MUSCLE (3.8) multiple sequence alignment

KNAG0L02170        -----MIPGTLGTGERAQLP------------LDVEHAVFRQPQKRIFDSQTTATFQESV
TBLA0E01690        ---------------MESIP---------IYKLD-SNCVFSAPTKQIFDSQGTQYFNRSI
CAGL0H06655g       --------------------------------------MFSEPVKRIYDSQGAYYFQSSE
KAFR0D02190        ------------MNLPNDQP-----------VVDPFASKFSIPAKRIFDSQTTQYFQHSV
KLLA0A00462g       -------------------M-----------DFDYENAKFSMPEKRIFDSQGTLDFQNSV
TPHA0D04650        ---------------MEDLS-----------TINIKEQSFSLPLKRIYDSQSTFTFQSSI
SAKL0E15070g       ------------MISTITTP-----------KIDVSHTKFTEPVKKIFDTQGTQDFQSSV
AFR293C            -------------------M-----------EFSVEGTQFSPPVKRIFDTAGTHDFQKSL
Ecym_4012          -------------------M-----------TVELRKTKFSAPVKRIFDSHGTHDFQRSL
Suva_9.35          ----------------MSLD-----------HVDWPHAAFSTPVKRIFDTQTTQDFQSSL
Skud_9.15          -------MDKHERNGIMSLD-----------HVDWLHATFSTPVKRIFDTQTTLDFQSSL
Smik_9.16          ----------------MSLD-----------HVDWPHATFSTPVKRIFDTQTTLDFQSSL
YIL153W            ----------------MSLD-----------RVDWPHATFSTPVKRIFDTQTTLDFQSSL
NDAI0F00240        ------------MSHKIHKP-------TPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSI
NCAS0G00200        MDKLLLCCDNNDRGRTIKQSAMTTINDTHMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSI
Kpol_2001.77       --------------MKMKQP-----------LLNKEPIEFCLPVKRIYDSQGTSLFQSSV
KLTH0E00880g       ----------------MSLE-----------RIDASSATFTEPTKRIFDSRGSHVFQSSV
Kwal_55.19661      ----------------MEQD-----------QIDVGTTTFTEPVKRIFDSRGTHVFQSSV
TDEL0B02110        ---------------MISEP-----------RIDISQTKFESPVKCIFDSQGASDFQQSV
ZYRO0B16478g       ------------------MR-----------MLTNENTQFNTPVKRIFDSQCTLEFQASV
                                                          *  * * *:*:  :  *: * 

KNAG0L02170        ALARIRFHIEKYMRMMRGDTSG-------GISASVARMLQI-LDRLDALVDETPPLVG-P
TBLA0E01690        AFHRIQYFISKYTQLIQEENIP--PTDYTSSNDTISGVSKI-INDLIKLVEETPPLPG-P
CAGL0H06655g       AIRRLEGAIVKYTDLVESRDVA-----DLELSGVVGGVVKV-LDRLDQLVSETPPIPG-P
KAFR0D02190        ANYRLKYFTNKYINLVRGVPLP---VSRNITMTITRYILDL-LDKCSQFIDETPPLIE-P
KLLA0A00462g       AMVRIQYHLQKYITLCKGQQIP----DTIKESFFTNIVVEL-LKRLSALIDETPPERM-H
TPHA0D04650        AIYRLKYYLHKYINMVHNVEIP--DLTYVSEITIVNEMSSL-LTELSNDIDTIPPFEG-P
SAKL0E15070g       TMYRLQSYLHKYITLVGTKNIP-----STSNNDAVNRFTQI-IDALSRTIDETPPLPG-P
AFR293C            TMYRLQSHLERYLKLVQGQKIP-----KSSQNRAVVRFVCI-LERLDALMDETPPRTGSA
Ecym_4012          TMYRLQSHLERYLGLVHNQEVP-----KVSTNGSVSSFVSIFLDRFLELIDETPPTTNTP
Suva_9.35          AIHRIKYHLHKYTTLMSHCADP-DPHATASSIPMVNGLMAV-LDRFAQLIDDTPPLPG-P
Skud_9.15          AIHRIKYHLHKYTTLMSHCPDP-DAHAASSSIAMVNGLMGV-LDKLAQLIDETPPLPG-P
Smik_9.16          AIHRIKYHLHKYTTLMSHCADP-DPQAVASSIPMDNGLMQV-LDKLAHLIDETPPLPG-P
YIL153W            AIHRIKYHLHKYTTLISHCSDP-DPHATASSIAMVNGLMGV-LDKLAHLIDETPPLPG-P
NDAI0F00240        ALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHL-LNELSTIVQDTPPLKG-P
NCAS0G00200        ALNRLRFFLQKYISMVTNVQTP--PEGTLSSVTLVNSIVQL-LNHLSTLIDETPPLVG-P
Kpol_2001.77       AIFRLKYFISKYIKLVPNVDIP--DESYVSEIPTVNKLVKL-ISELSLLVDETPPAPG-P
KLTH0E00880g       AMGRLKSYLHKYVSSMSGVKIP-----ETSTNHEVRSFAEL-LKTLSELVDSTPALPG-P
Kwal_55.19661      AMIRLKKHLHKYLGMLSGQRIP-----SETSNPNVISLRKI-LHFFSKLVDETPALPG-P
TDEL0B02110        AIDRLKYHLEKYARMIHGQPIV----HEPSGIEVVNRVVSL-LSRLSELVDETPPFSG-P
ZYRO0B16478g       AIVRLKYFIQKYAKIINRVNIP----QGPSRISVVNEFVGV-LNHMSLLVDQTPPLEG-P
                   :  *:     .*                         .  : :      :.  *.     

