MUSCLE (3.8) multiple sequence alignment

KLLA0A00506g             -------------MTDTKGRTKIGEVSELV-DAWFGKK---RKLLYAHKKC---------
Cgla_YGOB_Anc_5.707      ---------------------MIRITEVVF-RKRSKSVHNKRKPLAA-------------
SAKL0E15026g             -----MGISEQRVSKRHTTALSQPFSVLLN-NSRAVSPRSSRKPLASKSTNRNLSLSQLL
KLTH0E00946g             ---------------MTRETRAQDRASNVF-RNLSTLASKERKPLQPRPVNI--------
Kwal_55.19675            ---------------MNSDTQSRDHASNLF-KNITALSSRERKPLQPKSVNI--------
KNAG0L02160              ---------------MSPRPVSLSRLQVLE-GSRSGRT---SGALRGKSINI--------
NCAS0G00210              ---MDFNSRPANRVLKGKDGGNWKRGFDIFVDPNKGKPKRRLEHVDGQHVKTSNNISLSR
NDAI0F00270              MVERRGFVIYPDYNNNQSRISNHSENTLLI-NEKKETSSQLLSSSQRSITSIDVENAKER
KAFR0D02200              ---------------------MTALLQSRY-DVNKNCVEHTRRNLEFIKSSM--------
TDEL0B02130              ---MPRRLNQTHPPYFGIDPIMGKRCNVLP-DRSSRMPIGKLGSVVTKKRAL--------
Kpol_1043.74             ---------------MTTSTRNSRRIGSII--KRKKIIHKKKPPL---------------
Suva_9.36                -------------------MGHKRRGLVIY-QDQKQQQHSPGKSISSLAWSA--------
YIL152W                  -------------------MSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSP--------
Skud_9.16                -------------------MSHKRRGLVIY-QDQKQQQQPSGQSLSSISWSP--------
Smik_9.17                -MIIHTNNEVKEASVPCKQMSHKRRGLVIY-QDQKQQQRPSGQSISSISWSP--------
TBLA0I01690              ---------------MSSQRSSIRRGFCIYQNPYNNNSSSSVSSVSSIETLD----NSPK
ZYRO0B16434g             ---MDRKGSDLYRDARSKNPGALRLSQLAY-KSSSLLSTRKNLPLESKNVNV--------
TPHA0E00180              -----------------------MKSRLII-DHKRLVSH---------------------
                                                                                     

KLLA0A00506g             ------------------------------------------------------------
Cgla_YGOB_Anc_5.707      ------------------------------------------------------------
SAKL0E15026g             PRSSSPRKAPSHQKCKKTKTPGPPAASSAHDVFSKLSTYSAGCLRHVPENQGNNRMSLSQ
KLTH0E00946g             ------------------------------------------------SQLVASQKLRSP
Kwal_55.19675            ------------------------------------------------SQLVASQKQDNA
KNAG0L02160              ------------------------------------------------------ASLVAG
NCAS0G00210              LPVVPVKERKVLTEKTN----------NFSTLLSQSRHTSHKSSKMNEISILKPVQFTSI
NDAI0F00270              YHKTNNINSLFTLAHKS------------------IKKVAKEPRNNLPISSFTSGKFKSI
KAFR0D02200              --------------------------------------------------------NSTH
TDEL0B02130              --------------------------------------------RPTDVNVSAVFNRSST
Kpol_1043.74             ------------------------------------------------------------
Suva_9.36                --------------------------------------AQQHPLKQQSTNSFTAILSKSC
YIL152W                  ------------------------------------TRRPHHPLKQQSTNSFSEILSKSS
Skud_9.16                ------------------------------------TRRHHHPLKQQSSNSFTEILSKSS
Smik_9.17                ------------------------------------KQRPHHPLKQQSTNNFTAILSKST
TBLA0I01690              ITLSHHNDKLVKTQLHFLDQNGVTLNSNTKNFPTKSAFGGKHPLLTSFTNEQTSRLIKKH
