MUSCLE (3.8) multiple sequence alignment

KLTH0E00858g       MEGGE-------------------PKRSILLPSKAETAGRDNI-----------------
Kwal_55.19655      MDLGE-------------------PKRSILLPSKAETNGGDNI-----------------
SAKL0E15092g       MDHKE-------------------PGRSILLTNGANP--SIHVSEYGENNAQAGRTPASS
TBLA0E01740        MS----------------------QHRGILLTTPEGT--GTA------------------
ZYRO0B16500g       MS----------------------NQKSILLTVPDGT--RTVLLDEPHRRHSLAE-PGG-
TPHA0E00160        MS----------------------NRKSILLTGPEGG--TVDILNENETHSKDAANTKNS
KNAG0L02180        MEQVQG------------------NHASILLTKADGSVVDSPHIEQELGRGAGEGEGLGE
Kpol_1043.76       MV----------------------NQRSILLHSSDGA--QTQIYKSPDVEENNEINNSG-
TDEL0B02100        MNKP--------------------GYRGILLTGTDGS--QSPL-------NVNDNEPAGG
KAFR0D02180        MVDNP-------------------NNKSILLTTPDGT--QAPL-HAVESRTTKDSSPSPK
CAGL0H06677g       ------------------------MQKGILV--PSGS--ERG--------------PTE-
NCAS0G00190        MSTNHSNSNSKHGK----------GHKSILLTTPEGK--EAPLHHSESNPLPTEDKLLPP
NDAI0F00230        MNTNNNASRDADNDNNKSLGGPGINKRSILLTTPEGS--ETKLMKDAKNDDTIIDSPTTS
Suva_9.34          ------------------------MHKSILLTTPDGA--QTNL------HQTKPETPTT-
Skud_9.14          ------------------------MQKSILLTKPDGT--QSNL------HRTKTETPTT-
Smik_9.15          ------------------------MQKSILLTKPDGT--QSNL------HSAKTETPTT-
YIL154C            ------------------------MQKSILLTKPDGT--QSNL------HSIKTETPTT-
KLLA0A00440g       MEE---------------------PGRGILNKKLTD---DKHLAAPPAFPT---------
AFR294W            MDE---------------------PSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRR
Ecym_4011          MDE---------------------PGRGILNRNGSSNMFVMPPPQQQQQHQRQNQSAAAA
                                              .**                              

KLTH0E00858g       ------------------------------------------------------RILESE
Kwal_55.19655      ------------------------------------------------------RILESE
SAKL0E15092g       NTRNN-------------------------------------------------IQIVES
TBLA0E01740        ------------------------------------------------------VQFDSE
ZYRO0B16500g       ------------------------------------------------------VQFDSE
TPHA0E00160        PIMELSNSAGDYFSAGANNESSG-------------------------------VKFDSE
KNAG0L02180        GTEKTTRPEVAPHTPAATGVATSTGAGAGAGAGA--------------------VQFDSE
Kpol_1043.76       ------------------------------------------------------VQFDSA
TDEL0B02100        ------------------------------------------------------VQFDSE
KAFR0D02180        DESILHKNATE-------------------------------------------VQFN--
CAGL0H06677g       ------------------------------------------------------IQFDSE
NCAS0G00190        QKLEDADNMLTPSKSTDLSPRTSAPSTG--------------------------VQFDAE
NDAI0F00230        TSDLQPPPSINISHIDSTADQMANLSPKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAE
Suva_9.34          ------------------------------------------------------VEFDSE
Skud_9.14          ------------------------------------------------------VEFDSE
Smik_9.15          ------------------------------------------------------VEFDSE
YIL154C            ------------------------------------------------------VEFDSE
KLLA0A00440g       ------------------------------------------------------IKIE-E
AFR294W            TSSPIGVT----------------------------------------------IKIEEP
Ecym_4011          AGPSSEPGSANGAKASNGIIQTDGKGNSSSMTSPMGVT----------------IKIEEP
                                                                           :   

KLTH0E00858g       VPSRSERGRSREKK---GSS------------------------ANTAVQ---HRSRTSS
Kwal_55.19655      VPGRGERGRSREKR---GSS------------------------SNNTAQ---NRSRTTS
SAKL0E15092g       PLPRG-RGRSREKR---SSVGG----------------------GTSNTRSLSTRSISGS
TBLA0E01740        QIEND-RGRSKKRF---KDKTNTSRSATG---------------GSSISR---SRSRASS
ZYRO0B16500g       QLERG-RSRVKAAR---GIK------------------------SNSGSR---SRSRNPS
TPHA0E00160        QIEND-RGRTRSRN---NREDSSGTGNSFSYSSN----------NNSKSR---SRSRASS
KNAG0L02180        QIERG-RSRMKRRD---AKRAEARSNSGSRSRSGSRSRSRSRSFSRSRSR---TSSRASS
Kpol_1043.76       QIEND-RGRSKRRN---GEFRNGS--------------------GASLSR---SRSRANS
TDEL0B02100        QLERG-RSRTKIRN---NGSSQL---------------------SASSSR---SRSRASS
KAFR0D02180        -IDRG-RSRLKKQR---SNASTSQSFSR----------------SRSRSK---SFSRNSS
CAGL0H06677g       -IGRG-RSRDKRTG---GNGAG----------------------RLSLSR---SRSRASS
NCAS0G00190        QIERG-RSRIKKSN---AISAGAATMGTSQTGGNIGSLSG----SKSRSR---SRSRASS
NDAI0F00230        EIERG-RSRIKNSTTHANVNTNANPNNNTNNNMERSNRRIGGSLSTSRSR---SRSRASS
Suva_9.34          QLERGHRERGRSK-----------------------------------------------
Skud_9.14          QMERGHRERGRSKK---KRDERDSYAS-----------------SLSRSRSRASRASSRS