KNAG0L02170        RRYGNLACRDWHDKVDSSLPGLTSQVDCL-----------------AGGGACIEAEYYLR
TBLA0E01690        RRYGNLSCRQWHKRVDDNINELFEKY--L----TISNTK------FNKDQLFLELIYYFN
CAGL0H06655g       RRYGNMACRDWHEKIEREIPGLLEDL--ISSHFP------------SELQCVVELRYYLA
KAFR0D02190        RRFGNLSCRTWHDKINSYLPGELKTI--I----DNFSTI-------ENENMFNELNYYLL
KLLA0A00462g       SRYGNLSYRDWQTKFQNQLENWLHEL--L----P----E-------KYNNSIIELSYYIS
TPHA0D04650        RRYGNLACRNWHSLIDSKVPLLLEKV--L----GCSNHATEKGEFEKLKGCIIELNYYLC
SAKL0E15070g       RRFGNFACRTWHVKMRGSLDALLQAF--I----P----E-------KYHVCIVEIRYYLG
AFR293C            RRFGDLACRDWHDRMQGELDGLLETL--L----P----E-------AARRSAAELRYYLG
Ecym_4012          RRFGNMACRDWHAKVQEEMDSLWRRF--L----PIERDA-------AYENCIIELRYYLG
Suva_9.35          RRYGNLACREWHYKLDAHLAQWLREV--L----P----A-------QYHAVVPELQYYLG
Skud_9.15          RRYGNLACREWHYKLDEHLSQWLQEM--L----P----A-------EYHVVVPELQYYLG
Smik_9.16          RRYGNLACREWHHKLDERLPQWLREM--L----P----P-------EYHVVVPELQYYLG
YIL153W            RRYGNLACREWHHKLDERLPQWLQEM--L----P----S-------EYHEVVPELQYYLG
NDAI0F00240        RRYGNLACRDWHSKIEVELPKLLEKA--I----P----S------PDLQPSIIELNYYIA
NCAS0G00200        RRYGNLACRDWHTKMEAQLPALLNEI--LDPYLPKVSGE-----SSSMHPCIQELNYYIS
Kpol_2001.77       RRFGNLSCREWHKKVDLNLKSLLMKM--L----T----DDKQNISSKCKDSVVELSYYLG
KLTH0E00880g       RRYGNLACRTWHDKVDESLEALLHKF--L----P----E-------PCHKSIVELQYYLG
Kwal_55.19661      RRYGNLACRDWHDKMEEQIREQLQEF--L----P----E-------KYYPSIVELAYYLG
TDEL0B02110        RRYGNLACRDWHDKLDANLTELLQQV--L----P----Q-------DYHKCIPELSYYLG
ZYRO0B16478g       RRYGNLACRDWHAKIDEQMPSLWRKV--L----P----D-------RFHHCIVELVHYLG
                    *:*::: * *:  .   :         :                        *  :*: 

KNAG0L02170        NSFGSKIRLDYGTGHELSFLAFVAALDMMSQP-----RG--ITPVELSRLWDRYYRLVRR
TBLA0E01690        ASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-----TD--ISGTDILFIFNEYYRLIRK
CAGL0H06655g       NSFGSATRLDFGTGHELSFLATVAALDMLGAS---------FDGDQVLYIFDRYYSLVHR
KAFR0D02190        NSFGSKTRLDYGTGHELSFLAFISCIDMIRML-----QD--MTADDFLLIWQSYYNLTRK
KLLA0A00462g       NAFGSKERIDYGTGHELSFLAVIICLDMLKIE-----T---IKGPALLYCFNSYYDVIQK
TPHA0D04650        NSLGSATRLDYGTGHELSFLAVIAAMDMLGLW-----TEN-FKGVDLLHMFHCYYELVKK
SAKL0E15070g       NAFGSKERLDYGTGHELSFLAVVSAIDMLDLW-----GSN-PSGEDILFLFNGYYTLVKK
AFR293C            SAFGSRERLDYGTGHELAFLAVVVALDMLGLW-----TEDKFTGEDMLYVWARYYALVHR
Ecym_4012          NAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHG-LTGTDLLYLWNKYYSIVHK
Suva_9.35          NSFGSSTRLDYGTGHELSFMATVAALDLLGLF-----PH--LRGTDVFLLFSKYYAIMRR
Skud_9.15          NSFGSSTRLDYGTGHELSFMATVAALDLLGVF-----PH--LRGNDVFLLFNKYYTIMRR
Smik_9.16          NSFGSSTRLDYGTGHELSFMATVTALDLLGMF-----PH--LRGTDVFLLFNKYYTIMRR
YIL153W            NSFGSSTRLDYGTGHELSFMATVAALDMLGMF-----PH--MRGADVFLLFNKYYTIMRR
NDAI0F00240        NSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-----PD--LTGKDLLIMFNAYYSLVRE
NCAS0G00200        NAFGSSTRLDFGTGHELSFMAFIAAIDMLGLW-----TDG-MQGTDILLLFNTYYALVRK
Kpol_2001.77       NSFGSSTRLDYGTGHELSFIAVIAGIDMLGLW-----TEN-IKGGDLLIIFNEYYKLMKK
KLTH0E00880g       NAFGSRERLDYGTGHELSFFAEICALDMLGVW-----GAD-FQASDVLFLFDKYYALVRK
Kwal_55.19661      NAFGSRERLDYGTGHELSFFSVICALDMLGIW-----GSG-FQAKDLLYLFNEYYSLVRK
TDEL0B02110        NSFGSSTRLDYGTGHELSFLAVLGALDMLGLW-----TSE-FSGKDVLLLFDTYYKLVRK
ZYRO0B16478g       NSFGSATRLDYGTGHELSFLAVVGAIDMLGLF-----TDE-FQGEDFLLIMNAYYAVVRK
                    ::**  *:*:******:*:: :  :*::                 .      ** : . 

KNAG0L02170        LIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQF--ANNP------------VGVQPRDVL
