNYTCFDKNGEFLSASLYTSWYVP--------------------------NGS
N-NPETNINSNCE---------------KENEGQFLECLKS-------------------
-------------------------DDR----------EIDLNTTYFVFDATSWLRHSAR
IFKLAQNRLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFT
GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK--L-----------ENANQLPVS
S-------------------------CRFNYV---------------ILISDDDTMKKKA
E----EKKIKTLSTRFVFSL-------CTKL-----------------------------
-------GEQRHLCTD---
>Skud_11.336
-------MPEASVQN----PLRLSENGNTRSMFLSASQP---------------------
-----------------------------------------------QRP----PFPMSV
RNATTRLDLSNFQVLNPS-----------------------------AKRQNSSSVYNDI
NSSKRR--INESRFLDVEDNT-------------------------------NDSTPSER
TIICHS-RPK---PS---------PRYSNSPKRSLKRENSVEVTGSYPLISK--------
----------------------------------PASQSGKNNAYDKRSSKNLSLLNPSK
SSLAFVDAEA----------------------DGQSNNDIIGNFQHKS------------
---NNREHIHDGDNNANNQSYNNSNNN----------------NNNNNNNNNNN------
-----NNNNSSNNNNNNNNNNNNNNINNNDDNNEAEEDDACRSANSKRSS-IALIQKLQE
LYKVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YRINTELINNYVTFITTALLPS
QPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
MKYIYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
PSFLESPD------LQNVVVSYFVEKFGI-------------------------------
----DANG---------CN--------IFNPEDMFIQ-NPDFFK---YFFRHAPSFAQSH
ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND--------------------
----------------------------------------SSVTESSTGNSRN---DNND
DDEIMSSTASISDHDF---LAEFFNDIDTLRRPI--LPSMLTSEAWLETLKFLNMTSLKC
GMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQ-LSDPTSKDFWMIIVKRVFPWDTI
VTFMNVLIAYLLDNE--------ALNP------IIGELCSKYGTL---NLAGLLESFNES
E-ELPEIWNCWGTLWFDTICQKNA-----------HSISSDDNFQE--------------
----------------IGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSR
-TFP-IG-VIVSNDPLIKCSSSQ--SSII----LRNLVYKLEP---------------LS
NIRSNTP--------------ILTALENSVDI----------------------------
------------------------------SEARSKNNIDLYAVPE-LSVNSG-DNIFHY
TGYKKLRPDYTCFDRNGEFLSASLYTRWYLP--------------------------NGN
N-ISEALVNSDIE---------------KGDEDLFLECMKP-------------------
-------------------------DCP----------GIDFETTYFVFDATSWLRHSAR
IFKLAQNRLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYEDKVLPLRFT
GNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEK--L-----------ENAGQPHVT
P-------------------------RHSNYV---------------VLISDDDTMKKKA
E----EKEIKTLSTKFVFSL-------CTKL-----------------------------
-------GEKRHLCTD---
>Smik_11.360
-------MPKTSVQN----PIRLSENENTRSIFLSISQP---------------------
-----------------------------------------------QRPSNISSFPRLV
HNATTRLELSDFQVLNPS-----------------------------FKRQNSNSVNDDI
NCSKRR--ISRSKFSNSEDRN-------------------------------DDSTQSEK
TTTNHS-RSN---KS---------FKFMGRQKLSMQEENLVEVTQSSALLSK--------
----------------------------------PLNKQSKNTTYEKRGSQNVVKPK--N
ISKSSFAFVDGES-------------------DGQSNNGIVSNFQR--------------
---ESSNSENVCDEYKGEKNDDNNENR---------------------------------
-----NDDNDDSNNGNHDNNINNNDDENERDEN-----DACKPANNKRSG-IALIQKLQE
LYRVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YKINTELVNNYVTFITTALLPS
QPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
MKYTYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
PSFLESPD------LQNVVLSYFIEKFGI-------------------------------
----DANG---------CN--------IFNCEDMFIQ-NPDFFK---YFFRHGPSFAQSH
ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNND--------------------
----------------------------------------SSVTESSTGNSRN---GNED
DDETMSSTTSMSDPDL---LVEFFNDIDTLRRPI--LPSMLTNEAWLETLKFLNMTSLKC
GMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQ-LNDPISKEFWIVIIKRMFPWDTM
VTFMNVLIAYLLDNE--------TSNS------IIGDLCNEYSKL---NLSELLNSFNEN
E-DLPEIWGCWGTLWFDAICQKNT-----------HSISSEDNFQE--------------
----------------IGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSR
-SFP-LG-VIVRHDPLVNCSSLQ--SNNI----LRDLVYKLEP---------------LT
NIRSSVP--------------VLSTLESIFDI----------------------------
------------------------------SEARSEINTDLHAVPE-LSVING-DNIFHY
