MUSCLE (3.8) multiple sequence alignment

Kpol_304.6         -----------MVIQTDFSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEH
KAFR0H00150        MASLSSDKMNLEDSSLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDH
KAFR0D02160        --------------MESISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEY
Suva_11.335        -------------------MFLNP---NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEH
Skud_11.338        -------------------MLLNP---DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDH
Smik_11.362        -------------------MLLNP---DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDH
YKR098C            -------------------MLLNP---DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDH
Ecym_4009          -----------------MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEH
ZYRO0B16544g       --------------MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDH
KLTH0E00814g       -----------------MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEH
Kwal_55.19645      -----------------MNHLYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEH
TBLA0E01760        ------------MKRTKTLPNYTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDH
KLLA0A00396g       -----------------MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQ
AFR296C            -----------------MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLER
SAKL0E15136g       -----------------MECSYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEH
CAGL0H06721g       ------------------MDRFTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQ
Suva_9.30          --------------MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEH
Skud_9.12          --------------MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEH
Smik_9.13          --------------MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEH
YIL156W            -----MLDDDKGTAMHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEH
KNAG0L02200        --------MRSMYGDDSTALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEH
TPHA0D04660        ---------------MKVESTFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEH
TDEL0B02080        --------------MADTEVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEH
NCAS0G00170        ------------MPSAYEKSTFTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEH
NDAI0F00200        -------------MSVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEH
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         TAYLLEAFHHFLPSG-RYDDALSAYIVGCYYLYLIIPQSTQF--QTKNKSYSMYNDWKIL
KAFR0H00150        TTYLLDLFKVYTSHKSRKRQATLAFVNGSFYLFLIIPYCVQF--QTKNKLFTRYKDLKID
KAFR0D02160        TEQLFEYFLK------GNTDSLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKY
Suva_11.335        AAYLFDVYVRDLKNN-QKKNALTAFIVGGFYLYLVIPHSLQF--QTRNNVYSSYAKLKNK
Skud_11.338        TSHLFDVYLRDLEIN-REVEALTAFIIGGYYLYLIIPQSLQF--QTRSNLYSSYAKLKNS
Smik_11.362        AAHLFEVYLRDSEIN-QEMEALTAFIIGGYYLYLVIPQSLQF--QTRNNLYSSYAKLKND
YKR098C            AAHLFNVYLRDLEIN-QEMEALTAFIIGCYYLYLIIPQSLQF--QTRNNLYSSYAKLKND
Ecym_4009          GAYLLESYRELLGRG-QVEAGITAYVVGAFYLYLIIPQSIEF--HTRNLSYSIYVDLKRH
ZYRO0B16544g       TRYLYESFSDEMKNR-NKQDALTAYIIGCYFLYLIIPQSTQF--QARNKTFQVHNALKKL
KLTH0E00814g       AEYLFESYRHALAAN-QAEDLLTAFVAGCFYIYLIIPHSIQF--QSRDKSYAIYADLKKY
Kwal_55.19645      AEYLFESYRRSLEAK-QNSELLTAFVVGCFYIYLIIPHSIQF--HSRDKSYAIYADLRKY
TBLA0E01760        SSFLFETYTKSLRDS-HFDDALSAFIVGSFYMYFIIPQSTQF--LTKNRHYRMYHELKNL
KLLA0A00396g       AESLFESYRESLSVE-KYEDCLCEYVIGSFYVFLIIPGSVQF--SARNKSYSIYSDLKKL
AFR296C            AANLFESYQDLVREG-QTREGLMAYVIGAFYLYLIIPQSIEF--HTRNLSYSLYTDLRKH
SAKL0E15136g       AEYLFESYHMMLKQG-NQEDALTAFIIGSFYVYLIIPQSIQF--HTRNKSYGIYVDLRKY
CAGL0H06721g       AQCMLEDYMGCVDVD--TSKAVRVFITGCFYIYLVMPESMQF--QTRSKSYSLYTELRHL
Suva_9.30          TEYLFELYLDSMRHE-RPNDALTAFVIGCYYVFLIIPQSLQF--QTRNKSYSIYSDLKKM
Skud_9.12          TEYLYELYLDSMRHN-RPNDALTAFIIGCYYVFLIIPQSLQF--QTRNKSYSIYTDLKKM
Smik_9.13          TEYLFELYLDSMHHG-RPNDALTAFVIGCYYVFLIIPQSLQF--QTRNKSYSIYTDLKKM
YIL156W            TEYLFELYLDSIHHD-RPNDALTAFIIGCYYVFLIIPQSLQF--QTRNKSYSIYTDLKKM
KNAG0L02200        TEWLYELYLSCLGKD-QNMDALGSFINGCFYVYLVMPQSIQF--HTRNRAHTVYSDVRAL
TPHA0D04660        TAYLLESYLDLLHEQ-KYDECLSAYIVGCFYLYLIIPNSTQF--QIRNKSFRIYNELKIL
TDEL0B02080        TEYLFESYLQFLHEK-NNQDALTAFIIGCYYLYLIVPQSIEF--QTRNKSYSIFNDLMKM
NCAS0G00170        TEYLFELFLHFGHEG-NNKDALTSFIVGCYYLFLIMPQSIQF--QSRNKSYGIYSDLKKL
NDAI0F00200        TEYLLELFFTYNKNNTNNKDVLTAFIVGCYYLFLIIPQSIQF--QSKNKSYGIYTELKKL
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         YQNEANMTNVCSMVRNEVDSILDK--SYQEPEPTKRV--------------------IPR
KAFR0H00150        YEGQISMKNILDTVKEKSVSILEQ-----DLSGINRR--------------------ILK
KAFR0D02160        YESQPNLSDLLFIIRSESENILQS------------------------------------
Suva_11.335        YQDEQGMSYVLKLVKDESTIIVDQ--CLSDSKRISRS--------------------MKR
Skud_11.338        YQDEQLMSYVLRLVRDESTSIVDQ--YLSDSNRITVT--------------------ITR
Smik_11.362        YQDEQIMSYVLKIVKEESNMIVDR--YLSDSNRISRT--------------------ITR
YKR098C            YQDEHVMGYVLKVVRDESTVIVDR--YLAESNGICRT--------------------IKR
Ecym_4009          YESDPNMMNVMLLVAAKVGSVMQLYLSGEGDEKYGARF-------------------TGR
ZYRO0B16544g       YENQVNMTNVLLMVKDEVDSVLDR-----DFRKLKD---------------------VER
KLTH0E00814g       YQDEANMTNVLLMVTEVIESMSKD-----EVETAR----------------------IMR
Kwal_55.19645      YQDETNMTNVLLMVTGVIESVSRD-----ELESAK----------------------IMR
TBLA0E01760        YEDELNMTNVLSMVKTEITKILDS--NYKSQNESSNNLFVDSKF-------------IRR
KLLA0A00396g       YQDELNMSNVLLMVLHKVDSVLNQNMEILAKQHLD----------------------PSR
AFR296C            YEREPNMTNVVQMVTEKVDAVLLR-QTPEDGERGDTK--------------------LYR
SAKL0E15136g       YQDETSMTNVLLMVTKKVDAIL---CKSRDFDDTK----------------------ITR
CAGL0H06721g       YESQLNMTNVIAMVKEEVAQIQEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITR
Suva_9.30          YENEMNMTNVVLMVKKEIGVVLDD--SVKHVVGIEHR--------------------ITK
Skud_9.12          YENEMNMTNVVLMVKKEIGVVLDE--SVKHAVGIEHR--------------------ITK
Smik_9.13          YENEMNMTNVVLMVKKEIGVVLDE--SVKHVVGIEHR--------------------INK
YIL156W            YENEMNMTNVVLMVKKEIGVVLDE--SVKHGAGIEHR--------------------ITK
KNAG0L02200        YESQVNMTNVLLMVKEEVQVVLES---QWDSASLNER--------------------IPR
TPHA0D04660        YQNQANMTNVLAIVKNEVDSILDE--SILELEGIEKV--------------------IKR
TDEL0B02080        YQNQANMTNVLLMVKDEVDSILDR--NAREFKEFEHQ--------------------KAR
NCAS0G00170        YENQASMTNVLLMVKDEIETILEK-TAEREINETNNR--------------------IVR
NDAI0F00200        YENETHMTNVLLMVKDEIENVLDM-DENNNGSDLNHRI-------------------IKR
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         GRAFSVKDDT------------------------------------------PKDYNTIE
KAFR0H00150        KRAYTEPSIR--------------------------------------------------