Smik_9.15          QMERGQRERGRSKK---KRGDQDSSVS-----------------SLSRSR---SRASSRS
YIL154C            QMERGHRERGRSKK---KRGERDSNVS-----------------SLSRSR---SRASSRS
KLLA0A00440g       PEQRG-RSRSKTRD---TGI------------------------SSSRSI---SRSASRV
AFR294W            PEQRG-RTRNKQSG---AAFSS----------------------SRSRTK---SRSRSRV
Ecym_4011          PEQRG-RSRNKQSD---ATSSFST--------------------SRSRTK---LRSLSRV
                      .. * * .                                                 

KLTH0E00858g       RLRGDVGSYLKWTVLQHDPSERLLL-----------------------------------
Kwal_55.19655      RIRGDMGSYLKWTVLHHDPSERLQL-----------------------------------
SAKL0E15092g       RIEDE--SYLKWTVLRRDPSERLHK-----------------------------------
TBLA0E01740        RVRDE--EFLKWTVLRKDPSMRLILINGSDDKKNGSKDRGRSKNRENGDD----------
ZYRO0B16500g       HVRNG--EFLKWTVLKRDPSMRLH------------------------------------
TPHA0E00160        MVRDE--EFLKWTVLRKDPSMRLKFR----------------------------------
KNAG0L02180        RIREE--EFLKWTVLRQDPSMRLHHYRVDYKNGKGRGEDDDDEEEEEEEE----------
Kpol_1043.76       RVRDE--EFLKWTVLRRDPSMRLRTIRKKNQQGLN-------------------------
TDEL0B02100        RIRDE--EFLKWTVLRRDPSMRLQL-----------------------------------
KAFR0D02180        KVREE--EFLKWTVLRQDPSMRLFNANEKLKKKEGTYDSDEI------------------
CAGL0H06677g       RVREE--EFLKWTVLRRDPSMRLTTLKK--------------------------------
NCAS0G00190        RIREE--EFLKWTVLRQDPSMRLQNVNENIDRYNRRKKRREERRLLKKTK----------
NDAI0F00230        RIREE--EFLKWTVLRQDPSMRLQNLNENIAKYNKKKKKNELKEQKNLKKKRSETDDEQT
Suva_9.34          --KEE--QFLKWTVLRQDPSMRLRVV----------------------------------
Skud_9.14          RVREE--EFLKWTVLRQDPSMRLKV-----------------------------------
Smik_9.15          RVREE--EFLKWTVLRQDPSMRLRVV----------------------------------
YIL154C            RVREE--EFLKWTVLRQDPSMRLRVV----------------------------------
KLLA0A00440g       SIKDQ--AYLKWTILNKDPSERLHLKAKKGNTRDS-------------------------
AFR294W            SVTDQ--EFLRWTILRADPSERLHL-----------------------------------
Ecym_4011          SIAEH--ELLRWTILRHDPSERLHRDSHAGTA----------------------------
                            *.**:*. *** **                                     

KLTH0E00858g       ---------------GTKEGAEASDD--------------DEDVSDEEQVSDVENEIDID
Kwal_55.19655      ---------------SAQDGKDSSDD--------------EEDVSDEEQVSDVDNEINID
SAKL0E15092g       ---------NEENDRDESAIDDDDYD--------------EDDVSDEEQISDIENDQEID
TBLA0E01740        NDPLSANNNDDDDNNDKEDELDADNESNLNLQQIKDALSLENEISDEEQVSDIENEAELD
ZYRO0B16500g       KKPHGNGIGNNADDEEEEEEDEDQED--------------EDLVSDEEQVSDVENDLEID
TPHA0E00160        RANDGAHRDHSNEDLEDDDDEYFDED--------------DDEISDEEQVSDLENELEID
KNAG0L02180        EEDDEDDEDDDEDDEDDDGDDDEDSE--------------SDEESDEEQVSDVENDAEID
Kpol_1043.76       KKKHGAEEDDDEEEDEEEEEEEEDDD--------------DDEISDEEQVSDIENENDID
TDEL0B02100        ---NQKDDKKSRDEQSDDEDSEELDL--------------EDDVSDEEQVTDVDNDFDID
KAFR0D02180        YSSESVEDEDKGDDEDEDEDEESEDF--------------EEEESDEEQVSDIDNEVEID
CAGL0H06677g       NKKSGSGTGGDDDDDDDEDDDDEDDD--------------DEEESDEERVSDIENDAEID
NCAS0G00190        KEGELEDSDEDDEDDEEEEEEDSDEE--------------EEEESDEEQVSDIENDVEID
NDAI0F00230        EEEEEEEEDVTDTDSDEDDEDDDEDE--------------SDEESDEEQVSDIENDVEID
Suva_9.34          DQDSEEDEDNDNNNNNDDDGPNDDDV--------------DDEESDEEQVSDVDNDLEID
Skud_9.14          ADADSDEEEEGEGGDDDDDDEDGDDM--------------DEEESDEEQVSDVENDAEID
Smik_9.15          -----DVDSEEEGEGNDDDGDDGDDV--------------DEEESDEEQVSDVENDLEID
YIL154C            ---DVDSEEEGEGNDEDDDDGDGDDM--------------DEEESDEEQVSDIENDLEID
KLLA0A00440g       VSPGQENGGDEDEDEDEEEFIEDRED--------------DGEVSEEEQVSDVENEIEID
AFR294W            ------------------GAVEDEED--------------DDELSDEEQLSDVENDYDVD
Ecym_4011          ARFGDISPQTTTVVPAGAAAGIAEDI--------------EDVLSDEEQISDVENDYEVD
                                                           .   *:**.::*::*: ::*

KLTH0E00858g       AALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEG----KDSGVKLEDLQGGYARA
Kwal_55.19655      AALGYDLGARVLPNFTNSLWDVLQTEKPWIAKYNETVDE----NNTDVKLDELQGGYARA
SAKL0E15092g       SELDYDLGARVLPNFSTSISNVLESNKPWTKKYLQTVDQKA--ERAKIKLDSLPGGYMRA
TBLA0E01740        EEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYESQVK-GK--ENEGINLIKLDNGYARA
ZYRO0B16500g       EQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQE------TTQDVSFTKLPGGYSRC
TPHA0E00160        D-FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKIDPNANVLINELEGGFVKA
KNAG0L02180        EKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDADH--GE--SQEKIDVRDVEGGYVRA
Kpol_1043.76       EDITFDLGTKVLPNYCMSINDIMESSKKWISDYLSRPE-NL--RNDNVHIEKMEGGFVKA