VGYKKLRPDYTCFDKNGEFLSASLYTSWYVP--------------------------NCN
N-NLETNISYANE---------------RENEALFLECMKS-------------------
--------------------VHPEIAYP----------EIDFKTTYFVFDATSWLRHSAR
IFKLAQNRLLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYCEDKVLPLRFT
GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK--L-----------ENAKQPNIS
S-------------------------HRFNYV---------------VLISDDDTMKKKA
E----EKKIRTLSTRFVFSL-------CTKL-----------------------------
-------GEQRHLCTD---
>YKR096W
-------MPETSVQN----PLRLSENENTRSMFLSASQQ---------------------
-----------------------------------------------QRPSATPSFPRLV
RNTTANLSLSDFQVLNPS-----------------------------SKRQNSNSVYDDI
NSSKRR--ISRPRFSDIEGKNN------------------------------DHTYPERT
TVKESEKNPS--------------PRYVSSSKRALKRENSVGITQSSALISK--------
----------------------------------SFSENGGSIAHEKWSPENMIKPL--N
VSQNSLAFVDAGS-------------------DEQSKSEIVGGFQRKS------------
---NNSQEINDKDNSARDQDFNNSGNN-----------NNNNNHSSNNNDNNNN------
-----NNDDNNNNNNSNSRDNNNNSDDSNEREEN----DSCKPASNKRSG-IALIQKLQE
LYKVIVKQEIELQERCSQ---LTNSQTTELKSLWTI--YKINTDLVNNYVTFITTALLPS
QPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY-----TEA
MKYIYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVID
NIYQRAF-----VERN-NGN------LRNS---------------L-LIEYLKHSEAMLL
PSFLESPD------LQNVVLSYFIEKFGI-------------------------------
----DANG---------CN--------IFNAEDMFVQ-NPDFFK---YFFRHGPSFAQSH
ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND--------------------
----------------------------------------SSVTESSTGNSRN---DNED
DDEIMSSTTSISDHDL---LAEFFNDIDTLRRPI--LPSMLTNEAWLETLKFLNMTSLKC
GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQ-LSDPVSKEFWMIIVKRAFPWDTM
VTFMNVLIVYLLDNQ--------TSNS------IIGDLCDDYDKL---SLSELLELFNEG
E-ELPEILGCWGTLWFDTICEKNT-----------HSISSEDNFQE--------------
----------------IGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSR
-SFP-IG-VIIRNDPLIY--RSSFQNTNI----LGSLVFKLEP---------------LC
NIHNNIP--------------VLGALESIIDI----------------------------
------------------------------SEARSENNTDLHAVPE-LSVNEG-DNIFHY
VGYKKLRADYTCFDKNGEFLSASLYTTWYVP--------------------------NSN
NTNIEDNINYNSE---------------KENEGLFLECIKS-------------------
-------------------------DYP----------EIDFKTTYFVFDATSWLRHSAR
IFKLAQNRLLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFT
GNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEK--L-----------ESASEPRLS
P-------------------------RRFNYV---------------VLISDDDAMKKKA
E----EKEIKTLSTRFVFSL-------CTKL-----------------------------
-------GEQRHLCTD---
>ZYRO0B16412g
-------MIETFNHAKRRQTDKNTNDSSMIGMTPSFTNEINNSTGGVGDASAAAQSVFGT
ITGDLTREDSDNNNSNNNGEMNNSNNMSSSINPNVNPSINASNINPRLKRSSSNTYNYVS
AN-FVKRRLPNQEEIFPQ-----------------------------QSQFLDTSLTGAI
NQSISV--PNTPSKAP-TSRRPSLPKKA------------------------IDTSSASN
YGGAGG-GGTYALGS---------PYCSLPNVSTFVSNVDLASKAAIENSVQKLPCLERN
SSNYLQTTPSRLDTP-------------------YLSQDQNSNKYYHHGISAYPPVNSGD
NSNHHNNMNTNSNTTNNDNDNNNNNTNYYNNHNNRRQNETSKIADIQNSVSVANTNNNNN
FDIKENRGNGDCNQDGNNNNGNTNENN----------------FNMNNNGNNNNSINNRS
G----NNDGRDSNNNSNSNSNNNNNDNNNNNGNRA---VPSVVVPSKRSS-QALVQKLQD
IYKVIVKQEIELQERCSQ---LTTSQTTELKNLWTI--YKINSDLINNYVTFLTTALLPS
QTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFM----------DPEVCCQFI
THVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVID
NIYQRAF-----VERN-NGN------HRNT---------------Q-LIEYLKHSEVMLL
PSFLESAD------LQQVVLIYFKAKFGC-------------------------------
----DSNN---------VN--------IFDTRKMFCQ-NPDYLR---YFFRHAPAFAESH
ILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKS----------------------
----------------------------------------TTVTETSSTMAID-------
-----DLEDEQSDRMST--PEGFFGNIETLRFPY-SVPSNL--EIWNESLNYINMTSLKC
SMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKD-LNHESSRKFWVEFVDRIFPWNTI
VSFLNVLIAYMLDNS--------WKSS------LVDSLCGQYSSM---GLEDLLDYFNNN
E-VLPEVWKCWGTLWFDTICNKE--------------QSHVEDLES--------------
----------------VGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAE
-NFP-IG-ITLSPVAPVYCRRNDVSPYHI----LKSFSFKLRRGSDSELVPMN-----PP
QPSTTAI--------------DLDHLKNTLEI----------------------------
------------------------------FEEASWENIHMDTIPM-LSVIEG-ESIFDY
AGYRRLHPDYFSYDKNGEFLSASLYTSWYAN-----------------------NNTNNT
GVIPAHGSDVDSQRD---------AVQSVQEMHIFNQIMEP-------------------
--------------GYC--GGFADDLFLRD--ALYQ--TAHSSTTYFVLDTTTWLRHFGH
IYKLASSGVLKFAICLTTFHELRFLRK-PKDENVVEAATRAIITVRQLYSEGKLLPLRFT
GNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSK--F-----------QEMNQLQLE
QEEQQHQLRAHDDR------------SGLKFV---------------VLVTDDSNMRKKA
Q----DQDVRTFSTKFVFSL-------CNSI-----------------------------
-------GLRSKICTN---
>TDEL0B02140
-------MIETFNHT----SDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGR----
-----------------------------------------------QKRHSSNPYNSAE
ST-GVKRRVANHDDG--------------------------------ITQFLDNGAI---
--------PNTPCKEPVSSRRPSATRRT------------------------VNRTPRST
TSYVADASAS--------------PYCYSPNNSNLRIDHLSRMVNSSGV-----------
----------------------------------SIPNVCRDPSFLSKEAHIV-------
------------------------------------------------------------
---SDGQDTGTISINSGEVNDQSQDNS------------------ANDEGRDDN------
-----NENDSIRNKNSNNDNDNNRENNKDNNGN-----VPSVVVPSKKSS-QALVQKLQD
IYKVIVKQEIELQERCSQ---LTNSQTTELKQLWVI--YKVNSDLINNYVTFITTALLPP
QSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCAQFI
THVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
MKYIYGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVID
NIYQRAF-----VERN-NGN------HRNS---------------Q-LIEYLKHSEVMLL
PSFLESTD------LQQVVLIYFRDKFGM-------------------------------
----DTNE---------NN--------IFDTRQMFDQ-NPDQLK---YFFRHAPAFAESH
ILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKS----------------------
----------------------------------------SVTTETSSAMAID-------
--EEEYIDSSFSLGAQ---VQQFFDNIDSLTSPY-LFPPSL--EVWNCSLKYLNITSLHC
SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQH-ITDGASREFWLELVNRIFPWNTI
VNFLNVLIAYTLDNI--------HPSL------PIDPLCEELSTM---GLDQLVEHFNNN
E-DLPEVWKCWGLLWFDAICDKD--------------KVQMDSYES--------------
----------------AGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAE
-NFQ-TR-LVVSSQAQVHCRRTD-PMNHV----LKSFCFKLRD-----------------
TFYNSNS--------------VLQNT---IEV----------------------------
------------------------------FEEGSDANKDMQMTPQ-LSVLEN-ESIFGY
VGYKRLLSDLSCYDRGGEFVSTSLYTSWGNE--------------------------TSK
NEIPQSEPT---------------QQQTANEADLFIEGINT-------------------
------------------SLTEFNIDFPEC--------KMNGKDTFFVLDATSWLRHFAH
VYKLASNQVLQFAICLTTFQELRFLRK-SKDENVVEAATRAVITVRQLYTENRILPLRFT
GNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQAR--L-----------SQEN-----
--------------------------RDFHHV---------------VLVTDDANMRRKA
Q----QHAIHTLSTRFVFAT-------CNAV-----------------------------
-------GNRLKICTN---
>KNAG0C06630
-------MPQLLAAQLI--PNNSTGNNNNSNSNVRNNGSASGFVHQQNNSVIFPRDSKKT
LDGISCIIASVEKEMEAHCQGDDGANHSG------------------QKRHGSASYSFAN
ANFPSKRRIANAEEDSKR-----------------------------ISSYSDNLLLQ--
--------QNTPRRSRDVARKSASG---------------------------SASGCRSA
SGSGSAPQES--------------PFCMEFTSLA---NVDPLPTTGGAATG---------
----------------------------------VNTPGGLGVDNISSGKQTVFIDK--S
IGATHRY-----------------------------------------------------
---ATETQQGEIDNNGEGEVAGNNDNA--------------------DNDGLPT------
-----NGNGDNNEKNLSNDNDNSNNNSNNNNNYPADQSDAQNTSVTRKSS-QALVQKLQD
IYKVIVKQEIELQERCSQ---LTTSQTTELKNLWTI--YKINTDLINNYTTFITTALLPS
QPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCSQFI
THVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVID
NIYQRTF-----VDRNTGGN------YRNP---------------D-LIDYLKHSEVMLL
PSFLGSKD------LQQVVLNYFQDRFGI-------------------------------
----DYSE---------NN--------IFDTQDMFFQ-PPSCLR---FFFRHAPAFAESH
ILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTS--------------------
----------------------------------------TADVSSTAPKTVD-DQATDN
VNEGTNDDHELTATLS---GPEYLDNIETLKYAI-ETPDIC---TWIKSLDFINMTSLKC
SMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNE-LENEKNYKFWRILMKRIFPWDTI