ZYRO0B16434g             ----------------------------------TSLCGSKKIEHASFKRKPLSSINQKS
TPHA0E00180              ------------------------------------------------------------
                                                                                     

KLLA0A00506g             ---NASNIGGKGSINKLIQTSKSVVRAR--------------------------------
Cgla_YGOB_Anc_5.707      ------------------------------------------------------------
SAKL0E15026g             LVSVASAAKAEDPLPQQMKPSSPATFDAILQSSIAGGNSTSTDGR---------------
KLTH0E00946g             PNTPASAKSPASLLSNAISRSRPKSHDGSLRSVAQV------------------------
Kwal_55.19675            HKTVSVRAATPTSLSTLISKSRPKSGHSPMRFSVARV-----------------------
KNAG0L02160              SRHRHRHQSSGVSVSSVLLQCKRRVAPKGYRPALHR------------------------
NCAS0G00210              SKKQVEIAKPLKSINNIMDNVTIRQSDTLNVEPPRSKR----------------------
NDAI0F00270              TLKDTKRAGPLQSIQNIIYNCKGYPHSVFMAKQLERKEPTTI------------------
KAFR0D02200              CLKNSKETQGRTQVITILNNSE--------------------------------------
TDEL0B02130              CKIPDTGLMKATALGGVLEE----------------------------------------
Kpol_1043.74             ------HQQPSTELNNIFNNTKF-------------------------------------
Suva_9.36                LRQDVQQDSSHLPISSLVLKQQQQQQQHPSQSSGPPLRKL--------------------
YIL152W                  VQPNVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQL------------
Skud_9.16                VQQDVRQDSSHLPISSLVLKQQQQRRNMPSQNSGPPLRKV--------------------
Smik_9.17                VQQDVQQDRSHLPISSLVLKQEQHQQNEEQRRRNMQQQNSGPPLRKL-------------
TBLA0I01690              SNSINNGSVSLNSFDNILHNSKSNKRDNSLQPLTAAISPRSSANRRHVGHSSIICDEQND
ZYRO0B16434g             YVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGED--------------------
TPHA0E00180              ---LDSRKKNKKAISELLA-----------------------------------------
                                                                                     

KLLA0A00506g             --------------------------------ASKRQKTYTAPMAASIIPKA--------
Cgla_YGOB_Anc_5.707      --------------------------------PRFRRTVYRQGTQNHLRLPF--------
SAKL0E15026g             --------------------------------TGGTKFTGSSNVQRYLHPEF--------
KLTH0E00946g             --------------------------------IGSDYHLTPTKPHYRARAKK--------
Kwal_55.19675            --------------------------------IGSRHHLAHAPAQYGIRPKK--------
KNAG0L02160              --------------------------------TQTVPRQVVGKARPHLDSVI--------
NCAS0G00210              --------------------------------PYLNYPLPKKLSRTSTSDVS--------
NDAI0F00270              --------------------------RDGIAILDSKNGIGSKIIKAKFRKSHFKLGSVTR
KAFR0D02200              --------------------------------VKKMTFARHWNERPHLNLLD--------
TDEL0B02130              --------------------------------ATTSRVARGRRVKPHLRRSR--------
Kpol_1043.74             --------------------------------KGFKKRNKHVPTTANIYSTS--------
Suva_9.36                --------------------------------VQNSQWTSSATHRPSWKQEK--------
YIL152W                  --------------------------------VQESQWTSSASNSSLKKQEK--------
Skud_9.16                --------------------------------VQDSQWTSSTIHCPSRKQEK--------