TDEL0B02100        EEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANT------QEPEIPLATLAGGYKRA
KAFR0D02180        EKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYEKEIESVL--PDETTKLDEIEDGYIRA
CAGL0H06677g       EEFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLSTLDMEK--ERAGVNFETLEGGYSRA
NCAS0G00190        EAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GK--ENDNVEIGRLDGGYLRA
NDAI0F00230        EAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GK--ENEGVNFTTLDGGYIRA
Suva_9.34          EEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYEMGH------ENDGVSLERLAGGYVRA
Skud_9.14          EEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIR-GH--ENEGVSLEQLDGGYVRA
Smik_9.15          EEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIR-GH--EDEGVSLEQLDGGYVRA
YIL154C            EEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIR-GH--ENEDVSLEQLDGGYVRA
KLLA0A00440g       EHIDYDLGCKVLPNFVTPITQVLDSMKPWLAK-NAEIKTEA--DKRDIKLEEIQHGIHRA
AFR294W            AELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQ------PAGAARVDVLQDTCTRA
Ecym_4011          AALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQ--EKKKVQVDVLEN-CKRA
                     : :: * . ***:   :   :     *                    .  :     ..

KLTH0E00858g       IKIVHGK--------PQQGA--------------------------EAR---------EG
Kwal_55.19655      IQVMHS----------AKSQ--------------------------KTELK-------PG
SAKL0E15092g       MSLVTR----------GKGG--------------------------SST---------HG
TBLA0E01740        IEGYSK----------GKGC--------------------------SA----------DG
ZYRO0B16500g       CQLLSR----------GKGA--------------------------T-----------TR
TPHA0E00160        MELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIASSNTNNTTSSSGSSDSG
KNAG0L02180        VELLTR----------GKGA--------------------------SP----------QA
Kpol_1043.76       MELISK----------KEDS--------------------------STSISSSGK---EG
TDEL0B02100        MLPLSK----------GKGS--------------------------T-----------TD
KAFR0D02180        IDLVTK----------GEGS--------------------------SKNG--------DG
CAGL0H06677g       LELVRK----------GKGA--------------------------EAHPE-------TS
NCAS0G00190        MQLLTK----------GKGA--------------------------YLNTESTATPTPAG
NDAI0F00230        MQLLTK----------GKGA--------------------------SMDFDPMKP---AG
Suva_9.34          MQLLTK----------GAGA--------------------------EPG---------AQ
Skud_9.14          MQLLTK----------GAGA--------------------------EPG---------NQ
Smik_9.15          MQLLTK----------GAGA--------------------------EPG---------NQ
YIL154C            MQLLTK----------GAGA--------------------------EAG---------NQ
KLLA0A00440g       VYHMSK----------GDNI--------------------------TAATSE------KG
AFR294W            VRHFAR----------HSGA--------------------------PGP---------AG
Ecym_4011          IQHIAK----------RALS--------------------------PAP---------AG
                                                                               

KLTH0E00858g       ----------------------RSYIIYLD----LTPESFYALLYVFGAVLASNDTLYVV
Kwal_55.19655      ----------------------ASYIVYLD----LTPESFYALLYVFGAVLSPNDTLYVV
SAKL0E15092g       ----------------------SSYILYAD----LSSESMYALTYTLGAVVNSGDTLYVV
TBLA0E01740        ----------------------KSYLLYSD----LSSESTYALAYLIGSIIKNGDMIYLV
ZYRO0B16500g       ----------------------RSFVLCTD----LTTESHYALAYVIGALLNNGDTLYIV
TPHA0E00160        ----------------------DSFILYTD----LSSESTYALTYVMGTLVKNNDTLYIV
KNAG0L02180        ----------------------DTYIVYSD----LSSESNYALLYVLGTLVGNGDTVYVV
Kpol_1043.76       ----------------------DSYILYTD----LTSESTYALAYVLGALVNNGDTLYVV
TDEL0B02100        ----------------------RSYILCSD----LTSESQYALTYVMGALVSNGDTLYVV
KAFR0D02180        ----------------------QSYILFMD----LSSESIYALTYVMGCVINNGDTLYIV
CAGL0H06677g       ----------------------KNYILCTD----LSSESTYALTYVMGSLVSNGDTLYIV
NCAS0G00190        ----------------------RCYILYTD----LSSESTYALTYTMGAVINNGDTLYVV
NDAI0F00230        ----------------------RCYILYTD----LSSESTYALTYMMGAVLNNGDTLYIV
Suva_9.34          ----------------------RCFILYTD----LSSESTYALTYLMGAVLNQGDTLYIV
Skud_9.14          ----------------------RSFILYTD----LSSESTYALTYLMGAVVNQGDTLYIL
Smik_9.15          ----------------------RSFILYTD----LSSESTYALTYLMGAVVNQGDTLYIV
YIL154C            ----------------------RSFILYTD----LSSESTYALTYLMGAAVNQGDTVYIV
KLLA0A00440g       ----------------------HSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYII
AFR294W            ----------------------KTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIF
Ecym_4011          AAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLANRDTLYIV
                                           ::   :      .*. *** * :*  .   * :*:.