TBLA0E01690        LILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDIL
CAGL0H06655g       LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQW-CNRKK------------LAMEPNDLS
KAFR0D02190        LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQL--ISDI------------SHLAPKDIL
KLLA0A00462g       LILTYKLEPAGSHGVWGLDDHFHFSYILGATQL--LDVN------------TSLIPKDIS
TPHA0D04650        LIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQL-SENPN------------PPFSPSDII
SAKL0E15070g       LIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHN-------------PLRPSDIL
AFR293C            LILTYNLEPAGSHGVWGLDDHLHLAYILGASQW-AQDRN------------VPMQPSDIL
Ecym_4012          LILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQN------------APIQLSDIL
Suva_9.35          LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ------------APLQPRDVL
Skud_9.15          LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAR------------APLQPREVL
Smik_9.16          LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ------------APLQPREIL
YIL153W            LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ------------APLQPREIL
NDAI0F00240        LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW---LNN------------APLTPKEIT
NCAS0G00200        LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW---IRN------------APMRPRDVK
Kpol_2001.77       LILTYTLEPAGSHGVWGLDDHFHFAYILGSAQW-SETNN------------PPLKPMDIV
KLTH0E00880g       LVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW-VDGKC------------APIAPREVQ
Kwal_55.19661      LITKYSLEPAGSHGVWGLDDHFHLIYIFGASQW-ADSKD------------AEASPREIQ
TDEL0B02110        LILTYTLEPAGSHGVWGLDDHFHIIYILGSSQW-SSDPA------------VPMTPRDVK
ZYRO0B16478g       LILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQW-ANYKE------------APLRPRDIL
                   *:  *.***************:*: *: *::*                         :: 

KNAG0L02170        SGVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNA
TBLA0E01690        NKNLI-EKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV
CAGL0H06655g       DPVLV-EQYSRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKD
KAFR0D02190        KKDVV-AEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYND
KLLA0A00462g       NTRLM-EQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKV
TPHA0D04650        NKKIV-TEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMV
SAKL0E15070g       DRHTV-EDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSA
AFR293C            DPKAV-ARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRV
Ecym_4012          DMKSL-YQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQV
Suva_9.35          DKSLV-REYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
Skud_9.15          DKSLV-HDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
Smik_9.16          DKSLV-REYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
YIL153W            DKSLV-REYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
NDAI0F00240        NSRLV-KDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMD
NCAS0G00200        DISLV-KQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMD
Kpol_2001.77       NKDLV-CEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMV
KLTH0E00880g       DKLIV-DEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFA
Kwal_55.19661      SKMIV-DEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFA
TDEL0B02110        NKVLV-QDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYV
ZYRO0B16478g       NHHLV-QEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAV
                   .           *:    : *:  ** * * ::*.:* ::   *  * *   ** .**  

KNAG0L02170        EVLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQ----------------ET-
TBLA0E01690        EVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGSKKT
CAGL0H06655g       EVLNKFPVIQHFWFGTGFYPWVDYKNGKPLPNYENSPDIDE----------------TND
KAFR0D02190        EVLNKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESP----------------NP-
KLLA0A00462g       EVLNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDD-------------------
TPHA0D04650        EVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQEN----------------NV-
SAKL0E15070g       EVLNKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEENP-------------------
AFR293C            EVLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSE-------------------
Ecym_4012          EVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGAC-------------------
Suva_9.35          EVLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESI----------------DQ-
Skud_9.15          EVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETI----------------EQ-
Smik_9.16          EVLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETI----------------EQ-
YIL153W            EVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESI----------------EQ-
NDAI0F00240        EVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPEDDD----------------NNN
NCAS0G00200        EVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDE----------------TE-
Kpol_2001.77       EVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTT-------------------
KLTH0E00880g       EVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQG----------------QV-
Kwal_55.19661      EVLNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDT-------------------
TDEL0B02110        EVLKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKK----------------QP-
ZYRO0B16478g       EVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYDPADADRR-------------------
                   ***:****:****** .::** .      *  :                           

KNAG0L02170        ----------------------FDSGAPPGPGTTTLPALDTSTMASVPSR----------
TBLA0E01690        LENMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPNDMLRSSQMSSE
CAGL0H06655g       LKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRSTR
KAFR0D02190        --------------------AIMTMMPSSTETMASFNLARSSKSPIMNPNYKMSMHRPPS
KLLA0A00462g       ------------------------------ADFLTANNA---------------------
TPHA0D04650        --------------FNSSDSSSIPNNAMNKDRSVNQNPSQLNRIPQNRYTAIPVNNRDLR
SAKL0E15070g       -------------------------HFSSVTSISNMPTATKSVLPATS------------
AFR293C            -----------------------------KPAAGTAHTT---------------------
Ecym_4012          ---------------------------KERAVDGDASEDSTTAVPTATGSSGKLTT----
Suva_9.35          -----------------------ANATSATPDRTSTRFPASTSMP---------------
Skud_9.15          -----------------------ANAASPGPNHTSTRFPGSLSMP---------------
Smik_9.16          -----------------------ANAGPPGPEHTSTRFPASMSMP---------------
YIL153W            -----------------------ANAGSPGREQTSTRFPTSTSMP---------------
NDAI0F00240        NNNNNNNNLVQRSSSSTSTVTSRPLPHTSTAFPQSSGRMGSTKLPSMMGSMTSPSTRQIG
NCAS0G00200        ---------------QEREIQQYAPHWHKENAHVRTAKPGITAMPSVTNT----------
Kpol_2001.77       ------------------------SIHTKSPSPSPLGISTRRDFSKFTSPALNRNPICRN
KLTH0E00880g       ------------------------LQHTTAPAPTNLNSA---------------------
Kwal_55.19661      ---------------------------QAQLPRMTQHQPSMTKL----------------