KAFR0D02160        ---FDVDAPS--------------------------------------------------
Suva_11.335        KRAYSLPLRP-----------------------------------------LPVHMASLS
Skud_11.338        KRAYSLPLRP-----------------------------------------LPVHMASLS
Smik_11.362        KRAYSLPLRP-----------------------------------------LPVHMASLS
YKR098C            KRAYSLPLRP-----------------------------------------LPVHMASLS
Ecym_4009          KRAYSMQSCD--------------------------------------SSKLADTLGKLS
ZYRO0B16544g       KRAFSSPDNG-----------------------------------------LDSEISRLT
KLTH0E00814g       KRAYSVPYGK-----------------------------------------SPVTIQALS
Kwal_55.19645      KRAYSVPHKK-----------------------------------------LSDKMQALT
TBLA0E01760        ERAFSVPNAS---------------------------NPFSLMNDTSLDSQLDNSMDTLN
KLLA0A00396g       KRAFSVEEPI-----------------------------------------IRYQLHNLQ
AFR296C            KRAYSVPEKG--------------------------------------VARSSDSLQHLT
SAKL0E15136g       KRAYSVPSQA-----------------------------------------LANQLRSLT
CAGL0H06721g       RSAYSISSPSGMSTLSLHDELPEHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNP
Suva_9.30          KRAFSVPGID-----------------------------------------LSDQLASLS
Skud_9.12          KRAFSVPAND-----------------------------------------LSGQVASLS
Smik_9.13          KRAFSVPAND-----------------------------------------LSGQVASLS
YIL156W            KRAFSVPADD-----------------------------------------LSGQVASLS
KNAG0L02200        NRAYSVPDEA----------------------------------------RVVQNLDKLT
TPHA0D04660        DRAYSSPAPK---------------------------------------VNNISKFSKLS
TDEL0B02080        TRAYSVPDRN-----------------------------------------FESRLTNLN
NCAS0G00170        QRAYSVPDSN----------------------------------------DLTEQLHSLS
NDAI0F00200        QRAYSISINE-----------------------------------------LSNQVKSLS
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         FPIRERKSS-------------TTQRPLSMAKPYDSLP----------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ----------------------------SHSQHEEDNT----------------------
Suva_11.335        IH----------------------------------------------------------
Skud_11.338        IH----------------------------------------------------------
Smik_11.362        IL----------------------------------------------------------
YKR098C            IH----------------------------------------------------------
Ecym_4009          IERSSTRGT-------------TVFEGKTEQGAFGQQQ----------------------
ZYRO0B16544g       LAGNGS----------------TLPKMHKKWDFIRSDS-------------NFH------
KLTH0E00814g       KAN---------------------SATVEPDAPTETEF----------------------
Kwal_55.19645      LS----------------------PETASSTNAGPETD----------------------
TBLA0E01760        TSSTTVLSNKGTSAGPSFSNNSVTPNPTFRITLAKDANNMSANGNNSNSNSGINSSLQLP
KLLA0A00396g       LNN-------------------------ADQKSVDDDY----------------------
AFR296C            VDG---------------------KRRGGHHAIGGAIP----------------------
SAKL0E15136g       LNN-------------------TDGLEQLPEVSKESDT--------------LT------
CAGL0H06721g       ITNINQPRKSLDVTLNANNEIPTLSLHSDDKAVFDQHN-EAKSLPGTATDSDEE------
Suva_9.30          LDA-------------------AGPRGHLHKTSSTEED----------------------
Skud_9.12          LEN-------------------AGPHGHGFKASFTEED----------------------
Smik_9.13          LDT-------------------AGPQQHNIKVPLTEDD----------------------
YIL156W            LDT-------------------AAPQDHGLKGTFTEDD----------------------
KNAG0L02200        LQSPTETRGGRPRSQKKQLL--QLPRPGNVPVHSDSEFIAEQGISLHGDDSGWS------
TPHA0D04660        INDNHHNGETISTDNKLQSHFPQTPNYSNSNNSTGSFN-------NVKSNSNSS------
TDEL0B02080        IHN-------------------ENPLPLGDHQAASKSE-------QGREDMNNL------
NCAS0G00170        VSDRNLK---------------SPPRKILMNNSFEHSD----------------------
NDAI0F00200        ISNSIDQEHINNKTETSLTNQPPNHHLLPIILHCDEEF---------SNEEINA------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ----------------MELDDSTPLWTAPSLNPNDQLKLALE------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------ADSSTTIWQAPFLEPNDQLKLAIIS-----------------
Suva_11.335        ------------------NQLDVPLREMPI------------------------------
Skud_11.338        ------------------NQSDDPPREMPN------------------------------
Smik_11.362        ------------------NQLENPRHETPKVSAKS-------------------------
YKR098C            ------------------NKFDGSLHEIPN------------------------------
Ecym_4009          ----------------QDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHD---------
ZYRO0B16544g       ----------------SHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVD--------
KLTH0E00814g       -------------------ENGTTMWTAPELEPNDHLKVSLGSHHSSTSSAS--------
Kwal_55.19645      ------------------NENDSTMWTAPELEPNDHLKVNLGGHNSSVSS----------
TBLA0E01760        RYQYTNEVHSDVEYSIEDTDESSPLWTAPQLDSKNQLKLAPDAGNPQIVDDAYSNQLPSV
KLLA0A00396g       ------------------KSFASTEWKAPQLDPNDRLHLAIASSKTTESSSLNSIS----
AFR296C            ----------------EVAVQADTLWSAPKLEENDLLRTVVSVSRSPSVSLSRPSSRGGD
SAKL0E15136g       ----------------NYADDYTTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSS----
CAGL0H06721g       ----------------YYVEHGSPIWTAPDLDPNDQLKLALG------------------
Suva_9.30          ------------------ADQSSPVWTAPNLEPNDQLKLALL------------------
Skud_9.12          ------------------AEQSSPVWTAPNLEPNDQLKLALL------------------
Smik_9.13          ------------------MDQSSPVWTAPNLEPNDQLKLALL------------------
YIL156W            ------------------AEQSSPVWTAPNLEPNDQLKLALL------------------
KNAG0L02200        ----------------DLDDQSSPLWRAPQLEPNDQLKLAAEVHDLPPGAISRGSDADEE
TPHA0D04660        ----------------EEAEDTAPIWHIPSLEPNDQLKLALEQPVE--------------
TDEL0B02080        ----------------QNDEDSSPVWTAPPLEPNDQLRIALD------------------
NCAS0G00170        -----------SDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLP------------
NDAI0F00200        ----------------TDFDRASPLWTAPSLEPKDQLKLAYTNNTNTKTNTDNNNGQKDS
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          -------------------T----------------------------------------
ZYRO0B16544g       -------------------T----------------------------------------
KLTH0E00814g       ------------------------------------------------------------
Kwal_55.19645      ------------------------------------------------------------
TBLA0E01760        TRVLSNIRRNQPKQSKLSLN----------------------------------------
KLLA0A00396g       -------------------L----------------------------------------
AFR296C            FVENALDGNSTKNGGRNTSKREGRRNSRRSDRSGRRNDGAKQRNGRSPNRSRSRGRSRSR
SAKL0E15136g       ------F------------V----------------------------------------
CAGL0H06721g       ------------------------------------------------------------
Suva_9.30          ------------------------------------------------------------