KLTH0E00858g       HISQR-----VPNE---QLRANVERLEAEAAYLLDASSAA--LNAVNVVLLSVSHPYPKH
Kwal_55.19655      HISPR-----VPSD---QLRSNVARLRAQTAYLLDASSAA--LDSVSVVILSVSHPYPKH
SAKL0E15092g       HVESS-----TTET---RLLQNIDKLTQQTAFLLDCTSGV--VNDLSVVLLSLSHPYPKH
TBLA0E01740        HWEGNNKK--IPEK---QLSDNVFRMRRHVLHLLDAASTI--IDDAEIMMVSLTHPYPKH
ZYRO0B16500g       HWDGKQPG--SSKE---TLEQSVKSLRQHVLHKLDCASAS--LQDLDVVLLSLSHPYPKH
TPHA0E00160        HWEGSTTS--NNDAMKKKMTSNLQKIRENVMYLNDCNNSI--IDRLDVVVISMTHPYPKH
KNAG0L02180        HWHSDRGGGAVTHS---EVRSNVRNLRRKALHLFDCLSAT--VDDLDIVLLSTTHPYPKH
Kpol_1043.76       HWEGNNTHG-VTDT---RIYDNIFRIRKHVMHLLDCSSAV--IDRIDILLISLTHPYPKH
TDEL0B02100        HWDNQSSS--DADA---KLQKNILTIRENVEHMFDSIGAV--IEDFDVVVLSLQHPFPKQ
KAFR0D02180        NWESTLKH--IDET---IIYNNLKRVKKMTLHLFDCISGV--IDNLDVIIVSLTHPYPKH
CAGL0H06677g       HWDGDSTT--STKD---SFIDNALRVKKHVRHLMDCVSVI--VDDLDVVIISLTHPYPKH
NCAS0G00190        HSENSNI---FDEP---LMLKNVGRIRKHVMHMFDCISAV--VDDVDVVALSLTHPYPKH
NDAI0F00230        HWESSKV---ANEK---LMQENVGRVRKHVMHMFDCVSAV--IDDLDVIILSLTHPYPKH
Suva_9.34          HWEPSTP---VDDA---QMLANVARIRKHVMHLFDCVAGV--LDDLDVVVLSLTHPYPKH
Skud_9.14          HWEPSKP---TDDS---QMFANVARIRKHVMHLFDCAAGV--LDDLDVVVLSLTHPYPKH
Smik_9.15          HWEPSKP---TDDA---QMFANVARIRKHVMHLFDCVAGV--LDDLDVVVLSLTHPYPKH
YIL154C            HWEPSKP---TDDS---QMFANVARIRKHVMHLFDCVAGV--LDDLDVVVLSLTHPYPKH
KLLA0A00440g       NQCDDDTN---------DMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQ
AFR294W            VLCDAV-----------DVESHLNRVAEQVAFLLDCSAAA--LDDLDVVVLALQHAYPRH
Ecym_4011          VQCDAA-----------DVEAHLVKVREQVAFLLDATSAA--LDHLDIIILTLHHPYPRH
                                     .      :     .  :.      ::  .::  :  *.:*.:

KLTH0E00858g       LLNELVIALKPMALCVPLSLVLSS--LQNYVCPIPTVVIRRKLKRSKKKGFEE
Kwal_55.19655      LLNEMVLALKPMALCVPLSLVLSV--LQNYVCPIPTVVIRRKLKRSKKKGFHE
SAKL0E15092g       LVNQMIHGLKPLLLVVSLSLVLTS--LQNYVCNIPTLVVRKKLKRSKRRGIYE
TBLA0E01740        FLNELIHGLDISMLCCSLTMILSG--LQNFVSSIPMLIVRKKLKKR----IVQ
ZYRO0B16500g       LLSEMIYALQPIALCCSLSLVLTT--LQNFVCSVPTLVIRKKLKRSKRKGISD
TPHA0E00160        FLNEMIYGLKPKSLICSLNIMLSPSGLQNYVCSIPVLVIRKKLKRTRRRGIDE
KNAG0L02180        LLNEMINALHPVALCCSLSIVLSL--LQNFVCSVPTFVIRKKLKRAKRKGISD
Kpol_1043.76       LLNEMIHGLKPKTLCCSLSVVLSPSGLQNYVSSIPMLVIRKKLKRPRKKGINE
TDEL0B02100        LLTEMIHGLQPVALCCSLSMILST--LQNYVCSVPTLVIRKKLKRAKKKGISE
KAFR0D02180        LLSEMIYGLKPMALCCSLSIMLST--LQNFVCSVPTLVVRRKLKRSKRRGLTD
CAGL0H06677g       LLNEMIHGLKPVTLACSLSLILSS--LQNFVCSVPTLVIRKKLKRSRKKGISE
NCAS0G00190        LLNEMIHGLKPVALCVPLSIMLSS--LQNFVCSVPTLVIRKKLKRAKRKGITD
NDAI0F00230        LLNEMIHGLKPVSIACSLTIILST--LQNFVCSVPTLVIRKKLKRS-------
Suva_9.34          LLNEMIHGLKPVALCCSLSVILGT--LQNFVCSVPTLAVRKKLKRAKRKGICE
Skud_9.14          LLNEMIHGLKPVALCCSLSVILST--LQNFVCSVPILAVRKKLKRAKRKGISE
Smik_9.15          LLNEMIHGLKPVALCCSLSVILST--LQNFVCSVPILAVRKKLKRAKRKGICE
YIL154C            LLNEMIHGLKPVALCCSLSVILST--LQNFVCSVPILAVRKKLKRAKRKGISE
KLLA0A00440g       LLTEMAHSLQPSSIIIPLQTVLAS--LQNFITSVPMLVIRKKLKRSKRRGIAD
AFR294W            LLTETIHAFRPAGLIVPLQIATRS--LAGYVSSVPTLIVRKKLKRARRRGIFD
Ecym_4011          LLTEISEAFQPSALIIPLQIATGS--LAGYVSFVPTLVVRKKLKRSRRKGIYD
                   ::.:   .:    :  .*        * .::  :* . :*.***.        