Smik_9.17                --------------------------------VQESQWTSSTSHCHSRKQEK--------
TBLA0I01690              LFLKYFQDAFDIRLKKHKLAPNISKLRPHLRFLGKKYTKHKSIKQNFLKVAY--------
ZYRO0B16434g             --------------------------------IRDSYTLRRRIRDDNEKCAS--------
TPHA0E00180              --------------------------------TKKKYNKTYSKLKLNNNFHN--------
                                                                                     

KLLA0A00506g             ------D---FSNDISHSPRTVQAIVFDSSTKIRLMKE--HHSDADWLRLVVRQHHKLND
Cgla_YGOB_Anc_5.707      -------------------------LHSFKTVLRQRAEGAT------ISVPVCRCIQLSP
SAKL0E15026g             ------S---ASLSKDSMLFRLQKSLCDFNTVYKLSSH-VSKPNYD-IVLTVDCTQQLSP
KLTH0E00946g             ------RYDLAFPAGKALVNRLLKCVSAFETNRRLQRHGLSTHEYD-RKLHVQYTKLLSP
Kwal_55.19675            ------RY--EQEASGALIRHLFKCVNSLETSWRLQRHGVATHQYD-RRLRVQYFKSLSP
KNAG0L02160              ------EALGSQQGTPTLVQQLQRSLGRLNQLVLTTGH---SRHYD-ALVGVTGCLKLSS
NCAS0G00210              ------SRDNSNNEPKIFVTSLQKYLCDLDTMMKTSK----KFSYD-SVWTINSITKLSD
NDAI0F00270              KYELFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLS----YHSYD-TLLTVTSFEMLSD
KAFR0D02200              ----------ECNKPVSLAISLQKSLWDLNALVTVSKN---NKKYD-LLIKVASARRLSS
TDEL0B02130              ------DQGLETSRDKSLSTAVSVALSHLNTRIQVL-----SGELD-QLMAFERLVLLSQ
Kpol_1043.74             ------NNQLSVSKYSPSLLSLHNSLYVFNTIVRSGS----LLKFD-HVWHILHFQLLSQ
Suva_9.36                ------QPKAFYHTDSRLVSQLHSSVKDLDTIVQTH-----KPRFDTIIHDLSHTTILSP
YIL152W                  ------QPQTFYNTDSKLVSQLHSSVKDLDAIIQTH-----KPKFDTIIRDFSQATILSS
Skud_9.16                ------QSLTFYRTDSKLVSQLHTSVKDLDTIVQTH-----KPRFDTIIHDLSHTAILSS
Smik_9.17                ------IPQGFYSSDSKLVSQLHSSVKDLDAIIQTH-----KPKFDTIIHDLSRTTILSS
TBLA0I01690              ------SKSYNEYLKTPLVNGLHTILSNLNTRIHSSR----NLKFD-KIFQISKLTKLSD
ZYRO0B16434g             ------S---ADKKKTNLVTQLICALNDFNLMVKTSQQ---NQNYD-ILVDIRHAIWLSP
TPHA0E00180              -----------FKCSSASVSDLRLSINKFNMLLKAS-----SNKYD-EIHDINSIEKLSQ
                                                  :   .                     .     *. 

KLLA0A00506g             KLT--LLKTDHPKFSTV------ILQGL----------------CSSNVH-----HVLCH
Cgla_YGOB_Anc_5.707      NEI--MVWTNANGVEP------LILHSN----------------TKLQIATTKYTRIQYC
SAKL0E15026g             DEL--LVISSECAHA-------IVLHRFKNK-------------AFPRTEKHRVLKLHLD
KLTH0E00946g             TEL--LAVAAGPLGREV-----LILHMLP---------------STKDAEPKSGSQLLLS
Kwal_55.19675            TED--LAVASSSTGQEI-----LILHRTS---------------LRDSISLRAGSELMLD
KNAG0L02160              HEL--MLETGHSSKR-------YVLHSNGPVHG-----------FLLDQIASGGYTVALY
NCAS0G00210              FEL--QVTTQMSPQL-------IILHNKTSINNIPILKFIHDVSINTKIQVTESLKLAIN
NDAI0F00270              HEI--KINSVKNYTAGFTTDVTMLLHSKISLN------------VPLPNNLHKDYKLALD
KAFR0D02200              TEM--LIIPSTDEAMR------YILHKPLTF-------------RTNSVDNFTGAHLALN
TDEL0B02130              HEL--LVVTQRKIF---------VLHSVIPL-------------TREGVSRFGALKLAVN
Kpol_1043.74             FQIYCLVVDHNEMTKNI------ILYKNNNNNN-----------NANITLPTTFAKIAIN
Suva_9.36                NEL--LIKLHTEDT--------IILHSRTPIINAE---------WLRNKVSNAGASLVID