TSFLNVLLAYVLDNY--------GNTT------IIEELCMQYSDM---DLDDMLAHFNKS
E-DLPEVWKCWGTLWYDAICNKN--------------SVDADTFAG--------------
----------------FGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISK
-KFD-FG-LKISHEAGVYCRNEK-AADSP----LRRFTFKLES-----------------
---YDEP--------------TSSKFNEFIPL----------------------------
------------------------------CEEVSAINNDALATPS-LSVVQG-ENIFEY
MGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGT
PISASLSAAGKTTTSHVTDD----QDPGLNENDLFKKFMSL-------------------
---------GDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAH
IYKIATNGVLKFGVCLTTFQELRFLRK-SKDENVVEAAARAIITMRQLYRENRLLPLRFT
GNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDK--F-----------TTAGETKQP
EEEGTGPPRVPLGG------------KRFHYV---------------TLVTNDQNMKRKA
Q----DQGIKTFSTDFVFSL-------CSKL-----------------------------
-------GMSLDLCTN---
>KAFR0H00180
-------MPQISIQT----PFDIITNSFTAMHSSETQDNNNNIDIFRPISPSAALR----
-----------------------------------------------QKRHGSNSYIY--
---KNQKRIARPDDKILN-----------------------------ANININYIDHNSI
VN------ENATPVKSVLSRRPSLSKKS------------------------NNVTPQPS
FLVT---EPP---KS---------PFYVTNQSYT---NIDVALSANNNGITNNNNQ----
----------------------------------YTNMNTYNSINNNYNNIEGYSGN--A
VLPGNDDMFINTQ-------------------SNKYRNNSTSTAIIND------------
---VSDNFVNNMNTDIQQNENIYQDQN------------------FNDDTGNNNAES---
-----DNNQNNSNDESNNQNSEDNNDNPNNNNN-----NVEETSVTKKTS-RVLIEKLQN
IYKIIVKQEMELQQRCSQ---LTTSQTTELKNLWSI--YKLNTDLINNYITFITTALLPS
QSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCSQFI
THVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----MEA
MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVID
NIYQRTF-----VDRNKNGN------VRNS---------------D-LIDYLKHSEVMLL
PSFLENED------LQQVVLNYFNDRFGV-------------------------------
----DYND---------NN--------IFETQDMFFQ-VPASLR---FYFRHAPAFAESH
ILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKS----------------------
-------------------------------------------STEISTMSID---TNDS
RGPILNTSAYVNEGNI---VTEYFDNIDSLRLPI-DHPNIL---VWLKSLEHLNMTSLKC
SVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQS-SKNTSSVKFWTIVMRRILPWNTL
TSFLNVLLAYILDNF--------YQTE------SIAKLCETYSNF--ENFYELLDYFNRN
E-NLPEIWKCWGTLWFDVISNKR--------------ALNADTFNG--------------
----------------LGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAE
-NLQ-TG-LRVSRTAPVHCRRDDIDPNHI----LKSFSFKMEG---------------FD
ESSYSGQ--------------PFSTINKLLPL----------------------------
------------------------------FENIDETNLDFDARPM-LSVVKG-ENIFEY
VGYKKLFLNNHSFDRNGELVSSSIYTAWVID-------------NDNSLNNSQGNQYTSN
MQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNP-------------------
--------------EKL--NKNMDQASIWT--TAND--EINRNITYFVFDATSWLRHFAH
IYKLSTNNVLNFAVCLTTFQELRFLRK-SKDENVVGAAARAIITMRQLYSEGKLLPLRFT
GNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNK--F-----------ISANESVTL
R-------------------------KGFNHV---------------VLVTDDINMKRKA
Q----EQGIKTFTTHFIFSV-------CRKL-----------------------------
-------GIQDNVCTN---
>NDAI0E05070
-------MPQASSST----LRNLVRLPPTNTATATATATNTTTVDPAYNNENNNNNNF--
-----------DDNSINDGIINNTNNTIDSINNNITNSIGNIAR---PKRHSSNSYNNYK
TIPFTKRRIAACTPININNNNDNYNNNENMILMNNNNNNNNINNSFIDNLDYLSNTNNNT
NMSTMA--QYTPSKGTTISRRPSIIIRKQQQQQQQSHFTTATTIKSPSNHTSVNITPQAS
NYDPAS-EPP---NS---------PYYLTTNSYSNMKNNNNANTTNTNNTIQPSPLPL--
----------------------------------PLPMDIPTNNSNNNNNNNITRSN--N
NNPQSRYFSPSPLPPPLQQ-------------NHHQQQQTSHLNPISL------------
---SNSTSTSNPNINSSALNNNNNNNN------------------NNTNTDNNNS-----
-----NNNNSNNNKTTNNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQD
IYKLIVKQEIQLQDRCSQ---LTTSQTTDLKNLWTI--YKINLDLINNYINFITNALLPT
QSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFM----------DPEVCCQFI
SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY-----NEA
MKFTYSHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVID
NIYQRAF-----VERN-NGN------HRNL---------------Q-LIEYLKHTEVMLL
PTFLESLD------LQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTT
TSSSSSSD---------NTTRSFTTIDIFRNQDMFIQ-NPDHLK---YFFRHSGTFAQSH
ILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNN
IVNMTDNNINTNNDNDNG----------------------NCPSKDGSMMSIDYINNINL
NSNSSNINQLFDNNYSNILCEEFFENIDLLQFPY-KIPQTI--EIWLESLKNINLISLKC
SIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSI
VNFLNVLMVYLLDNI--------NDENFK----LIISLSNKYNSMSSSSLNEMLKFFNQN
E-NLPEIWKCWGTLWFDVICNKN--------------INSDTTFLNQNNNNTTTTTKNNG
EDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIE
-TFPNLG-LKISHETSNYCRNTKIPQNFI----LNNFAFKLTNLYDPSLIII------PQ
TEQNIENENENENDDLEFNKSILSNIMEFFQI----------------------------
------------------------------HEPIEEINLNLQLQPP-LSILGGNENIFNY
LGYKRLNFNIQSFHENGEIISGSIYSSWPID---------------YNKFKEQQQQQQQQ
EHLVNDSTMKNENVT---------VGDITPEDASFKEFMKL-------------------
-------------SFHLKLSTRSNNSQTQNTHKMGV--SINKHRTFFVFDATSWLRHFAH
IYKLSKNGFLKFAVCLTTFQELRFLRK-SKDGNVVEASTRAIITMRQLYKEGKLLPLRFT
GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQER--FKTKSIQNYNLYNDDDDDDDD
TKTGTTTLSNTSVGVDNNVN--N---SRNTNVENELVTGFSSPTPLPIDVTADDKMN-KN
Q----INDIANANATSDIDIDIDANDDEGEL-----------------------------
-------FLLMKKISNMLF
>NCAS0A03170
-------MPQLATHN----FIQLSNNPNSESNLPSPNPIIQLGMDSNNNTNNESNNAFIQ
ENIR-------------------------------------------QKRHSSNSYSNAK
NNPAVKRRIAKPEEVSLKYI---------------------------DNMEYGTATTGNN
SIICQ---QQTPSKGT-LSRRPSLIKKQ------------------------MNSTPQPM
SYVVSEVPAS--------------PFYLPANSFSNNYERSPALLTNNNNININ-------
----------------------------------NNNNSNNNLRFNSMNASSIPREN--N
DVPAIEQLTLPQ--------------------PMSRTMNYSTEIPINSNS----------
---NNIDDQSAIIPNNEHKNGENQESE------------------NYKNTNNNN------
-----EQDTNNNINNTNRDRNNNNNNNNNNNNS-----SSSTSSSSKKTG-EALVRKLQD
IYKVIVKQEIELQERCSQ---LTTSQTTDLKNLWTI--YKVNIDLINNYVTFITTALLSS
QSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWY-----MEA
MKFTYNHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVID
NIYQRAF-----VERN-NGN------NRNL---------------Q-LIEYLKHSEVMLL
PTFLENSE------LQQVVLLYFQEKFGILE------------------VTIP---STSE
TISINTMN---------NNTR---TIDMFRSRDMFIQ-NPEQLK---YFFRHAPAFAESH
ILQLVGFGDPKNPFALLFELPKYLKERKDKKEKKKSKS----------------------
---------NSNSNNNNN----------------------ASTAGDGSMMSID-NSEMGE
DDINNLFSDNVMNQVT---SEEFFQNIEQLRFDY-FIPNSL--EIWMASLNHINLISLKC
SMIVLKKFLHGPLLIALPHLLPWCYFIISILLKREG-LTHEDSKIFWIGILKTIFPWNDI
INFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFILDLCNKYSTM---GFADLLQHFNEN
E-DLPEVWKCWGTLWFDTISNKN--------------GMDADSFEN--------------
----------------LGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAE
-NFDSLG-LKVSYNAGTEYRNNNVPMDNI----LKMFSFKWAG---------------SN
ADYVDAN---LGDELEIYTNTIINRITEFVDI----------------------------
------------------------------KEPIHETNLNFEIPPL-KSMIAN-EDIFDY
TGYKKLEPNSRSFDKNGEFSSGSIYTAWPMD-------------------------YDQL
ILAQNNNNNTNATDEMTDLF----TGTLSIDELSFRQLKRP-------------------
--------------EFRDKSTLLSSTSTE---------PFNRYKTYFVFDATSWLRHFAH
IYKLASNHVLKFAVCLTTFQELRFLRK-SKDANVVEASTRAIITMRQLYSDGNLLPLRFT
GNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEK--F----------VKSKTVENME
GTSNWGEIDATTTTVSAEEEEKS---NLFKYV---------------VLITDDDSMRMKA
Q----LKGISTFGTQVVFSV-------CSMM-----------------------------
-------GIDEGVCTN---
>KLLA0A00528g
------------------------MDPGSASMAGHSGLH---------------------
-----------------------------------------------QKRHNSNSVDYYD
SN-IIKRRTGDGVPENVD--------------I--------------SVAEIPQEPCQYL
DTSL----LTSPSKIRHHEKTPSITKPHTLQ---------------------MEQTPQPR
GVDTSG-EFP---QS---------PFYLPTTSQT---NFEAATTVNENSSIRRSDSVT--
----------------------------------RLTTVGNNTQLASNGNNYIKPQH--Y
QEDGVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHSPAK-----------------
---NNSDNEMNLPSGSNAGSGQNHDHN-------------------NSNPNDHN------
-----NSISDDHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQE
IYKSIVKQETELQERCSN---LTTQQTTDLKNLWLA--YKINAELIDNYILFITTALLPS
QSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
AYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWY-----RES
LKFTFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVID
NIYQRAF-----AERD-SSG------NRTN---------------H-IVDYLKHTEVMLL
PSFLESSE------LQNVVIHYFQHKFGV-------------------------------
----SSSG----------N--------FFDPNLIFIQ-DAERLK---HFFRHSSLFSQSH
ILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS------------------------
-------------------------------------------TKSTSEGSLD-------
-----PVEFSSQQQAS---TEDFFSTIDSPKVPY-EFPLDL--GVWKRSLHYINVTSMKC
GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ-VNDLTLKKFWIVFIRRIFPWDSL
ITFMNTLIHYCMVTG--------TKNF------DIDAHMSTYLPM---NREELLTSICEN
E-NLPECWSCWGSLWFNTISKKS--------------DLDVTTLES--------------
----------------TGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE
WEAC-DG-Y------GHGCKKLN-PEATS----WKNLVFRFND---------------DT
NDQLSVE--------------LYPEENESFPFEK--------------------------
------------------------------FEIISNLNCSDNLQDGSKSMIPG-VSIENL
QGFKLMYPDYFCFNKNGDLITASLYTKGPLE----------------TANIQGGDDFNAN
KILDNGRLVVQDRLEYS-------SAIDKLEQPWLEAFMNP-------------------
--------------DFRQ-RELLNRSFLGN---LNC--QADTNVTFFVLDATTWLRHFAH
IYKLATSSVLKFAICLTTFQELRFLRK-SKDESVLEAATRAVIAVRQLYYERKLLALRFT
GNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK--F-----------NVLNNDAIE
KGKDCIPLSEDGQST-----------QRFNFV---------------SLVTDDFNMRNKA
Q----QLGIRTFSTRFVFAI-------CREL-----------------------------
-------GRETGVCTN---
>AFR290W
--------------------MQVNEVAMEESGTRMDTAL---------------------
-----------------------------------------------HQKRHSSALGGCR
DG-LAKRRGPRGGLTA-------------------------------CGLVVDA------
----------------------------------------------------IGAEPGS-
------------------------PSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDTR
LELPS-----------------------------RLSSSPVQVALDPYLTCADGQSCIVD
RVEHFGYPQEEPSPRMGARPKEGVPQSLWSPHSKSGFNTHSKAVASNSGRRGYPCTGSRF
ADAAGGEQLDDQGPSSNGNNGSSNNGD----------------ASGEGAGHPGGGKSSAG
GASNGSRGNSDNSANNNSNGNNSGNSNDSDNNGNSDSSVPTVAVTAKQSS-QALMEKLQE
IYRNIVRQETELQQRCSQ---LTTSQTTDLKNLWII--YKVNAELIDNYFMFITTALLPT
QPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
IYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----HEA
LKYTFGHGK----------LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVID
NIYQRAF-----AERN-SGH------HRNA---------------H-LVEYLKHTEVMLL
PSFLESSE------LQDVVLAFFEQKFGV-------------------------------
-----TSN---------VD--------FFDPRLVFVQ-DSERLK---HFFRHASLYAESH
LLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKS------------------------
----------------------------------------KSSTSTQYDTSID-------
---------DDCAFAA---PSEFFETIDSTKYIY-KFPDDI--NIWKESLSYANVTAMKC
SMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVIT-IPQDEIRRFWVALVRQLFPFNTI
ITFLNVLLLYMNNQT--------QANF------PFDEYFEQFIDM---SLADLVGYFCEN
E-ELPEVWECWGTLWFDALNTKH--------------ITNLTDINS--------------
----------------TGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALAL
-ECP-VG-LR------------EISGGRN----WRSLVFKFEE---------------PP
SEWCDMY---------------LEPFTLVFDT----------------------------
------------------------------FEQISPVNLDQRATPY-CGMTPD-IDIRTL
QGYRILLPDYYCFNRNGDMITGSLYTIGTLE----------------SSGIHGGDDFNGK
RLLENGELVSTERRDYN-------SLIDREEQPIMDEFLRH-------------------
--------------THCKNDVRWEQMLPRG--DLHC--FADTHVTYFVLDATTWLRHFGH
VYKLAANNILKFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLYYERKLLPLRFT
GNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDK--F-----------NALNDDAKA
ASRDCIPTGAD---------------QRFNFI---------------ALVTDDLNMRNKA
G----AQNIKAFSTRFMFSV-------CNEL-----------------------------
-------GHAKNVCTN---
>Ecym_4015
-----------------------MEDPSTTSLQSQLH-----------------------
-----------------------------------------------QKRQYSTNFDCYN
HN-IVKRRLAEHGIASPSLN---------------------------EAEANDIDTPVDL
ISHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKL
AQQPPYECTP---RS---------PYYLPTTSSSNMEAAAKAIDSSSIKQVSGTTLHDSR
LQVPSKF---------------------------SQSPSCVTRLHRALSSHNLFPVG--N
EQHSMIDKGVSCGYFQEAQIQRQSPMKNFVFTQQQCSFGESRCNDANA------------
---NDNIDNNDEGNNITSNNNNSNSSD-----------------TTNINTNSNT------