TDEL0B02110        -----------------------PSMTTMAPSNTTMYHLTTRPIPH------GKLSQVHK
ZYRO0B16478g       ------------------------NTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEARA
                                                                               

KNAG0L02170        ------------RPAMGPPAGRQVN----------------KFIQHTTASHRDRLRR---
TBLA0E01690        GPTAPLERSTNMITGMNPPSSTSIRHSILRTNRNSRNNNDRTSNNLSRFRNNANDSK---
CAGL0H06655g       STAGPG------QGRMGPPTSMGIV---------QTRMPSSTTSQAHASRLMNTPRQ---
KAFR0D02190        LSKN--------SREMKPPSTNVIN----SYLSRPHSQSSNQNRNTSGSDTNNILHRT--
KLLA0A00462g       ------------TTKMPPPLSTSTS--------------------------RFIHRR---
TPHA0D04650        ------------RPPMGPPSSHGVE-------------------NILQFKPIDRFRRRR-
SAKL0E15070g       ------------STTMPPPTILPSR-----------------NSPMGKFANRDRFKR---
AFR293C            ------------TTTMPPPRMTANC-------------------GYGPLGRLVTPRR---
Ecym_4012          ------------SAAMPPPRMTTGY------------------SHHTPSGRYTVPRR---
Suva_9.35          -------------PPMAPPSANNVN---------SLLSHQNHTHRNQTSSSRDRLRR---
Skud_9.15          -------------PPMGPPSGSSIN---------YLLSHQNSSHRNQASSSKDRLRR---
Smik_9.16          -------------PPITPLSGSNIN---------YLLSHQNHSQRNQPSSPRDRLRR---
YIL153W            -------------PPGVPPSGNNIN---------YLLSHQNQSHRNQTSFSRDRLRR---
NDAI0F00240        GMTAATTTTKMARTTMPPPTTNFLTRPMHPSNTRTTRDGTSSIRSNVNTNTINKNLKNSQ
NCAS0G00200        ------------RTNMAPPSSRMMN------------SHDPTISSLLKRSTRDQARR---
Kpol_2001.77       PNHLGIGANPLRKSNMGPPSTNSVN----------------------SIFTRNSPSI---
KLTH0E00880g       ------------RRQMNPPNLRGIN----------------------RLTSQDRFRRE--
Kwal_55.19661      ------------RHPMNPPHLRNVS----------------------RFIAHDRLKKG--
TDEL0B02110        LPT---------RGTMQPPTSLPRT------------------------FNRSAKKE---
ZYRO0B16478g       PPA---------RTRMGPPTARTTN----------------------STAHHDLTKR---
                                    *                                          

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0L02170
-----MIPGTLGTGERAQLP------------LDVEHAVFRQPQKRIFDSQTTATFQESV
ALARIRFHIEKYMRMMRGDTSG-------GISASVARMLQI-LDRLDALVDETPPLVG-P
RRYGNLACRDWHDKVDSSLPGLTSQVDCL-----------------AGGGACIEAEYYLR
NSFGSKIRLDYGTGHELSFLAFVAALDMMSQP-----RG--ITPVELSRLWDRYYRLVRR
LIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQF--ANNP------------VGVQPRDVL
SGVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNA
EVLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQ----------------ET-
----------------------FDSGAPPGPGTTTLPALDTSTMASVPSR----------
------------RPAMGPPAGRQVN----------------KFIQHTTASHRDRLRR---
>TBLA0E01690
---------------MESIP---------IYKLD-SNCVFSAPTKQIFDSQGTQYFNRSI
AFHRIQYFISKYTQLIQEENIP--PTDYTSSNDTISGVSKI-INDLIKLVEETPPLPG-P
RRYGNLSCRQWHKRVDDNINELFEKY--L----TISNTK------FNKDQLFLELIYYFN
ASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-----TD--ISGTDILFIFNEYYRLIRK
LILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDIL
NKNLI-EKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV
EVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGSKKT
LENMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPNDMLRSSQMSSE
GPTAPLERSTNMITGMNPPSSTSIRHSILRTNRNSRNNNDRTSNNLSRFRNNANDSK---
>CAGL0H06655g
--------------------------------------MFSEPVKRIYDSQGAYYFQSSE
AIRRLEGAIVKYTDLVESRDVA-----DLELSGVVGGVVKV-LDRLDQLVSETPPIPG-P
RRYGNMACRDWHEKIEREIPGLLEDL--ISSHFP------------SELQCVVELRYYLA
NSFGSATRLDFGTGHELSFLATVAALDMLGAS---------FDGDQVLYIFDRYYSLVHR
LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQW-CNRKK------------LAMEPNDLS