Skud_9.12          ------------------------------------------------------------
Smik_9.13          ------------------------------------------------------------
YIL156W            ------------------------------------------------------------
KNAG0L02200        EDVDDLE------------I----------------------------------------
TPHA0D04660        -------------------F----------------------------------------
TDEL0B02080        -------------------A----------------------------------------
NCAS0G00170        ------------------------------------------------------------
NDAI0F00200        TANDFP-------------F----------------------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         -------------------------------------------------------QPELT
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ---------------------------------------------------SESELESET
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          ---------------------------------------------------SDSKTKDSG
ZYRO0B16544g       ---------------------------------------------------VGKEAPELS
KLTH0E00814g       ---------------------------------------------------SNEQFPKIH
Kwal_55.19645      ---------------------------------------------------RSSNEQAFK
TBLA0E01760        ---------------------------------------------------TNTNSPRSI
KLLA0A00396g       ---------------------------------------------------DENLYKEQD
AFR296C            VRNRSRSQTRIGGPTSDMADAKERGRTRSRSWSRSGSRSPSYSIRSTGGSRSPSRSPSRS
SAKL0E15136g       ---------------------------------------------------MDQHSKKFS
CAGL0H06721g       ------------------------------------------------------------
Suva_9.30          ----------------------------------------------------PEVIPTPA
Skud_9.12          ----------------------------------------------------PEVIPTPI
Smik_9.13          ----------------------------------------------------PEVIPTST
YIL156W            ----------------------------------------------------PEVIPTPA
KNAG0L02200        ---------------------------------------------------GYEEMGIYG
TPHA0D04660        ---------------------------------------------------SDEEIDASS
TDEL0B02080        ---------------------------------------------------TPLSPSIMA
NCAS0G00170        ---------------------------------------------------PPVIPYEAD
NDAI0F00200        ---------------------------------------------------APIQMPFDN
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         LDEQLSDKTQHNLIDDKYNNFTIPLPHQIPLPVKVTDF----------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        EVEAEIDINANESKYTNF------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          LENNSAAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNN---------------------
ZYRO0B16544g       LSPLGYPKHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKD-----------------
KLTH0E00814g       NESHSFPFEEPELHALSLGGSRTRRSSVPARASRKLGTTQA-------------------
Kwal_55.19645      VGNEGNSSSSDDIEMAVHSTTQDQRPRRSSVPIKVEAPQN--------------------
TBLA0E01760        ISQTPTSPTSRNIPYTNSHNNNTNSNNNSSSTYIHSASSFDSSNDIFKDALANNLNSKIN
KLLA0A00396g       DTDALDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQN-----------
AFR296C            ASRSPIRGRSRSRSGSRTPELGSATASVHSWSYLQTTGQQSRWSVLPNDLPNAGQNKYNQ
SAKL0E15136g       IGESSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSV---------
CAGL0H06721g       --------TELLSPPVMGLDGDTLGDDIYYETVSKGDDVS--------------------
Suva_9.30          FPESGRKTSTPVRQSVLL--------EDVPYTHNDNDGTSA-------------------
Skud_9.12          YPESGRKTSSPVRPSVLL--------EDVPYNCYDGGASSA-------------------
Smik_9.13          FNEPERKSTSPARPSVLL--------EDVPCTYHDNDASTA-------------------
YIL156W            FREPERKTSVPVRPSVLL--------EDVPSIYHEDDTSFA-------------------
KNAG0L02200        LAHHSVAPPQHAPPPVPLSSQSPITSGGTPAAIDDLMMRRRRTHTMTQMTPAAQTVPPGG
TPHA0D04660        ISEPLGRRYSPLSPYQKKRNSSISSAFLVPFPHNENDKVH--------------------
TDEL0B02080        LDQPMATKELAISTSRKALSRRASAMGPTPYPIEELDISGQDGNSHYDEL----------
NCAS0G00170        IQERTDLLKQPSIPELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREP-----------
NDAI0F00200        GSAPDIPPKIPITKATTNIINNSESENNVNEGTMPFTTSSLENINNINNI----------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         NHDKKIQKI--Y----------------------------------------PVDRSETH
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        INDKTINDE---------------------------------------------------
Suva_11.335        EISKPINDT---------------------------------------------------
Skud_11.338        YLAKPINDT----------------------------------------------SGKDL
Smik_11.362        INDTSVKDI-------------------------------------------PGERNQAH
YKR098C            ELTKPTNDN---------------------------------------------------
Ecym_4009          DELPSIGDH-ND----------------------------------------VLDRFYTH
ZYRO0B16544g       DDEQHFWDA--K----------------------------------------V-DRAVAH
KLTH0E00814g       SNSSDFNDQ-------------------------------------------KINRYATH
Kwal_55.19645      SLQSTVDDIYCQ----------------------------------------KVDRYNTH
TBLA0E01760        NSPTNIYNHGLTINTKDVEEDEEEDDFAETNPYHSSSVKEFPRKKSPTPLKSPVDRSVTH
KLLA0A00396g       DSSLMLENM--D----------------------------------------SFDRSRTH
AFR296C            ESAVSFEQQ-------------------------------------------ELDRPHNS
SAKL0E15136g       ESVANIYVQ--N----------------------------------------V-DRYNTH
CAGL0H06721g       YRGKDFEDL--H----------------------------------------A-NRLITH
Suva_9.30          SSDQPFGEI--T----------------------------------------A-DRSVTH
Skud_9.12          SLNPSFGEI--T----------------------------------------V-DRSITH
Smik_9.13          SLNPPFRDI--T----------------------------------------A-DRSVTH
YIL156W            SLNPPFREI--T----------------------------------------A-DRSVTH
KNAG0L02200        AHDRSFKDF--T----------------------------------------P-DRSLTH
TPHA0D04660        DNSMLIEDL-------------------------------------------PVDRSVTH
TDEL0B02080        GFNKTLWNA--N----------------------------------------V-DRQTTH
NCAS0G00170        SNNRSFRET-------------------------------------------NADRSQTH
NDAI0F00200        NNYKTIEQT--N----------------------------------------P-DRASNH
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         RKDSYHSVYMDNDNSAGYVRKND---EANNYIQTLERLQKQNVITCPELFSILSDPTTKD
KAFR0H00150        --------------------------------SGLSRDRSSTSV----------------
KAFR0D02160        --DTY-----------------------------LKHLYEECFITPHELFSILSNPSDRL
Suva_11.335        ------------------------------LVKGLAK--EENELKFSNELEEGTDTEGRD
Skud_11.338        RRE-----------------------------NNEIRLCSKHDVSAEDI-----DSTSRE
Smik_11.362        ------------------------------------------------------------
YKR098C            --------------------------------------SKEDIVR---------------
Ecym_4009          GQDLRYPICNDGVVPCEN--------------SSIMWLYESSSIKCLDLLSKLTS-SERS