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0E00858g
MEGGE-------------------PKRSILLPSKAETAGRDNI-----------------
------------------------------------------------------RILESE
VPSRSERGRSREKK---GSS------------------------ANTAVQ---HRSRTSS
RLRGDVGSYLKWTVLQHDPSERLLL-----------------------------------
---------------GTKEGAEASDD--------------DEDVSDEEQVSDVENEIDID
AALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEG----KDSGVKLEDLQGGYARA
IKIVHGK--------PQQGA--------------------------EAR---------EG
----------------------RSYIIYLD----LTPESFYALLYVFGAVLASNDTLYVV
HISQR-----VPNE---QLRANVERLEAEAAYLLDASSAA--LNAVNVVLLSVSHPYPKH
LLNELVIALKPMALCVPLSLVLSS--LQNYVCPIPTVVIRRKLKRSKKKGFEE
>Kwal_55.19655
MDLGE-------------------PKRSILLPSKAETNGGDNI-----------------
------------------------------------------------------RILESE
VPGRGERGRSREKR---GSS------------------------SNNTAQ---NRSRTTS
RIRGDMGSYLKWTVLHHDPSERLQL-----------------------------------
---------------SAQDGKDSSDD--------------EEDVSDEEQVSDVDNEINID
AALGYDLGARVLPNFTNSLWDVLQTEKPWIAKYNETVDE----NNTDVKLDELQGGYARA
IQVMHS----------AKSQ--------------------------KTELK-------PG
----------------------ASYIVYLD----LTPESFYALLYVFGAVLSPNDTLYVV
HISPR-----VPSD---QLRSNVARLRAQTAYLLDASSAA--LDSVSVVILSVSHPYPKH
LLNEMVLALKPMALCVPLSLVLSV--LQNYVCPIPTVVIRRKLKRSKKKGFHE
>SAKL0E15092g
MDHKE-------------------PGRSILLTNGANP--SIHVSEYGENNAQAGRTPASS
NTRNN-------------------------------------------------IQIVES
PLPRG-RGRSREKR---SSVGG----------------------GTSNTRSLSTRSISGS
RIEDE--SYLKWTVLRRDPSERLHK-----------------------------------
---------NEENDRDESAIDDDDYD--------------EDDVSDEEQISDIENDQEID
SELDYDLGARVLPNFSTSISNVLESNKPWTKKYLQTVDQKA--ERAKIKLDSLPGGYMRA
MSLVTR----------GKGG--------------------------SST---------HG
----------------------SSYILYAD----LSSESMYALTYTLGAVVNSGDTLYVV
HVESS-----TTET---RLLQNIDKLTQQTAFLLDCTSGV--VNDLSVVLLSLSHPYPKH
LVNQMIHGLKPLLLVVSLSLVLTS--LQNYVCNIPTLVVRKKLKRSKRRGIYE
>TBLA0E01740
MS----------------------QHRGILLTTPEGT--GTA------------------
------------------------------------------------------VQFDSE
QIEND-RGRSKKRF---KDKTNTSRSATG---------------GSSISR---SRSRASS
RVRDE--EFLKWTVLRKDPSMRLILINGSDDKKNGSKDRGRSKNRENGDD----------
NDPLSANNNDDDDNNDKEDELDADNESNLNLQQIKDALSLENEISDEEQVSDIENEAELD
EEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYESQVK-GK--ENEGINLIKLDNGYARA
IEGYSK----------GKGC--------------------------SA----------DG
----------------------KSYLLYSD----LSSESTYALAYLIGSIIKNGDMIYLV
HWEGNNKK--IPEK---QLSDNVFRMRRHVLHLLDAASTI--IDDAEIMMVSLTHPYPKH
FLNELIHGLDISMLCCSLTMILSG--LQNFVSSIPMLIVRKKLKKR----IVQ
>ZYRO0B16500g
MS----------------------NQKSILLTVPDGT--RTVLLDEPHRRHSLAE-PGG-
------------------------------------------------------VQFDSE
QLERG-RSRVKAAR---GIK------------------------SNSGSR---SRSRNPS
HVRNG--EFLKWTVLKRDPSMRLH------------------------------------
KKPHGNGIGNNADDEEEEEEDEDQED--------------EDLVSDEEQVSDVENDLEID
EQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQE------TTQDVSFTKLPGGYSRC
CQLLSR----------GKGA--------------------------T-----------TR
----------------------RSFVLCTD----LTTESHYALAYVIGALLNNGDTLYIV
HWDGKQPG--SSKE---TLEQSVKSLRQHVLHKLDCASAS--LQDLDVVLLSLSHPYPKH
LLSEMIYALQPIALCCSLSLVLTT--LQNFVCSVPTLVIRKKLKRSKRKGISD