DPVLV-EQYSRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKD
EVLNKFPVIQHFWFGTGFYPWVDYKNGKPLPNYENSPDIDE----------------TND
LKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRSTR
STAGPG------QGRMGPPTSMGIV---------QTRMPSSTTSQAHASRLMNTPRQ---
>KAFR0D02190
------------MNLPNDQP-----------VVDPFASKFSIPAKRIFDSQTTQYFQHSV
ANYRLKYFTNKYINLVRGVPLP---VSRNITMTITRYILDL-LDKCSQFIDETPPLIE-P
RRFGNLSCRTWHDKINSYLPGELKTI--I----DNFSTI-------ENENMFNELNYYLL
NSFGSKTRLDYGTGHELSFLAFISCIDMIRML-----QD--MTADDFLLIWQSYYNLTRK
LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQL--ISDI------------SHLAPKDIL
KKDVV-AEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYND
EVLNKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESP----------------NP-
--------------------AIMTMMPSSTETMASFNLARSSKSPIMNPNYKMSMHRPPS
LSKN--------SREMKPPSTNVIN----SYLSRPHSQSSNQNRNTSGSDTNNILHRT--
>KLLA0A00462g
-------------------M-----------DFDYENAKFSMPEKRIFDSQGTLDFQNSV
AMVRIQYHLQKYITLCKGQQIP----DTIKESFFTNIVVEL-LKRLSALIDETPPERM-H
SRYGNLSYRDWQTKFQNQLENWLHEL--L----P----E-------KYNNSIIELSYYIS
NAFGSKERIDYGTGHELSFLAVIICLDMLKIE-----T---IKGPALLYCFNSYYDVIQK
LILTYKLEPAGSHGVWGLDDHFHFSYILGATQL--LDVN------------TSLIPKDIS
NTRLM-EQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKV
EVLNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDD-------------------
------------------------------ADFLTANNA---------------------
------------TTKMPPPLSTSTS--------------------------RFIHRR---
>TPHA0D04650
---------------MEDLS-----------TINIKEQSFSLPLKRIYDSQSTFTFQSSI
AIYRLKYYLHKYINMVHNVEIP--DLTYVSEITIVNEMSSL-LTELSNDIDTIPPFEG-P
RRYGNLACRNWHSLIDSKVPLLLEKV--L----GCSNHATEKGEFEKLKGCIIELNYYLC
NSLGSATRLDYGTGHELSFLAVIAAMDMLGLW-----TEN-FKGVDLLHMFHCYYELVKK
LIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQL-SENPN------------PPFSPSDII
NKKIV-TEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMV
EVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQEN----------------NV-
--------------FNSSDSSSIPNNAMNKDRSVNQNPSQLNRIPQNRYTAIPVNNRDLR
------------RPPMGPPSSHGVE-------------------NILQFKPIDRFRRRR-
>SAKL0E15070g
------------MISTITTP-----------KIDVSHTKFTEPVKKIFDTQGTQDFQSSV
TMYRLQSYLHKYITLVGTKNIP-----STSNNDAVNRFTQI-IDALSRTIDETPPLPG-P
RRFGNFACRTWHVKMRGSLDALLQAF--I----P----E-------KYHVCIVEIRYYLG
NAFGSKERLDYGTGHELSFLAVVSAIDMLDLW-----GSN-PSGEDILFLFNGYYTLVKK
LIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHN-------------PLRPSDIL
DRHTV-EDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSA
EVLNKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEENP-------------------
-------------------------HFSSVTSISNMPTATKSVLPATS------------
------------STTMPPPTILPSR-----------------NSPMGKFANRDRFKR---
>AFR293C
-------------------M-----------EFSVEGTQFSPPVKRIFDTAGTHDFQKSL
TMYRLQSHLERYLKLVQGQKIP-----KSSQNRAVVRFVCI-LERLDALMDETPPRTGSA
RRFGDLACRDWHDRMQGELDGLLETL--L----P----E-------AARRSAAELRYYLG
SAFGSRERLDYGTGHELAFLAVVVALDMLGLW-----TEDKFTGEDMLYVWARYYALVHR
LILTYNLEPAGSHGVWGLDDHLHLAYILGASQW-AQDRN------------VPMQPSDIL
DPKAV-ARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRV
EVLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSE-------------------
-----------------------------KPAAGTAHTT---------------------
------------TTTMPPPRMTANC-------------------GYGPLGRLVTPRR---
>Ecym_4012
-------------------M-----------TVELRKTKFSAPVKRIFDSHGTHDFQRSL
TMYRLQSHLERYLGLVHNQEVP-----KVSTNGSVSSFVSIFLDRFLELIDETPPTTNTP
RRFGNMACRDWHAKVQEEMDSLWRRF--L----PIERDA-------AYENCIIELRYYLG
NAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHG-LTGTDLLYLWNKYYSIVHK
LILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQN------------APIQLSDIL
DMKSL-YQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQV
EVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGAC-------------------
---------------------------KERAVDGDASEDSTTAVPTATGSSGKLTT----
------------SAAMPPPRMTTGY------------------SHHTPSGRYTVPRR---
>Suva_9.35
----------------MSLD-----------HVDWPHAAFSTPVKRIFDTQTTQDFQSSL
AIHRIKYHLHKYTTLMSHCADP-DPHATASSIPMVNGLMAV-LDRFAQLIDDTPPLPG-P
RRYGNLACREWHYKLDAHLAQWLREV--L----P----A-------QYHAVVPELQYYLG
NSFGSSTRLDYGTGHELSFMATVAALDLLGLF-----PH--LRGTDVFLLFSKYYAIMRR
LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ------------APLQPRDVL
DKSLV-REYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
EVLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESI----------------DQ-
-----------------------ANATSATPDRTSTRFPASTSMP---------------
-------------PPMAPPSANNVN---------SLLSHQNHTHRNQTSSSRDRLRR---
>Skud_9.15
-------MDKHERNGIMSLD-----------HVDWLHATFSTPVKRIFDTQTTLDFQSSL
AIHRIKYHLHKYTTLMSHCPDP-DAHAASSSIAMVNGLMGV-LDKLAQLIDETPPLPG-P
RRYGNLACREWHYKLDEHLSQWLQEM--L----P----A-------EYHVVVPELQYYLG
NSFGSSTRLDYGTGHELSFMATVAALDLLGVF-----PH--LRGNDVFLLFNKYYTIMRR
LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAR------------APLQPREVL
DKSLV-HDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
EVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETI----------------EQ-
-----------------------ANAASPGPNHTSTRFPGSLSMP---------------
-------------PPMGPPSGSSIN---------YLLSHQNSSHRNQASSSKDRLRR---
>Smik_9.16
----------------MSLD-----------HVDWPHATFSTPVKRIFDTQTTLDFQSSL
AIHRIKYHLHKYTTLMSHCADP-DPQAVASSIPMDNGLMQV-LDKLAHLIDETPPLPG-P
RRYGNLACREWHHKLDERLPQWLREM--L----P----P-------EYHVVVPELQYYLG
NSFGSSTRLDYGTGHELSFMATVTALDLLGMF-----PH--LRGTDVFLLFNKYYTIMRR
LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ------------APLQPREIL
DKSLV-REYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
EVLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETI----------------EQ-
-----------------------ANAGPPGPEHTSTRFPASMSMP---------------
-------------PPITPLSGSNIN---------YLLSHQNHSQRNQPSSPRDRLRR---
>YIL153W
----------------MSLD-----------RVDWPHATFSTPVKRIFDTQTTLDFQSSL
AIHRIKYHLHKYTTLISHCSDP-DPHATASSIAMVNGLMGV-LDKLAHLIDETPPLPG-P
RRYGNLACREWHHKLDERLPQWLQEM--L----P----S-------EYHEVVPELQYYLG
NSFGSSTRLDYGTGHELSFMATVAALDMLGMF-----PH--MRGADVFLLFNKYYTIMRR
LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ------------APLQPREIL
DKSLV-REYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV
EVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESI----------------EQ-
-----------------------ANAGSPGREQTSTRFPTSTSMP---------------
-------------PPGVPPSGNNIN---------YLLSHQNQSHRNQTSFSRDRLRR---
>NDAI0F00240
------------MSHKIHKP-------TPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSI
ALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHL-LNELSTIVQDTPPLKG-P
RRYGNLACRDWHSKIEVELPKLLEKA--I----P----S------PDLQPSIIELNYYIA
NSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-----PD--LTGKDLLIMFNAYYSLVRE
LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW---LNN------------APLTPKEIT
NSRLV-KDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMD
EVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPEDDD----------------NNN
NNNNNNNNLVQRSSSSTSTVTSRPLPHTSTAFPQSSGRMGSTKLPSMMGSMTSPSTRQIG
GMTAATTTTKMARTTMPPPTTNFLTRPMHPSNTRTTRDGTSSIRSNVNTNTINKNLKNSQ
>NCAS0G00200
MDKLLLCCDNNDRGRTIKQSAMTTINDTHMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSI
ALNRLRFFLQKYISMVTNVQTP--PEGTLSSVTLVNSIVQL-LNHLSTLIDETPPLVG-P
RRYGNLACRDWHTKMEAQLPALLNEI--LDPYLPKVSGE-----SSSMHPCIQELNYYIS
NAFGSSTRLDFGTGHELSFMAFIAAIDMLGLW-----TDG-MQGTDILLLFNTYYALVRK
LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW---IRN------------APMRPRDVK
DISLV-KQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMD
EVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDE----------------TE-
---------------QEREIQQYAPHWHKENAHVRTAKPGITAMPSVTNT----------
------------RTNMAPPSSRMMN------------SHDPTISSLLKRSTRDQARR---
>Kpol_2001.77
--------------MKMKQP-----------LLNKEPIEFCLPVKRIYDSQGTSLFQSSV
AIFRLKYFISKYIKLVPNVDIP--DESYVSEIPTVNKLVKL-ISELSLLVDETPPAPG-P
RRFGNLSCREWHKKVDLNLKSLLMKM--L----T----DDKQNISSKCKDSVVELSYYLG
NSFGSSTRLDYGTGHELSFIAVIAGIDMLGLW-----TEN-IKGGDLLIIFNEYYKLMKK
LILTYTLEPAGSHGVWGLDDHFHFAYILGSAQW-SETNN------------PPLKPMDIV
NKDLV-CEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMV
EVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTT-------------------
------------------------SIHTKSPSPSPLGISTRRDFSKFTSPALNRNPICRN
PNHLGIGANPLRKSNMGPPSTNSVN----------------------SIFTRNSPSI---
>KLTH0E00880g
----------------MSLE-----------RIDASSATFTEPTKRIFDSRGSHVFQSSV
AMGRLKSYLHKYVSSMSGVKIP-----ETSTNHEVRSFAEL-LKTLSELVDSTPALPG-P
RRYGNLACRTWHDKVDESLEALLHKF--L----P----E-------PCHKSIVELQYYLG
NAFGSRERLDYGTGHELSFFAEICALDMLGVW-----GAD-FQASDVLFLFDKYYALVRK
LVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW-VDGKC------------APIAPREVQ
DKLIV-DEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFA
EVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQG----------------QV-
------------------------LQHTTAPAPTNLNSA---------------------
------------RRQMNPPNLRGIN----------------------RLTSQDRFRRE--
>Kwal_55.19661
----------------MEQD-----------QIDVGTTTFTEPVKRIFDSRGTHVFQSSV
AMIRLKKHLHKYLGMLSGQRIP-----SETSNPNVISLRKI-LHFFSKLVDETPALPG-P
RRYGNLACRDWHDKMEEQIREQLQEF--L----P----E-------KYYPSIVELAYYLG
NAFGSRERLDYGTGHELSFFSVICALDMLGIW-----GSG-FQAKDLLYLFNEYYSLVRK
LITKYSLEPAGSHGVWGLDDHFHLIYIFGASQW-ADSKD------------AEASPREIQ
SKMIV-DEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFA
EVLNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDT-------------------
---------------------------QAQLPRMTQHQPSMTKL----------------
------------RHPMNPPHLRNVS----------------------RFIAHDRLKKG--
>TDEL0B02110
---------------MISEP-----------RIDISQTKFESPVKCIFDSQGASDFQQSV
AIDRLKYHLEKYARMIHGQPIV----HEPSGIEVVNRVVSL-LSRLSELVDETPPFSG-P
RRYGNLACRDWHDKLDANLTELLQQV--L----P----Q-------DYHKCIPELSYYLG
NSFGSSTRLDYGTGHELSFLAVLGALDMLGLW-----TSE-FSGKDVLLLFDTYYKLVRK
LILTYTLEPAGSHGVWGLDDHFHIIYILGSSQW-SSDPA------------VPMTPRDVK
NKVLV-QDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYV
EVLKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKK----------------QP-
-----------------------PSMTTMAPSNTTMYHLTTRPIPH------GKLSQVHK
LPT---------RGTMQPPTSLPRT------------------------FNRSAKKE---
>ZYRO0B16478g
------------------MR-----------MLTNENTQFNTPVKRIFDSQCTLEFQASV
AIVRLKYFIQKYAKIINRVNIP----QGPSRISVVNEFVGV-LNHMSLLVDQTPPLEG-P
RRYGNLACRDWHAKIDEQMPSLWRKV--L----P----D-------RFHHCIVELVHYLG
NSFGSATRLDYGTGHELSFLAVVGAIDMLGLF-----TDE-FQGEDFLLIMNAYYAVVRK
LILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQW-ANYKE------------APLRPRDIL
NHHLV-QEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAV
EVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYDPADADRR-------------------
------------------------NTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEARA
PPA---------RTRMGPPTARTTN----------------------STAHHDLTKR---