ZYRO0B16544g       RKDSYHSVYMDDGDHDFGENKGAT--FPESEVQAMKRLQKQSIITSPELFSILSNKKERN
KLTH0E00814g       RKDSYHSVHMSND-------------DYDAFTFNLARLQKQSVVTCDQLMRIL-CSQDRD
Kwal_55.19645      RKGSYHSVHMTGD-------------EYDSFTFNTARLQKQSIITCDKLLRIL-DSEEAE
TBLA0E01760        RKDSYHSVYMFNDSNEDNNNHGYD--ETSEYIESLEHIQKQDVITCPELFSLLSNNVERE
KLLA0A00396g       RKDSYHSVYLGDELEDLNNIS-----------TGLARHQQENTIDCFALFSLLKDAESRE
AFR296C            RVEPYNPFANGNAAGLESCNP-------------LTRLYETSSIKCSDLMIILESDIQ-D
SAKL0E15136g       RKDSYHSVYMLNEDDDTNEYDFF---------QNLSRLQKQYVISCEELMDILQS-DERN
CAGL0H06721g       RKDSYHSIYMID-DDNNNSKNYFD--GSNAFIQGLERLQKQSIITAPELFSILSNPEERH
Suva_9.30          RKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESE
Skud_9.12          RKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIERE
Smik_9.13          RKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVERE
YIL156W            RKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVERE
KNAG0L02200        RKNSYHSVYMLEESESSQGNLYYD--ESNAYIQSLERLQKQSIITAPELFSILSNEQQSK
TPHA0D04660        RKDSYHSVYMNNQDEESDSGAHYG--LSNSYIQSMDRLQKQNVITCSELYSILSSPTERQ
TDEL0B02080        RKDSYHSVYMFEGGSDDHMPS-----ISKDFTQGLERLQKQSIITAPELFTILSSSEESE
NCAS0G00170        RKDSYHSVYMIDEESTDKLNQFY---DSTDYIQDLQRLQKQSIITAQELLSILSCPPERI
NDAI0F00200        RKDSYHSIYMVDDGSADGITQYY---DSNPYIHSLERLQKQCIITAQELFSILSNPIEKS
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         DILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKIL-N---DQLFN
KAFR0H00150        --------LSRKPTLSHV------------------------------------------
KAFR0D02160        KILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSLFS-------NPLFQ
Suva_11.335        STSTEPLSIP--------------------------------------------------
Skud_11.338        SL----------------------------------------------------------
Smik_11.362        --------FSKKLGADSESTENTSKV----------------------------------
YKR098C            -------------ESNQIASSNKLEAGSE-------------------------------
Ecym_4009          SMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVI-D---NHLFR
ZYRO0B16544g       RLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERL-K---NSIFN
KLTH0E00814g       NLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL-D---NKLLN
Kwal_55.19645      RLLLVDLRFIKRFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLN-K---NHALK
TBLA0E01760        KVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQII-N---NPLFS
KLLA0A00396g       NLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV-A---NPILD
AFR296C            RVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRL-D---NPLFT
SAKL0E15136g       NVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGS---YQTFQ
CAGL0H06721g       KLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRL-N---NPLFN
Suva_9.30          KLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEG---NEHFI
Skud_9.12          KILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEE---NEIFI
Smik_9.13          KVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKE---NENFA
YIL156W            KVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKE---NENFI
KNAG0L02200        QLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKL-N---NPLFN
TPHA0D04660        KLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYSFEELVKRI-N---NPLIS
TDEL0B02080        KLLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEII-K---KPAFL
NCAS0G00170        KLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLL-D---NELFN
NDAI0F00200        KLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQ
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         IRKSFAYVVYYTDLKTYMKIN-FDYNFTLFYLLTSSRT-SVLKTFPTSLLGGLEKWKKVI
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        KIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSSSM----KVTPNFLLGGFEKWEQLI
Suva_11.335        ---------------SYLRLD---------------------------------------
Skud_11.338        ------------SIPSYSKLN---------------------------------------
Smik_11.362        ----------FLSMPSYSKLN---------------------------------------
YKR098C            -------VAYYTSKEALSKPS---------YLKLSTGK----------------------
Ecym_4009          SRRQFATIVCYTDNYTYMQID-FDFVFLLFRLLYLGRP----QLVLKTLSGGYEQWKSFL
ZYRO0B16544g       KRGSFDFIVYYTDMKTYMEMD-FDYLFVFYNLVVASQE-VSLRSLPSYLLGGYEKWKAVL
KLTH0E00814g       ARSQFEYIVYYTDMKTFMKLD-FDYQLVFFQLIYTSNK--NLKCTPKVLLGGYEQWKKFL
Kwal_55.19645      DLSQFKHIVYYTDMKTFMRLD-FDYQLVFFQMLYTSNW--RISCTPKVLLGGYEQWKKFL
TBLA0E01760        KRDTFKYVVYYSDMKTYMNMT-FDYLFTLFYLLVTCTS-KPVKSLPTSLLGGYEKWYKVI
KLLA0A00396g       KISQYDNIVYYTDYKSFMHLT-FNYELILFELLFKKTG----TAIPKSLLGGYEQWKAFL
AFR296C            TRGQFSYLVCYTDNHTSMNMD-FKFELTFFELVYMGKP----RLLTKCLQGGYDQWRLYL
SAKL0E15136g       SRSKFKYIVYYTDMKTFLNID-FDYRLVFFQLLYASSS-TRLRSPPKALLGDYEQWKTFI
CAGL0H06721g       GRLKYDYIVYYSDMKTYMNFE-YDYSFILFYLLTTSGK--HLSSVPTALLGGYEKWKKVM
Suva_9.30          NRDKFQYVVCYSDVKTFMTMN-FDYSFIFFYLLLTSQK-TRLATVPTALLGGYEKWKKTL
Skud_9.12          NRDKFEYVVYYTDVKTFMYMN-FDYVFIFFYLMLTSQK-THLTSVPTALLGGYEKWKKTL
Smik_9.13          NRDKFDYIVYYSDVKTFMTIN-FDYVFIFFYLMLTSQK-TPLTTVPTALLGGYEKWKKTL
YIL156W            NRNKFDYIVYYTDVKTFMTIN-FDYAFIFFYLMLTSQK-TPLTTVPTTLLGGYEKWKKTL
KNAG0L02200        RRDEFDYVVYFSDMKTFMKLN-FDYHFTFFYLLNTARG-KPLKCVPTVLLGGYEKWKKVI
TPHA0D04660        EVNKFDYIVYYSDIRTFMVTD-YDFCFTFFYLLLSTKS-LNLKQVPTNLLGGFEKWKKVL
TDEL0B02080        ERGSYDYIVYYTDMKTYMTID-YDYMFTLFYLLTASPT-VNLRSLPTHLLGGYEKWKKIM
NCAS0G00170        RRHEFEYVVYYTDMKTYMHSD-FDYNFTLFYLLTTETT-NILRSTPTYLLGGYDKWKVFL
NDAI0F00200        NRTQFEYIVFYTDNKTYMNTN-FDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVL
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         RTYYHENGINALNYLHK------------------------------FHVHNIDQKEGDR
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        SSYSEQYGIETSNYIFT-------------------------------------------
Suva_11.335        ---------TGKDSLFK-------------------------------------------
Skud_11.338        ---------TGKDTLFK-------------------------------------------
Smik_11.362        ---------TGKDFLFK-------------------------------------------
YKR098C            ------------DALFK-------------------------------------------
Ecym_4009          KELKRTESIILSDFLWKRPHKNEHSNDIVIASGEPSDSNNSKSFPPSLVENSIPAFQSDH
ZYRO0B16544g       KKYLTQFGIRVDDYLYR-----------------P-YSSNKEGKEKSANAKHI-------
KLTH0E00814g       SKSSQAY-CDKDAFLYS-------------------------------------STNNGR
Kwal_55.19645      AKVPQSRVPIKEAFLFR-------------------------------------------
TBLA0E01760        NSYVNQYSITMNDYVYR------------------------------------KDAGASA
KLLA0A00396g       NKQLRDSEFDKSLFLFR-----------------K-SKSAPSDKTASKPSVQTDNIIKSS
AFR296C            KTNTKSIHAKISDFMWR-----------------------ANFLGRDTSVSDHNPFRATP