>TPHA0E00160
MS----------------------NRKSILLTGPEGG--TVDILNENETHSKDAANTKNS
PIMELSNSAGDYFSAGANNESSG-------------------------------VKFDSE
QIEND-RGRTRSRN---NREDSSGTGNSFSYSSN----------NNSKSR---SRSRASS
MVRDE--EFLKWTVLRKDPSMRLKFR----------------------------------
RANDGAHRDHSNEDLEDDDDEYFDED--------------DDEISDEEQVSDLENELEID
D-FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKIDPNANVLINELEGGFVKA
MELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIASSNTNNTTSSSGSSDSG
----------------------DSFILYTD----LSSESTYALTYVMGTLVKNNDTLYIV
HWEGSTTS--NNDAMKKKMTSNLQKIRENVMYLNDCNNSI--IDRLDVVVISMTHPYPKH
FLNEMIYGLKPKSLICSLNIMLSPSGLQNYVCSIPVLVIRKKLKRTRRRGIDE
>KNAG0L02180
MEQVQG------------------NHASILLTKADGSVVDSPHIEQELGRGAGEGEGLGE
GTEKTTRPEVAPHTPAATGVATSTGAGAGAGAGA--------------------VQFDSE
QIERG-RSRMKRRD---AKRAEARSNSGSRSRSGSRSRSRSRSFSRSRSR---TSSRASS
RIREE--EFLKWTVLRQDPSMRLHHYRVDYKNGKGRGEDDDDEEEEEEEE----------
EEDDEDDEDDDEDDEDDDGDDDEDSE--------------SDEESDEEQVSDVENDAEID
EKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDADH--GE--SQEKIDVRDVEGGYVRA
VELLTR----------GKGA--------------------------SP----------QA
----------------------DTYIVYSD----LSSESNYALLYVLGTLVGNGDTVYVV
HWHSDRGGGAVTHS---EVRSNVRNLRRKALHLFDCLSAT--VDDLDIVLLSTTHPYPKH
LLNEMINALHPVALCCSLSIVLSL--LQNFVCSVPTFVIRKKLKRAKRKGISD
>Kpol_1043.76
MV----------------------NQRSILLHSSDGA--QTQIYKSPDVEENNEINNSG-
------------------------------------------------------VQFDSA
QIEND-RGRSKRRN---GEFRNGS--------------------GASLSR---SRSRANS
RVRDE--EFLKWTVLRRDPSMRLRTIRKKNQQGLN-------------------------
KKKHGAEEDDDEEEDEEEEEEEEDDD--------------DDEISDEEQVSDIENENDID
EDITFDLGTKVLPNYCMSINDIMESSKKWISDYLSRPE-NL--RNDNVHIEKMEGGFVKA
MELISK----------KEDS--------------------------STSISSSGK---EG
----------------------DSYILYTD----LTSESTYALAYVLGALVNNGDTLYVV
HWEGNNTHG-VTDT---RIYDNIFRIRKHVMHLLDCSSAV--IDRIDILLISLTHPYPKH
LLNEMIHGLKPKTLCCSLSVVLSPSGLQNYVSSIPMLVIRKKLKRPRKKGINE
>TDEL0B02100
MNKP--------------------GYRGILLTGTDGS--QSPL-------NVNDNEPAGG
------------------------------------------------------VQFDSE
QLERG-RSRTKIRN---NGSSQL---------------------SASSSR---SRSRASS
RIRDE--EFLKWTVLRRDPSMRLQL-----------------------------------
---NQKDDKKSRDEQSDDEDSEELDL--------------EDDVSDEEQVTDVDNDFDID
EEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANT------QEPEIPLATLAGGYKRA
MLPLSK----------GKGS--------------------------T-----------TD
----------------------RSYILCSD----LTSESQYALTYVMGALVSNGDTLYVV
HWDNQSSS--DADA---KLQKNILTIRENVEHMFDSIGAV--IEDFDVVVLSLQHPFPKQ
LLTEMIHGLQPVALCCSLSMILST--LQNYVCSVPTLVIRKKLKRAKKKGISE
>KAFR0D02180
MVDNP-------------------NNKSILLTTPDGT--QAPL-HAVESRTTKDSSPSPK
DESILHKNATE-------------------------------------------VQFN--
-IDRG-RSRLKKQR---SNASTSQSFSR----------------SRSRSK---SFSRNSS
KVREE--EFLKWTVLRQDPSMRLFNANEKLKKKEGTYDSDEI------------------
YSSESVEDEDKGDDEDEDEDEESEDF--------------EEEESDEEQVSDIDNEVEID
EKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYEKEIESVL--PDETTKLDEIEDGYIRA
IDLVTK----------GEGS--------------------------SKNG--------DG
----------------------QSYILFMD----LSSESIYALTYVMGCVINNGDTLYIV
NWESTLKH--IDET---IIYNNLKRVKKMTLHLFDCISGV--IDNLDVIIVSLTHPYPKH
LLSEMIYGLKPMALCCSLSIMLST--LQNFVCSVPTLVVRRKLKRSKRRGLTD
>CAGL0H06677g