-----SREGNNNVGINSSSESNEDGDNGDNNHN-----VSTVAVPSKPSS-QTLVEKLQE
IYKNIVKQETELQERCSQ---LTTSQTTDLKNLWVI--YKLNAELIDNYFTFITTALLPT
QPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFM----------DPEVCCQFI
VYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----QEA
LKYNFGHGK----------LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVID
NIYQRAF-----AERN-SGH------HRYS---------------H-IVEYLKHTEVMLL
PSFLENVE------SQGVVLAFFDQKFGA-------------------------------
-----TGS---------AN--------FFDPSLIFVQ-DCERLK---HFFRHASLYAESH
ILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKS------------------------
----------------------------------------KSTASNQSDMSID-------
----------DTFLGD---PVQFFETLNSTKTAY-RFSQDL--NIWKESLNYVNKTSMRC
SMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDA-IRNEDSKRFWIVFIRQIFPWESI
TNFLNVLLLYINDQK--------PTKF------PIDEYMANYINM---PLPELLEYFCEN
E-DLPEVWNCWGTLWFDVINSKH--------------VSNLVDIHS--------------
----------------TGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAY
-QFP-FG-------FTEFNGSDD----------WKSLVFKFNE---------------PP
AEWKEQY---------------LGSFSKEYGE----------------------------
------------------------------FESISFVNTDLQSPPH-KGMVLG-TDIRTL
QGYKQLVPDYLCFNKNGDLITGSLYTSGMSE--------------GGSGVPNDSEDFGST
KRLLENELLVTSERRDYN------NLLDKEETPIIDEFLKW-------------------
--------------RYSSTNSRWEQCLPRG--DLQY--FTDTHVTYFVLDATTWLRHFGH
VYKLATSNLLKFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLYYERKLLPLRFT
GNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSK--F-----------NQLNKDAKA
SGRESITTIDD---------------GKFNFI---------------ALVTDDINMRNKA
R----AQSIRAFSTKFMFAI-------CHEI-----------------------------
-------GLSKKVCTD---
>SAKL0E15004g
-------M-----------GDTTTTDYSTVAFTSPANSRIQMASHPTLH-----------
-----------------------------------------------QKRHNSNSYDYYD
SG-YAKRRPNTLSQNVS------------------------------QNDELAASAACFL
DS------NLTPSKHQECT--PSSFQRA------------------------TDETPQPF
YPADTPQS----------------PFYLPTTSSSNLEAASKVITNDNSSV----------
----------------------------------QLPDICIDNKQQPERRQQQRLEK--R
VNHDDKKITRNA------------------------------------------------
---ANGEQKESITDELQGTDNTPHEQS------------------SNTHADTNQ------
-----QSDQHNSVQQGSSGGSDDGENNRENSG------IPIVNVPPKHTS-QALVQKLQD
IYRSIVKQEIELQERCSQ---LTNSQTTDMKNLWVI--YKVNAELINNYISFITTALLPS
QPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFM----------DPEVCCQFI
SHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----SQA
LIYTYGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVID
NIYQRAF-----AERS-GGS------SRNF---------------P-IVEYLKHSEVMLL
PSFLESPE------LQKVVLTFFQQRFGV-------------------------------
----WPNN---------VD--------FFDHKQIFIQ-DGEKLR---YFFSHAPAFAESH
ILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSK-----------------------
-------------------------------------------SSPPLPTNLD-------
-------DGNGSSSIS---VDHYFENIDSHRVPY-SFPQDI--QIWQQSLSYLNLTSMEC
SMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISS-LSSDALKKFWLVFMRRIFPWNSL
VSFLNTLMAFLLDNS--------RNMS------SVEKLCEEYNKM---DLHTLVEHFTNS
E-ELPEVWKCWGTLWFDTISNKS--------------ELKASSVQS--------------
----------------TGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAK
-EFH-YG-IRVS-DTPISTRR-DVTTLHA----LKRFSFKFEE---------------LP
QEWDNE---------------VFLQSDNFIKV----------------------------
------------------------------FEPISPINSNFEAVPS-LSMIDG-ESIFEF
QGYRRMYPDYYCFNKNGDLITGSLYTSGLLE----------------RVAIQGGDDFNVK
RHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDP-------------------
--------------AFM--ESLRDSRFPHG--DLAC--NADSNVTYFVLDATSWLRHFAH
VYKLATNNVLKFAICLTTFQELRFLRK-SKDESVVEAATRAVITARQLYYERKLLPLRFT
GNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRK--F-----------KGLNLQARD
QGQEYIPTDPKDD-------------DKFNFV---------------VLVTDDLNMRTKA
E----AHDIHIFSSRFMFAF-------CNQL-----------------------------
-------GYNQKVCIN---
>KLTH0E00968g
-------------------MEFMRDIPTGISGVNVEASPAQ-------------------
-----------------------------------------------QKRQHSRSCDYMG
SG-VNKRRLGSGISGAAAAA---------------------------AALFLDS------