SAKL0E15136g       GQYAKHHDIVTGDYLFR-----------------P-YASSAKSQKDKVKPISAPPVPATR
CAGL0H06721g       NTYVSQYQIELDDYLYR-----------------P-YA----------PSNNKGEQNNAQ
Suva_9.30          HTYAQQYHISIDDYLYR-----------------P-YSQKQQQQQQQQQQQQQPSSQDSS
Skud_9.12          HTYAQEYDVSIEDYLYR-----------------P-YSQKAHQQ--QQQEQQQSNAQDSS
Smik_9.13          HSYAQEYHISVEDYLYR-----------------P-YSQKARAQ--QQQQQQQPNSQDSS
YIL156W            HSYAQEYHISIEDYLYR-----------------P-YSQKARLQQEQQQQQQQPDSQDSF
KNAG0L02200        LEYGKQYNICVTDYLVR----------------------ITEGEDDTPARHDCQELPYRQ
TPHA0D04660        KTYNKEYGIDITPFIKK----------------------------------LHATELNKN
TDEL0B02080        KNYSVDHGVNMDNYIYR---------------------------PYGESKKALPDTSSKR
NCAS0G00170        HHYAKEYDINIPDYLYR------------------------------PYDKALKSETPEE
NDAI0F00200        YSYSEQYNFNMGDYLYK-----------------P-------HRHSGDSIKHHDDLVDSH
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         SNIGV-----EHYFWNAPEIPMRIRQRPPPPIPST-------------------------
KAFR0H00150        -----------------PSNPQRTLSTPKRSSTLM-------------------------
KAFR0D02160        ----NNKRFTEPPSWNPPPVPHEIRKRPPPPPPPN-------------------------
Suva_11.335        -------------TLSSPAAAASTRDSLDVLLQFE-------------------------
Skud_11.338        -------------THSSPAAASTAHSCDTSSQAAV-------------------------
Smik_11.362        ----TLSSPATAPTVHSFEVSSQVEDSTEDLSSIS-------------------------
YKR098C            ----TLSSPATAPPVHSLEVSSQIRDSSQDSSSSL-------------------------
Ecym_4009          KPIAQQSSVGIEPIHRFSSVSTYSKPVVPPPIPVTRPLLNPATNPLSQYCSQMLVNAVKP
ZYRO0B16544g       ----------EPVPWKPPALPERMRNLPPPPPPAT-------------------------
KLTH0E00814g       NAPVTSHSLPEHYPVAPPSIP-------PPPPPIA-------------------------
Kwal_55.19645      LKPGGKETVASAIIHQKASTPLPPSIPPPPPPVEK-------------------------
TBLA0E01760        GRPLNNNEKPKMEIWTPPQLPIRIRKRAPPPPPSS-------------------------
KLLA0A00396g       PSILSKEHNDDTLISSTPPIP-KVAPPPLPGSPLS-------------------------
AFR296C            PVPTARPPVPPLPTAPPPVAPYISSPRPVPFIPLQ-------------------------
SAKL0E15136g       ----------PPPPPLPAQAPPALPSQAPPTLPSQ-------------------------
CAGL0H06721g       IP--------DVPTWKPPPVPVMVRKRPPPPVPVS-------------------------
Suva_9.30          SSKESSAKIPEPPSWKPPDLPIRLRKRPPPPLPVT-------------------------
Skud_9.12          SSKESSAKVPEPPSWKPPDLPIRLRKRPPPPPPVS-------------------------
Smik_9.13          SSKETPTKVPEPPSWKPPDLPIRLRKRPPPPPPAS-------------------------
YIL156W            SAKESSTKVPEPPSWKPPDLPIRLRKRPPPPPPVS-------------------------
KNAG0L02200        QNFAGINGPGAVEPWKPHEVPATIRKRPPPPPPAS-------------------------
TPHA0D04660        TVPTGEMKTLEATSWKQPEVPLRIRKRPPPPPPSS-------------------------
TDEL0B02080        TP--------ELPSWKPPAIPPRIRKRPPPPPPIS-------------------------
NCAS0G00170        FEETKNKHVLEPPSWRPPELPVRIRKRPPPPPPAL-------------------------
NDAI0F00200        IL--------QPPSWKPPELPLRMRKRPPPPPPVA-------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          PSTNENSVSQSHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD
ZYRO0B16544g       ------------------------------------------------------------
KLTH0E00814g       ------------------------------------------------------------
Kwal_55.19645      ------------------------------------------------------------
TBLA0E01760        ------------------------------------------------------------
KLLA0A00396g       ------------------------------------------------------------
AFR296C            ------------------------------------------------------------
SAKL0E15136g       ------------------------------------------------------------
CAGL0H06721g       ------------------------------------------------------------
Suva_9.30          ------------------------------------------------------------
Skud_9.12          ------------------------------------------------------------
Smik_9.13          ------------------------------------------------------------
YIL156W            ------------------------------------------------------------
KNAG0L02200        ------------------------------------------------------------
TPHA0D04660        ------------------------------------------------------------
TDEL0B02080        ------------------------------------------------------------
NCAS0G00170        ------------------------------------------------------------
NDAI0F00200        ------------------------------------------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          AKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSV
ZYRO0B16544g       ------------------------------------------------------------
KLTH0E00814g       ------------------------------------------------------------
Kwal_55.19645      ------------------------------------------------------------
TBLA0E01760        ------------------------------------------------------------
KLLA0A00396g       ------------------------------------------------------------
AFR296C            ------------------------------------------------------------
SAKL0E15136g       ------------------------------------------------------------
CAGL0H06721g       ------------------------------------------------------------
Suva_9.30          ------------------------------------------------------------
Skud_9.12          ------------------------------------------------------------
Smik_9.13          ------------------------------------------------------------
YIL156W            ------------------------------------------------------------
KNAG0L02200        ------------------------------------------------------------
TPHA0D04660        ------------------------------------------------------------
TDEL0B02080        ------------------------------------------------------------
NCAS0G00170        ------------------------------------------------------------
NDAI0F00200        ------------------------------------------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          SQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATPESNLSATPD
ZYRO0B16544g       ------------------------------------------------------------
KLTH0E00814g       ------------------------------------------------------------
Kwal_55.19645      ------------------------------------------------------------
TBLA0E01760        ------------------------------------------------------------
KLLA0A00396g       ------------------------------------------------------------
AFR296C            ------------------------------------------------------------
SAKL0E15136g       ------------------------------------------------------------
CAGL0H06721g       ------------------------------------------------------------
Suva_9.30          ------------------------------------------------------------
Skud_9.12          ------------------------------------------------------------