------------------------MQKGILV--PSGS--ERG--------------PTE-
------------------------------------------------------IQFDSE
-IGRG-RSRDKRTG---GNGAG----------------------RLSLSR---SRSRASS
RVREE--EFLKWTVLRRDPSMRLTTLKK--------------------------------
NKKSGSGTGGDDDDDDDEDDDDEDDD--------------DEEESDEERVSDIENDAEID
EEFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLSTLDMEK--ERAGVNFETLEGGYSRA
LELVRK----------GKGA--------------------------EAHPE-------TS
----------------------KNYILCTD----LSSESTYALTYVMGSLVSNGDTLYIV
HWDGDSTT--STKD---SFIDNALRVKKHVRHLMDCVSVI--VDDLDVVIISLTHPYPKH
LLNEMIHGLKPVTLACSLSLILSS--LQNFVCSVPTLVIRKKLKRSRKKGISE
>NCAS0G00190
MSTNHSNSNSKHGK----------GHKSILLTTPEGK--EAPLHHSESNPLPTEDKLLPP
QKLEDADNMLTPSKSTDLSPRTSAPSTG--------------------------VQFDAE
QIERG-RSRIKKSN---AISAGAATMGTSQTGGNIGSLSG----SKSRSR---SRSRASS
RIREE--EFLKWTVLRQDPSMRLQNVNENIDRYNRRKKRREERRLLKKTK----------
KEGELEDSDEDDEDDEEEEEEDSDEE--------------EEEESDEEQVSDIENDVEID
EAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GK--ENDNVEIGRLDGGYLRA
MQLLTK----------GKGA--------------------------YLNTESTATPTPAG
----------------------RCYILYTD----LSSESTYALTYTMGAVINNGDTLYVV
HSENSNI---FDEP---LMLKNVGRIRKHVMHMFDCISAV--VDDVDVVALSLTHPYPKH
LLNEMIHGLKPVALCVPLSIMLSS--LQNFVCSVPTLVIRKKLKRAKRKGITD
>NDAI0F00230
MNTNNNASRDADNDNNKSLGGPGINKRSILLTTPEGS--ETKLMKDAKNDDTIIDSPTTS
TSDLQPPPSINISHIDSTADQMANLSPKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAE
EIERG-RSRIKNSTTHANVNTNANPNNNTNNNMERSNRRIGGSLSTSRSR---SRSRASS
RIREE--EFLKWTVLRQDPSMRLQNLNENIAKYNKKKKKNELKEQKNLKKKRSETDDEQT
EEEEEEEEDVTDTDSDEDDEDDDEDE--------------SDEESDEEQVSDIENDVEID
EAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GK--ENEGVNFTTLDGGYIRA
MQLLTK----------GKGA--------------------------SMDFDPMKP---AG
----------------------RCYILYTD----LSSESTYALTYMMGAVLNNGDTLYIV
HWESSKV---ANEK---LMQENVGRVRKHVMHMFDCVSAV--IDDLDVIILSLTHPYPKH
LLNEMIHGLKPVSIACSLTIILST--LQNFVCSVPTLVIRKKLKRS-------
>Suva_9.34
------------------------MHKSILLTTPDGA--QTNL------HQTKPETPTT-
------------------------------------------------------VEFDSE
QLERGHRERGRSK-----------------------------------------------
--KEE--QFLKWTVLRQDPSMRLRVV----------------------------------
DQDSEEDEDNDNNNNNDDDGPNDDDV--------------DDEESDEEQVSDVDNDLEID
EEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYEMGH------ENDGVSLERLAGGYVRA
MQLLTK----------GAGA--------------------------EPG---------AQ
----------------------RCFILYTD----LSSESTYALTYLMGAVLNQGDTLYIV
HWEPSTP---VDDA---QMLANVARIRKHVMHLFDCVAGV--LDDLDVVVLSLTHPYPKH
LLNEMIHGLKPVALCCSLSVILGT--LQNFVCSVPTLAVRKKLKRAKRKGICE
>Skud_9.14
------------------------MQKSILLTKPDGT--QSNL------HRTKTETPTT-
------------------------------------------------------VEFDSE
QMERGHRERGRSKK---KRDERDSYAS-----------------SLSRSRSRASRASSRS
RVREE--EFLKWTVLRQDPSMRLKV-----------------------------------
ADADSDEEEEGEGGDDDDDDEDGDDM--------------DEEESDEEQVSDVENDAEID
EEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIR-GH--ENEGVSLEQLDGGYVRA
MQLLTK----------GAGA--------------------------EPG---------NQ
----------------------RSFILYTD----LSSESTYALTYLMGAVVNQGDTLYIL
HWEPSKP---TDDS---QMFANVARIRKHVMHLFDCAAGV--LDDLDVVVLSLTHPYPKH
LLNEMIHGLKPVALCCSLSVILST--LQNFVCSVPILAVRKKLKRAKRKGISE
>Smik_9.15