YIL152W                  NEL--LIKLPKDQT--------IILHSRAPKINAE---------WLQNKVNDPSASLVID
Skud_9.16                NEL--LIKLPMNDT--------IILHSRIPKINAE---------WLHNKTSDPSASLVID
Smik_9.17                NEL--LIKLPMEET--------IILHSRTPTINEE---------WLHNKVSNPGASLVID
TBLA0I01690              TEL--LVITNTNSS--------LLLHSDSTIG------------QSEFNNYTLKEKVATN
ZYRO0B16434g             FEI--MVISDDPRVKRA------ILHSH----------------KAIPKFVNSPSRLAIC
TPHA0E00180              NEF--IVTTIDSKT--------LILHSNEKNV------------VNSNNYTLKYQQVAIN
                                                :*                               :   

KLLA0A00506g             DVSFFSLYRGVFWCLNWKLG------------------
Cgla_YGOB_Anc_5.707      PSNKFQLTRRISWYFQWELH------------------
SAKL0E15026g             SRSEIELYPGLYWYSNWYFADANR--------------
KLTH0E00946g             SNASALLYPGLRWYFEWRVI------------------
Kwal_55.19675            SSSSLLLYPGLRWYFQWQAVNALDSHLQSELQVSQLPK
KNAG0L02160              SKLAVRVTPDLYWCLQWKLVPAVH--------------
NCAS0G00210              SKSFIKVSDDINWYIDWKFIPSQ---------------
NDAI0F00270              SKVYLELAPNVKWYLVWKFI------------------
KAFR0D02200              SKISFRLDDTLIWCLNWKLLQ-----------------
TDEL0B02130              SQCYYVLYNDVVWFMRWKFF------------------
Kpol_1043.74             SNSFVHLYGNVNWYLHWRPL------------------
Suva_9.36                SRSFLILCSNIKWYLHWKFI------------------
YIL152W                  SRSFLTLCNNIKWYLHWKFI------------------
Skud_9.16                SRSFLILCNNIKWYLHWKFI------------------
Smik_9.17                SRSFLILCNNIKWYLHWKFI------------------
TBLA0I01690              SISILKITEDLNWYLKWKFI------------------
ZYRO0B16434g             SKCCLTLYNDMNWYLKWKFL------------------
TPHA0E00180              SKYYLSLYNDLNWYLDWKFYDKIKTLLKAYIHT-----
                               :   : *   *                     

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0A00506g
-------------MTDTKGRTKIGEVSELV-DAWFGKK---RKLLYAHKKC---------
------------------------------------------------------------
---NASNIGGKGSINKLIQTSKSVVRAR--------------------------------
--------------------------------ASKRQKTYTAPMAASIIPKA--------
------D---FSNDISHSPRTVQAIVFDSSTKIRLMKE--HHSDADWLRLVVRQHHKLND
KLT--LLKTDHPKFSTV------ILQGL----------------CSSNVH-----HVLCH
DVSFFSLYRGVFWCLNWKLG------------------
>Cgla_YGOB_Anc_5.707
---------------------MIRITEVVF-RKRSKSVHNKRKPLAA-------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------PRFRRTVYRQGTQNHLRLPF--------
-------------------------LHSFKTVLRQRAEGAT------ISVPVCRCIQLSP
NEI--MVWTNANGVEP------LILHSN----------------TKLQIATTKYTRIQYC
PSNKFQLTRRISWYFQWELH------------------
>SAKL0E15026g
-----MGISEQRVSKRHTTALSQPFSVLLN-NSRAVSPRSSRKPLASKSTNRNLSLSQLL
PRSSSPRKAPSHQKCKKTKTPGPPAASSAHDVFSKLSTYSAGCLRHVPENQGNNRMSLSQ
LVSVASAAKAEDPLPQQMKPSSPATFDAILQSSIAGGNSTSTDGR---------------
--------------------------------TGGTKFTGSSNVQRYLHPEF--------
------S---ASLSKDSMLFRLQKSLCDFNTVYKLSSH-VSKPNYD-IVLTVDCTQQLSP
DEL--LVISSECAHA-------IVLHRFKNK-------------AFPRTEKHRVLKLHLD
SRSEIELYPGLYWYSNWYFADANR--------------
>KLTH0E00946g
---------------MTRETRAQDRASNVF-RNLSTLASKERKPLQPRPVNI--------
------------------------------------------------SQLVASQKLRSP