Smik_9.13          ------------------------------------------------------------
YIL156W            ------------------------------------------------------------
KNAG0L02200        ------------------------------------------------------------
TPHA0D04660        ------------------------------------------------------------
TDEL0B02080        ------------------------------------------------------------
NCAS0G00170        ------------------------------------------------------------
NDAI0F00200        ------------------------------------------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         -----------------------------------------IIHP---------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        -------------------------------LPSRTY-----------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          ANSASQSNLSNTPDAKSVSHVSITTTTVPMVLPPIPVTRPLIPPPFENNRADSSLSSTRE
ZYRO0B16544g       -------------------------------LPITKE-----MPP---------------
KLTH0E00814g       ---------------------------KTEEMTKTPYNRAPFPTP---------------
Kwal_55.19645      -------------------------------VSKADSGSYTRAPF---------------
TBLA0E01760        -------------------------------LPKPNSGK---MPP---------------
KLLA0A00396g       -------------------------------APTIVY-----NRP---------------
AFR296C            -------------------------------QPSLSLLHTSANIVK--------------
SAKL0E15136g       -------------------------------AP-PTQSIPAVHLP---------------
CAGL0H06721g       -------------------------------IPIPPE-----TPP---------------
Suva_9.30          -------------------------------MPTTPE-----NPP---------------
Skud_9.12          -------------------------------MPTTPG-----IPP---------------
Smik_9.13          -------------------------------MPTTPE-----IPP---------------
YIL156W            -------------------------------MPTTPE-----IPP---------------
KNAG0L02200        -------------------------------VPQSPD-----VVP---------------
TPHA0D04660        -------------------------------IPEIPSTYQNN------------------
TDEL0B02080        -------------------------------VPVPTEKPPAAPPP---------------
NCAS0G00170        -------------------------------LPVPPS-------P---------------
NDAI0F00200        -------------------------------IPTP-------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         -----PLPPKIGL-----------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        -----KVEKQ--------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          TNETVPLPLQTVRNSGSIPFYPVVQDNKPTLSAIFSDEKLTSQSIVNHDDDDGTSSKSVS
ZYRO0B16544g       -----PVPPKIQLEQ---------------------------------------------
KLTH0E00814g       -----LVQAQRADHF---------------------------------------------
Kwal_55.19645      -----PLPAKEMVI----------------------------------------------
TBLA0E01760        -----PLPPKINLH----------------------------------------------
KLLA0A00396g       -----PVPLPI-------------------------------------------------
AFR296C            -----PGKAELRNELSRI------------------------------------------
SAKL0E15136g       -----PLPPKSAINL---------------------------------------------
CAGL0H06721g       -----PLPQKIKLES---------------------------------------------
Suva_9.30          -----PLPPKIMVHP---------------------------------------------
Skud_9.12          -----PLPPKIMVYS---------------------------------------------
Smik_9.13          -----PLPPKIMVYP---------------------------------------------
YIL156W            -----PLPPKIMVHS---------------------------------------------
KNAG0L02200        -----VIPPRIMLDS---------------------------------------------
TPHA0D04660        -----ELTTLIEDKR---------------------------------------------
TDEL0B02080        -----PIPPKVSLET---------------------------------------------
NCAS0G00170        -----PVKPRIVDDV---------------------------------------------
NDAI0F00200        -----PVPHLLTNST---------------------------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          SSHKGIMPVKTVEHDCDTSPLPNLLPKIPKIVSSVENINSGLSQFVSASSSRPVSSHNIK
ZYRO0B16544g       ---------------------------------------------------------QED
KLTH0E00814g       ------------------------------------------------------------
Kwal_55.19645      ------------------------------------------------------------
TBLA0E01760        ------------------------------------------------------------
KLLA0A00396g       ------------------------------------------------------------
AFR296C            ---------------------------------------------------------TGQ
SAKL0E15136g       ---------------------------------------------------------HYS
CAGL0H06721g       ---------------------------------------------------------IEE
Suva_9.30          ---------------------------------------------------------HDN
Skud_9.12          ---------------------------------------------------------HDN
Smik_9.13          ---------------------------------------------------------HEG
YIL156W            ---------------------------------------------------------QVS
KNAG0L02200        ---------------------------------------------------------KVS
TPHA0D04660        ---------------------------------------------------------LEN
TDEL0B02080        ---------------------------------------------------------HPE
NCAS0G00170        ------------------------------------------------------------
NDAI0F00200        ---------------------------------------------------------LPP
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        ------------------------------------------------------------
KAFR0D02160        ------------------------------------------------------------
Suva_11.335        ------------------------------------------------------------
Skud_11.338        ------------------------------------------------------------
Smik_11.362        ------------------------------------------------------------
YKR098C            ------------------------------------------------------------
Ecym_4009          YSKFNMSQPPIPITKPLLTPSNTVSTFHVPLAPSSIPIRATTITASQSSHPNYMASQKRM
ZYRO0B16544g       KNH------TRPRSRTV-------------------------------------------
KLTH0E00814g       ------------------------------------------------------------
Kwal_55.19645      ------------------------------------------------------------
TBLA0E01760        ------------------------------------------------------------
KLLA0A00396g       ------NSPAPLLKPSI-------------------------------------------
AFR296C            IDHTQYNQPEKYRYLPD-------------------------------------------
SAKL0E15136g       VAT--GMQPPMPQVTTV-------------------------------------------
CAGL0H06721g       SAP---------------------------------------------------------
Suva_9.30          FQL---RQPPIPARQHV-------------------------------------------
Skud_9.12          SFS---RKPPIPAKQHV-------------------------------------------