--------GGSPVRRKDAQS----------------------------------------
------------------------PSYMPTTSSS---NLEAAAVENENSSV---------
----------------------------------RLSDICIDPRMDSSADHNCKMRG---
----------------------------CDLASKNQHQTFSNCIQTASA-----------
---VPGAPAGNAPAYSEHSVPNNAAQT------------------ESGEARAPV------
-----NSGGLTGRNDRGNDHDNNNNNPNEN--------TPAAGQTSSQTS-QALVQKLQD
IYRNIVKQEVELQERCSQ---LTHSQTTDLKNLWII--YKVNTELINNYVAFITTALLPS
QPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWY-----TQA
LSHIFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVID
NIYQRAF-----AERN-GGN------QRNS---------------L-MVEYLKHSEVMLL
SSFLESPE------LQKVVLSFFQNKFGI-------------------------------
----SSNN---------TD--------YFSHQAIFLQ-DGERTK---YFFRHAPAFAESH
ILQMVGFGNPKNPFALLFELPKFLKERKERKERRKS------------------------
-------------------------------------------KSSNSFTSME-------
----------APSPTS---PIEYLESVDSPRFVY-EFPTDL--AIWQQSLSHINTTSIKC
SAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDE-LPSPELKDFWIALCRQVFPWNSI
VNFLNMIIAFALDNA--------WKTS------SIDNLCEQFDSV---DVRTLVDHFSQN
E-DLPEVWKCWGALWFDVISDKS--------------DVVDEGATY--------------
----------------NSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQ
-EFN-MG-LTLA-SVPLQSRRSL-AAGHP----LQNFCFKFED---------------PP
VDSESYA--------------LISTQ---MPA----------------------------
------------------------------FENISERNLDPNAPPG-QSMLEG-KSLFEL
PGYRQLHADHTCFNKTGTLITCSLYTSGSLE----------------KGPIHGGDDFNTE
RYSRSDELNKADNPQI--------KELDKMERMWLDTCMNP-------------------
--------------EFI--EQTYDMKFPFG--DLSC--NCDSGVSYFVPDATSWLRHFAH
VYKLATNGVLRFAICLTTFQELRFLRK-SKDESVVEAATRAVITVRQLYSEKRLLPLRFT
GNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK--F-----------EALNAQAKE
GGHDFIPTTEE---------------EPFHFI---------------ALVSDDTNMRLKA
H----AQRIRTFSSRFMFAV-------CNQI-----------------------------
-------GLAHHACTN---
>Kwal_55.19678
-------------------MEVMRDIPTETSGSVFGANTVQ-------------------
-----------------------------------------------QKRQHSRSYEYMG
SG-VSKRRVGSGVSGTTAAA---------------------------AASFLDCEGSP--
--------LRRREVTPTLGRGPTIGMPH------------------------SVMSADNA
YS----------------------PSYLPTTSSS---NLEAAVTENENGSVNFPDI----
----------------------------------CIERQRTDPHSVRYTRTEQGNVR--P
QSHESL--------------------------SNHQHHTLPNSIQGGSS-----------
---SAGLPTGDQDFREGSTPENSSRSS-------------------RHGPHDNQ------
-----ESKGYANSDERSNNNHENNNNNPNEN-------SQAVSPSSSPTS-QALVQKLQD
IYRNIVKQEVELQERCAQ---LTTSQTTDLKNLWII--YKINIELINNYVAFITTALLPS
QPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFM----------DPEVCCQFI
THVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWY-----SQA
LSHIFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVID
NIYQRAF-----AERN-GGN------HRNS---------------L-MVEYLKHSEVMLL
SSFLESPE------LQKVVLSFFQHKFGV-------------------------------
----STSN---------TD--------FFNPRDMFLQ-DGERVK---YFFRHAPAFAESH
ILQTVGFGDPKNPFALLFELPKFLKERKERKERRKS------------------------
-------------------------------------------KSSHSFTSIE-------
----------TTSHLS---PSEYLENVDSPRYAY-EFPEDL--AIWRESLSHINITSARC
SSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDS-LPSVELKSFWITLVRQIFPWNSI
VDFLNMLMAFVLDNN--------WKTS------PIDTLCEQLDSV---DARSLVEHFSEH
E-DLPEIWRCWGALWFDVIADKS--------------NGEDGDVIN--------------
----------------SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ
-EFS-LG-LTLSAFAPQ--SRRPMTAGHP----LQNFSFNFEE---------------IP
AQSQ-----------------IQSFVRNQIPL----------------------------
------------------------------FEEIATGNLDPNIRPG-QSMLEG-ESIFDF
PGYRQMYADYTCFNKSGSLISCSLYTSGKLE----------------RGPIQGGDDFNTE
RYGRSEDSNKPENAQI--------TELERLERDWLDNCMNP-------------------
--------------EFI--EQAYEMKFPFG--DLSC--NCDSGVSYFVLDATSWLRHFAH
VFKLATNNVLRFGICLTTFQELRFLRK-SKDESVVEAATRAVITVRQLYSDKKLLPLRFT
GNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKK--F-----------EAINAQAKE
AGHDFIATTDE---------------EPFHFV---------------ALVSDDTNMRVKA
H----TQRIQTFSTRFMFAV-------CNQI-----------------------------
-------GLAHQACTN---