PNTPASAKSPASLLSNAISRSRPKSHDGSLRSVAQV------------------------
--------------------------------IGSDYHLTPTKPHYRARAKK--------
------RYDLAFPAGKALVNRLLKCVSAFETNRRLQRHGLSTHEYD-RKLHVQYTKLLSP
TEL--LAVAAGPLGREV-----LILHMLP---------------STKDAEPKSGSQLLLS
SNASALLYPGLRWYFEWRVI------------------
>Kwal_55.19675
---------------MNSDTQSRDHASNLF-KNITALSSRERKPLQPKSVNI--------
------------------------------------------------SQLVASQKQDNA
HKTVSVRAATPTSLSTLISKSRPKSGHSPMRFSVARV-----------------------
--------------------------------IGSRHHLAHAPAQYGIRPKK--------
------RY--EQEASGALIRHLFKCVNSLETSWRLQRHGVATHQYD-RRLRVQYFKSLSP
TED--LAVASSSTGQEI-----LILHRTS---------------LRDSISLRAGSELMLD
SSSSLLLYPGLRWYFQWQAVNALDSHLQSELQVSQLPK
>KNAG0L02160
---------------MSPRPVSLSRLQVLE-GSRSGRT---SGALRGKSINI--------
------------------------------------------------------ASLVAG
SRHRHRHQSSGVSVSSVLLQCKRRVAPKGYRPALHR------------------------
--------------------------------TQTVPRQVVGKARPHLDSVI--------
------EALGSQQGTPTLVQQLQRSLGRLNQLVLTTGH---SRHYD-ALVGVTGCLKLSS
HEL--MLETGHSSKR-------YVLHSNGPVHG-----------FLLDQIASGGYTVALY
SKLAVRVTPDLYWCLQWKLVPAVH--------------
>NCAS0G00210
---MDFNSRPANRVLKGKDGGNWKRGFDIFVDPNKGKPKRRLEHVDGQHVKTSNNISLSR
LPVVPVKERKVLTEKTN----------NFSTLLSQSRHTSHKSSKMNEISILKPVQFTSI
SKKQVEIAKPLKSINNIMDNVTIRQSDTLNVEPPRSKR----------------------
--------------------------------PYLNYPLPKKLSRTSTSDVS--------
------SRDNSNNEPKIFVTSLQKYLCDLDTMMKTSK----KFSYD-SVWTINSITKLSD
FEL--QVTTQMSPQL-------IILHNKTSINNIPILKFIHDVSINTKIQVTESLKLAIN
SKSFIKVSDDINWYIDWKFIPSQ---------------
>NDAI0F00270
MVERRGFVIYPDYNNNQSRISNHSENTLLI-NEKKETSSQLLSSSQRSITSIDVENAKER
YHKTNNINSLFTLAHKS------------------IKKVAKEPRNNLPISSFTSGKFKSI
TLKDTKRAGPLQSIQNIIYNCKGYPHSVFMAKQLERKEPTTI------------------
--------------------------RDGIAILDSKNGIGSKIIKAKFRKSHFKLGSVTR
KYELFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLS----YHSYD-TLLTVTSFEMLSD
HEI--KINSVKNYTAGFTTDVTMLLHSKISLN------------VPLPNNLHKDYKLALD
SKVYLELAPNVKWYLVWKFI------------------
>KAFR0D02200
---------------------MTALLQSRY-DVNKNCVEHTRRNLEFIKSSM--------
--------------------------------------------------------NSTH
CLKNSKETQGRTQVITILNNSE--------------------------------------
--------------------------------VKKMTFARHWNERPHLNLLD--------
----------ECNKPVSLAISLQKSLWDLNALVTVSKN---NKKYD-LLIKVASARRLSS
TEM--LIIPSTDEAMR------YILHKPLTF-------------RTNSVDNFTGAHLALN
SKISFRLDDTLIWCLNWKLLQ-----------------
>TDEL0B02130
---MPRRLNQTHPPYFGIDPIMGKRCNVLP-DRSSRMPIGKLGSVVTKKRAL--------
--------------------------------------------RPTDVNVSAVFNRSST
CKIPDTGLMKATALGGVLEE----------------------------------------
--------------------------------ATTSRVARGRRVKPHLRRSR--------
------DQGLETSRDKSLSTAVSVALSHLNTRIQVL-----SGELD-QLMAFERLVLLSQ
HEL--LVVTQRKIF---------VLHSVIPL-------------TREGVSRFGALKLAVN
SQCYYVLYNDVVWFMRWKFF------------------
>Kpol_1043.74
---------------MTTSTRNSRRIGSII--KRKKIIHKKKPPL---------------
------------------------------------------------------------
------HQQPSTELNNIFNNTKF-------------------------------------
--------------------------------KGFKKRNKHVPTTANIYSTS--------