------------------------MQKSILLTKPDGT--QSNL------HSAKTETPTT-
------------------------------------------------------VEFDSE
QMERGQRERGRSKK---KRGDQDSSVS-----------------SLSRSR---SRASSRS
RVREE--EFLKWTVLRQDPSMRLRVV----------------------------------
-----DVDSEEEGEGNDDDGDDGDDV--------------DEEESDEEQVSDVENDLEID
EEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIR-GH--EDEGVSLEQLDGGYVRA
MQLLTK----------GAGA--------------------------EPG---------NQ
----------------------RSFILYTD----LSSESTYALTYLMGAVVNQGDTLYIV
HWEPSKP---TDDA---QMFANVARIRKHVMHLFDCVAGV--LDDLDVVVLSLTHPYPKH
LLNEMIHGLKPVALCCSLSVILST--LQNFVCSVPILAVRKKLKRAKRKGICE
>YIL154C
------------------------MQKSILLTKPDGT--QSNL------HSIKTETPTT-
------------------------------------------------------VEFDSE
QMERGHRERGRSKK---KRGERDSNVS-----------------SLSRSR---SRASSRS
RVREE--EFLKWTVLRQDPSMRLRVV----------------------------------
---DVDSEEEGEGNDEDDDDGDGDDM--------------DEEESDEEQVSDIENDLEID
EEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIR-GH--ENEDVSLEQLDGGYVRA
MQLLTK----------GAGA--------------------------EAG---------NQ
----------------------RSFILYTD----LSSESTYALTYLMGAAVNQGDTVYIV
HWEPSKP---TDDS---QMFANVARIRKHVMHLFDCVAGV--LDDLDVVVLSLTHPYPKH
LLNEMIHGLKPVALCCSLSVILST--LQNFVCSVPILAVRKKLKRAKRKGISE
>KLLA0A00440g
MEE---------------------PGRGILNKKLTD---DKHLAAPPAFPT---------
------------------------------------------------------IKIE-E
PEQRG-RSRSKTRD---TGI------------------------SSSRSI---SRSASRV
SIKDQ--AYLKWTILNKDPSERLHLKAKKGNTRDS-------------------------
VSPGQENGGDEDEDEDEEEFIEDRED--------------DGEVSEEEQVSDVENEIEID
EHIDYDLGCKVLPNFVTPITQVLDSMKPWLAK-NAEIKTEA--DKRDIKLEEIQHGIHRA
VYHMSK----------GDNI--------------------------TAATSE------KG
----------------------HSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYII
NQCDDDTN---------DMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQ
LLTEMAHSLQPSSIIIPLQTVLAS--LQNFITSVPMLVIRKKLKRSKRRGIAD
>AFR294W
MDE---------------------PSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRR
TSSPIGVT----------------------------------------------IKIEEP
PEQRG-RTRNKQSG---AAFSS----------------------SRSRTK---SRSRSRV
SVTDQ--EFLRWTILRADPSERLHL-----------------------------------
------------------GAVEDEED--------------DDELSDEEQLSDVENDYDVD
AELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQ------PAGAARVDVLQDTCTRA
VRHFAR----------HSGA--------------------------PGP---------AG
----------------------KTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIF
VLCDAV-----------DVESHLNRVAEQVAFLLDCSAAA--LDDLDVVVLALQHAYPRH
LLTETIHAFRPAGLIVPLQIATRS--LAGYVSSVPTLIVRKKLKRARRRGIFD
>Ecym_4011
MDE---------------------PGRGILNRNGSSNMFVMPPPQQQQQHQRQNQSAAAA
AGPSSEPGSANGAKASNGIIQTDGKGNSSSMTSPMGVT----------------IKIEEP
PEQRG-RSRNKQSD---ATSSFST--------------------SRSRTK---LRSLSRV
SIAEH--ELLRWTILRHDPSERLHRDSHAGTA----------------------------
ARFGDISPQTTTVVPAGAAAGIAEDI--------------EDVLSDEEQISDVENDYEVD
AALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQ--EKKKVQVDVLEN-CKRA
IQHIAK----------RALS--------------------------PAP---------AG
AAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLANRDTLYIV
VQCDAA-----------DVEAHLVKVREQVAFLLDATSAA--LDHLDIIILTLHHPYPRH
LLTEISEAFQPSALIIPLQIATGS--LAGYVSFVPTLVVRKKLKRSRRKGIYD