------NNQLSVSKYSPSLLSLHNSLYVFNTIVRSGS----LLKFD-HVWHILHFQLLSQ
FQIYCLVVDHNEMTKNI------ILYKNNNNNN-----------NANITLPTTFAKIAIN
SNSFVHLYGNVNWYLHWRPL------------------
>Suva_9.36
-------------------MGHKRRGLVIY-QDQKQQQHSPGKSISSLAWSA--------
--------------------------------------AQQHPLKQQSTNSFTAILSKSC
LRQDVQQDSSHLPISSLVLKQQQQQQQHPSQSSGPPLRKL--------------------
--------------------------------VQNSQWTSSATHRPSWKQEK--------
------QPKAFYHTDSRLVSQLHSSVKDLDTIVQTH-----KPRFDTIIHDLSHTTILSP
NEL--LIKLHTEDT--------IILHSRTPIINAE---------WLRNKVSNAGASLVID
SRSFLILCSNIKWYLHWKFI------------------
>YIL152W
-------------------MSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSP--------
------------------------------------TRRPHHPLKQQSTNSFSEILSKSS
VQPNVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQL------------
--------------------------------VQESQWTSSASNSSLKKQEK--------
------QPQTFYNTDSKLVSQLHSSVKDLDAIIQTH-----KPKFDTIIRDFSQATILSS
NEL--LIKLPKDQT--------IILHSRAPKINAE---------WLQNKVNDPSASLVID
SRSFLTLCNNIKWYLHWKFI------------------
>Skud_9.16
-------------------MSHKRRGLVIY-QDQKQQQQPSGQSLSSISWSP--------
------------------------------------TRRHHHPLKQQSSNSFTEILSKSS
VQQDVRQDSSHLPISSLVLKQQQQRRNMPSQNSGPPLRKV--------------------
--------------------------------VQDSQWTSSTIHCPSRKQEK--------
------QSLTFYRTDSKLVSQLHTSVKDLDTIVQTH-----KPRFDTIIHDLSHTAILSS
NEL--LIKLPMNDT--------IILHSRIPKINAE---------WLHNKTSDPSASLVID
SRSFLILCNNIKWYLHWKFI------------------
>Smik_9.17
-MIIHTNNEVKEASVPCKQMSHKRRGLVIY-QDQKQQQRPSGQSISSISWSP--------
------------------------------------KQRPHHPLKQQSTNNFTAILSKST
VQQDVQQDRSHLPISSLVLKQEQHQQNEEQRRRNMQQQNSGPPLRKL-------------
--------------------------------VQESQWTSSTSHCHSRKQEK--------
------IPQGFYSSDSKLVSQLHSSVKDLDAIIQTH-----KPKFDTIIHDLSRTTILSS
NEL--LIKLPMEET--------IILHSRTPTINEE---------WLHNKVSNPGASLVID
SRSFLILCNNIKWYLHWKFI------------------
>TBLA0I01690
---------------MSSQRSSIRRGFCIYQNPYNNNSSSSVSSVSSIETLD----NSPK
ITLSHHNDKLVKTQLHFLDQNGVTLNSNTKNFPTKSAFGGKHPLLTSFTNEQTSRLIKKH
SNSINNGSVSLNSFDNILHNSKSNKRDNSLQPLTAAISPRSSANRRHVGHSSIICDEQND
LFLKYFQDAFDIRLKKHKLAPNISKLRPHLRFLGKKYTKHKSIKQNFLKVAY--------
------SKSYNEYLKTPLVNGLHTILSNLNTRIHSSR----NLKFD-KIFQISKLTKLSD
TEL--LVITNTNSS--------LLLHSDSTIG------------QSEFNNYTLKEKVATN
SISILKITEDLNWYLKWKFI------------------
>ZYRO0B16434g
---MDRKGSDLYRDARSKNPGALRLSQLAY-KSSSLLSTRKNLPLESKNVNV--------
----------------------------------TSLCGSKKIEHASFKRKPLSSINQKS
YVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGED--------------------
--------------------------------IRDSYTLRRRIRDDNEKCAS--------
------S---ADKKKTNLVTQLICALNDFNLMVKTSQQ---NQNYD-ILVDIRHAIWLSP
FEI--MVISDDPRVKRA------ILHSH----------------KAIPKFVNSPSRLAIC
SKCCLTLYNDMNWYLKWKFL------------------
>TPHA0E00180
-----------------------MKSRLII-DHKRLVSH---------------------
------------------------------------------------------------
---LDSRKKNKKAISELLA-----------------------------------------
--------------------------------TKKKYNKTYSKLKLNNNFHN--------
-----------FKCSSASVSDLRLSINKFNMLLKAS-----SNKYD-EIHDINSIEKLSQ
NEF--IVTTIDSKT--------LILHSNEKNV------------VNSNNYTLKYQQVAIN
SKYYLSLYNDLNWYLDWKFYDKIKTLLKAYIHT-----