Smik_9.13          SVP---RKPPIPAKQHV-------------------------------------------
YIL156W            SIS---RKPPIPAKQHV-------------------------------------------
KNAG0L02200        QHRAPFQSNLNFVTGQI-------------------------------------------
TPHA0D04660        IDVQGKHRRIEYISPPI-------------------------------------------
TDEL0B02080        EPPAVDDHSVE-------------------------------------------------
NCAS0G00170        ------NRPKK-------------------------------------------------
NDAI0F00200        ISSTTEQSPGIVLKT---------------------------------------------
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        -----------------------------------------------TESLSFVLARPAE
KAFR0D02160        -----------------------------------------------STRHTQGYREQQQ
Suva_11.335        -----------------------------------------------EPSQDSSSILKSK
Skud_11.338        -----------------------------------------------SSQDSSSQSKKAK
Smik_11.362        -----------------------------------------------KEEEEKEDIDKER
YKR098C            ------------------------------------------------SKVEKPKEEEGK
Ecym_4009          ELFESGSVRSVTTSKYPLPLVNPIHDPAQVASTQRTEIYDNIWRALDRRSERRNHRSNAY
ZYRO0B16544g       -----------------------------------------------SSPAEVPKNVVAP
KLTH0E00814g       -----------------------------------------------PASSQNHTRDKNE
Kwal_55.19645      -----------------------------------------------QSSLDSISRTQIP
TBLA0E01760        -----------------------------------------------GNPSLPPIHSPLE
KLLA0A00396g       -----------------------------------------------AKELRTPQRNDWT
AFR296C            -----------------------------------------------SRESPYPIEYEDP
SAKL0E15136g       -----------------------------------------------SHAHRHRYLSHSK
CAGL0H06721g       ------------------------------------------------SDNSQYIRPPAK
Suva_9.30          -----------------------------------------------KKQQLNSNEIIQK
Skud_9.12          -----------------------------------------------KKQQLNSNEIIQR
Smik_9.13          -----------------------------------------------KKKQSNSNEIIQR
YIL156W            -----------------------------------------------KKEQLNSNEIIQR
KNAG0L02200        -----------------------------------------------LEADEDTALQVAP
TPHA0D04660        -----------------------------------------------PPRTPSPNHQPSY
TDEL0B02080        -----------------------------------------------TTRPTRITRKAIG
NCAS0G00170        -----------------------------------------------TLMNLHSARPLLH
NDAI0F00200        -----------------------------------------------KTMTDLHSTKSQQ
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        IKKHT------------------------------------VPIIDATDNIPKMLSLVGL
KAFR0D02160        QQQQHHHNHRPK-------------------RIVTRYTKYGLPHLPHSSNLYVQLSISGL
Suva_11.335        EQEEEETVSAST------------------------SKTFKLPVIENSDNLLSELSITGL
Skud_11.338        QKEEAASSFISE--------------------------TFEPPTIEDSKGLLSKLSITGL
Smik_11.362        EKKTVRSSALNK-----------------------------LPTIEDSTSLLSQLSITGL
YKR098C            IEAIESSAP----------------------------KAYNLPVIEDSNDLLSELSITGL
Ecym_4009          ASAYRKNSSISHKGADRSPEETNNIKVDGHKLIRNPIPHFSIPTIENSYNEYVALSITGL
ZYRO0B16544g       EQLSQLDSYPMR------------------------QRQFSVPTIERSNNKYVALSITGL
KLTH0E00814g       IQKHSVPALSGN---------------------GNYSKHTAIPTIEQSPNEYVALSITGL
Kwal_55.19645      SHLESHYTHEKV------------------LQNKMHHAEGTIPTIEQSSNEYVALSITGL
TBLA0E01760        NQVHSLDTHKQN---------------------GAIHRHFSIPILEKSENDYVSLSITGL
KLLA0A00396g       VQTQHLHVP------------------------------FSIPTIERSPNEFVSLSITGL
AFR296C            KHTERSRGWLSA---------------------GSSEAHFSVPTIEKNPNEYIALSITGL
SAKL0E15136g       RSQHQHYSPISH-------------------------QYISVPTIEQSSNVYVSLSITGL
CAGL0H06721g       LPIHALHSPRNQ----------------------TLTRKFSIPTIEKNSNPYVAYSVTGL
Suva_9.30          KRQHQHQHYDQQ------------------LLQPQPQRVYHIPTIEQSSNAYVSLSITGL
Skud_9.12          KRQQQKHRHYGQ-----------------QLLQPQPQRAYNIPTIEQSSNVYVSLSITGL
Smik_9.13          KRQQQHYGQQLL--------------------QPLPPKDYSIPTIERNPNVYVSLSITGL
YIL156W            KRQHQHQHYDQQ--------------------ILQPQRAYNIPTIERSPNVYVSLSITGL
KNAG0L02200        TKRIQQEPFRSA--------------------TNGLHETYSIPTIEQNPNIYVSLSITGL
TPHA0D04660        NQKKHQYKALKS-------------------------YATPVPTIEQNPNTYVSLSITGL
TDEL0B02080        SRPLHTHPHDQR---------------------LSLQRHYSIPTIEKSSNTYVSLSITGL
NCAS0G00170        ERNYQIPPHLQQ--------------------TTTLTRRPSIPTIERSPNLYVSLSITGL
NDAI0F00200        HRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGL
Kpol_2001.78       ------------------------------------------------------------
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        RNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETK--------ISEPFARLL
KAFR0D02160        RNLGNTCYINSMLQCLFATTAFRNLFLSN-RYKEYIGTKVDPH--------LSNSFHILF
Suva_11.335        RNPCNTCYINSMVQCLFSTTLFRDLFLTK-KYKLFLENEKYPK-----GLQLSHSIYVLF
Skud_11.338        QNPCNTCYINSIIQCLFGSTPFRDLFLTK-KYRLFLKTEEYPK-----EVQLSRSIYSLF
Smik_11.362        QNPCNTCYINSIIQCLFGTTLFRDLFLTK-KYRLFLQTDKYPR-----EVQLSRSIYVLF
YKR098C            QNPCNTCYINSIIQCLFGTTLFRDLFLTK-KYRLFLNTNKYPK-----EVQLSRSIYVLF
Ecym_4009          RNMSNTCYINSMLQCLFSTSAFRNLFLSN-KYAHYLKSPEMDT--------MSRSFYMLF
ZYRO0B16544g       RNLGATCYINSMLQCLFATNMFRDLFEPS-NYERFFNP-ELED-----TGKLSKSFSVLI
KLTH0E00814g       RNIGCTCYVNSMLQCLFATKAFRDLFLST-KYEHYFSRKYTNP------NQLSKYFNVLF
Kwal_55.19645      RNMGNTCYINSMLQCLFATRKFRDLFLSP-KYEDYFSKRYSNP------HQLSKYFNILF
TBLA0E01760        RNLGNTCYINSMLQCLFATTEFRNIFLSH-KYEKYMDHDIPTN------QRLSKSFNMLF
KLLA0A00396g       RNMGNTCYINSMLQCLFGCSQFRDLFLGG-KYHRYLNPKRSNT-------IISKWFSLLF
AFR296C            RNMSNTCYINSMLQCLFSTTEFRNLFLSN-KYSRYLKSSNMDN--------MSRSFYMLF
SAKL0E15136g       RNLGSTCYINSMLQCLFATRKFRDIFLSP-KYHDYISKGYIHR------AQISRSFHMLF
CAGL0H06721g       RNLGNTCYINCMLQSLFATNELKNLFISG-KYREYQMKPNDNK-----ESAISNTFANLF
Suva_9.30          RNLGNTCYINSMIQCLFAAKVFRTLFISS-KYKSYLQQSRGNR---LHSPRLSNSLNMLF
Skud_9.12          RNLGNTCYINSMIQCLFAAKIFRTLFISA-NYKNYLQPPKGSRSAH--SSKLSNSLNMLF
Smik_9.13          RNLGNTCYINSMIQCLFAAKTFRTLFISS-NYKNYLEPLASNRPHH--SPKLSNSLSMLF
YIL156W            RNLGNTCYINSMIQCLFAAKTFRTLFISS-KYKSYLQPIRSNGSHY--SPKLSNSLSMLF
KNAG0L02200        RNLGNTCYINSMIQCLFATKSFRNLFISM-KYKEFLKEVAPKPGANGSQPVISRTFYILF
TPHA0D04660        RNLGNTCYISSMLQCLFATTTLRDLFITT-KYESYINHKVTDK------INLSRSFSILF
TDEL0B02080        RNLGNTCYINSMLQCLFATTKFRDLFVSG-KFEEFFNQNYSNR------PQLSKSFNILF
NCAS0G00170        RNLGNTCYINSMLQCLFATRRFRDLFLTS-KYSSFLNGSKFPN-----SPMISNSFNLLF
NDAI0F00200        RNLGNTCYINSMLQCLFATRLFRDLFISS-KFQSFINDSKFPN-----TPKISNSFNLLF
Kpol_2001.78       -----------MVQCLFGTKLLRDLFISS-KYEKYLSKRIDRS------SNLSRSFSILF
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN
KAFR0D02160        RKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVS
Suva_11.335        KKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILARIHEEL--SNNNVTK
Skud_11.338        KKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIHEEL--SNENVTK
Smik_11.362        KKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL--SNGTVTE
YKR098C            KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL--SNENVVK
Ecym_4009          RKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKLHDEL-SSIESVSN
ZYRO0B16544g       RKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL-SNQTEVLN
KLTH0E00814g       KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL-SESNRVAN
Kwal_55.19645      KKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDEL-SESNHVAN
TBLA0E01760        KKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLILDRLHDEL-SNQHEVKL
KLLA0A00396g       RKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDEL-SEPTKVAN
AFR296C            KKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRLRDEL-SYLAAVVN
SAKL0E15136g       KKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQLHDEL-SDPEQVAN
CAGL0H06721g       NKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDEL-SNQVNVIN
Suva_9.30          DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SNQPHVAN
Skud_9.12          NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SNQQHVAN
Smik_9.13          NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SNQQHVAN
YIL156W            NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SDQQHVAN
KNAG0L02200        KKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL-SNQDAVVN
TPHA0D04660        RKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLHDEL-SKEDTVLN
TDEL0B02080        RKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRLHDEL-SNQAAVAN
NCAS0G00170        KKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRLHDEL-SNQQEVVN
NDAI0F00200        KKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL-SNQQEVVN
Kpol_2001.78       KKMYLNGGCSVVPTSFLKTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDEL-SNQETVGI
                                                                               

Kpol_304.6         ------------------------------------IDSTLEGPNQNDTILASSKVDYSS
KAFR0H00150        NY----VSDDINLG----KEYMPWLQNNLKANGKSPIDLIFQG--QIENCLQCQRCGNTS
KAFR0D02160        EHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQG--QLENSLECQRCNYTS
Suva_11.335        YYSDLILNDATALQVNP-SKYQKWCEETVLSDGLSPIDHIFQG--QMENILKCQRCGNSS
Skud_11.338        YYCDLVSYDTNALQVNP-IKYQKWYEETILADGLSPIDHIFRG--QMENILKCQRCGNSS
Smik_11.362        YYPDLVSYDANAFQVNP-SKYQKWYEGSVLTDGLSPIDYIFRG--QMENILKCQRCGNSS
YKR098C            YYPDLVSYDANALQVNP-SKYEKWYERNVITDGLSPIDHIYRG--QLENILKCQRCGNSS
Ecym_4009          DYSHLLLHDNVRLYVDD-AQYNKWFDQNIDQNGLSPIDDLFQG--QMENQLSCQRCGYSS
ZYRO0B16544g       AHPELLLYDAETSKVQK-EEYKQWFENSLINTKFSPIDKIFQG--QLENGLHCKKCGYSS
KLTH0E00814g       DYPGLLLHDDKKLDVDQ-KEYDTWFEKHISENGISPIDNIFQG--QMENGLFCQRCGHSS
Kwal_55.19645      DYPNLLLHDDESLAVDQ-KEYDKWFESNISENGISPIDAIFQG--QMENGLLCQRCGHSS
TBLA0E01760        DYPDLVDYDVDDMEVQP-GQYIKWYNESVKSNGLSPIDHVFQG--QTEDGLVCQRCGCSS
KLLA0A00396g       DYPNLLLHDDEKLLVDN-KEYDKWFDEGLKNNGLSPIDDIFQG--QMENSLKCQRCGFTS
AFR296C            DYPQLLLHESSVLKVND-KEYTTWFDQNFEKNGLSPIDSIFQG--QIEHQLSCQRCDFSS
SAKL0E15136g       DYPQLLLHDDDNLQVDG-KEYDKWFEDSISKNGLSPIDSIFQG--QMENCLQCQRCGHSS
CAGL0H06721g       DYPNLLLYDDDKMMVDK-EKYKKWFDKTVVANGLSPVDGVFQG--QMENALQCQRCGYES
Suva_9.30          DYPNLLLYDADGLKVSN-KEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
Skud_9.12          DYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
Smik_9.13          DYPNLLLYNADVLKVSN-NEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
YIL156W            DYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
KNAG0L02200        EYPDLILYDEKKLNVQN-KEYKKWFDKSVIGNGLSPIDDIFQG--QMENSLHCQRCGHSS
TPHA0D04660        DYSNLLLYDAERMHVKV-DQYKKWFENSNLSGGVSPIDDIFQG--QIENSINCQRCGYSS
TDEL0B02080        EYPDLLLYDEHQMDVNG-KEYKKWFEESVIGNGLAPIDHIFQG--QIENILECQRCGNSS
NCAS0G00170        EYPSLMLYDTNHLRVQH-EEYKHWFEKSVIGNGLSPIDEIFQG--QIENGLQCQRCGHSS
NDAI0F00200        EYPNLLLYDENNLKVQN-KEYKHWFDKNVIGNGLSPIDHIFSG--QMENSLQCQRCGNSS
Kpol_2001.78       DYPDLVLYDTRKLRVNN-KEYSKWFDKTIFANGLSPIDHIFQG--QIENTLTCQRCGFVS
                                                       :     *  * :  : ... .  :

Kpol_304.6         SN----------------------------------------------------------
KAFR0H00150        YNYSMFYMLSLAIP-------KIAKENSK-NRVKLEDCINFFTSDEILTGENAWNCPKCC
KAFR0D02160        TNYSNFCTLSLSIP--------NKRRKFR-KLVDLEDCISLFIENEMLTGENAWNCPKCS
Suva_11.335        YSYSTFYVLSLAIP----KASLYSFTSKS-KKIKLEDCINFFTSDEELSDDNAWDCPKCR
Skud_11.338        FSYSTFYVLSLAIP----KNSVHSFTSKS-KKIKLEDCINLFTSDEELTGDNAWDCPECR
Smik_11.362        HSYSTFYVLSLAIP----KISLYSFTSKS-KKIKLEDCINLFTSDEELSGDNSWDCPNCG
YKR098C            YSYSTFYVLSLAIP----KLSLYSFTSKS-RKIKLEDCINLFTGDEELSGDNAWDCPNCR
Ecym_4009          YTYSTFYVLSLALP----NPVAKAFGKTK-K-LRLEDCINFFTCDEVLSDQNAWDCPRCC
ZYRO0B16544g       YSYSTFYILSLAIP----KPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCG
KLTH0E00814g       FNYSVFYVLSLAIP-----SSTSTFSQRK-K-VRLEDCINLFTSDEQLTNENAWDCPKCG
Kwal_55.19645      YNYSMFYVLSLAIP-----ASMSSFGQKK-K-MRLEDCINLFTSDEKLTNENAWDCPKCG
TBLA0E01760        FTYSTFYILSLAIP----KASTNAFGKIK-R-VNLEDCIKMFTNDEILSDENAWDCPRCG
KLLA0A00396g       YNYSTFYVLSLAIPA---MPPPKTFSRSK-KIIRLEDCINLYTQDELLTGENAWDCPKCG
AFR296C            YSYSTFYVLSLALP----NPGSKAFGKAK-K-LRLEDCINFFTCDEVLTGQNPWDCPKCG
SAKL0E15136g       YNYSTFYVLSLAIP----TPGTSTFGKTK-K-VLLEDCINLFTSDEVLSGENAWDCPRCG
CAGL0H06721g       VNYSTFYVLSLALP----KPSAPAFYKSG-R-VKLEDCINMFTSDEVLTGENAWDCPKCG
Suva_9.30          FNYSTFYVLSLAIPRRSMKLSKLGRPNEK-R-VKLEDCINMFTSDEVLSGENAWDCPRCG
Skud_9.12          FNYSTFYVLSLAIPRRSMKLSKLGRSTEK-R-VKLEDCINMFTDDEVLSGENAWDCPRCG
Smik_9.13          FNYSTFYVLSLAIPTRSMKLSKLGRSTEK-R-VKLEDCINMFTSDEVLSGENAWDCPRCG
YIL156W            FNYSTFYVLSLAIPRRSMKLSKLGRSTEK-R-VKLEDCINMFTSDEVLSGENAWDCPRCG
KNAG0L02200        FNYSTFYVLSLAIP----KATSSTFSRSK-R-VSLEECLNMYTSDEVLSGENAWDCPNCC
TPHA0D04660        FNYSSFYVLSLAIP----KISVMSFSRTN-R-VKLEDCINMFTRDEVLSGENAWDCSRCG
TDEL0B02080        FSYSTFYVLSLAIP----KPSTSTFSRAK-R-VKLEDCINMFTNDEILSGENAWDCPKCG
NCAS0G00170        FNYSTFYVLSLAIP----KPSPTGFSRSK-R-VKLEDCINMFTNDEMLSGENAWDCPNCG
NDAI0F00200        YNYSTFYVLSLAIP----KPSSTTFSRSK-R-VKLEECINMFTSDEVLSGENAWDCPKCG
Kpol_2001.78       YNYSTFYVLSLAIP----KPSSGTFSRSK-R-VKLEDCINMFTNDEVLSGENAWDCSNCG
                    .                                                          

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        PTT-----IETYDEADSPATVE-----NRVKNKSINPL--------------NFFKLHKV
KAFR0D02160        SSS--------------------------------NNNTSKRKSR-------GFFKFSKH
Suva_11.335        TAE----------------------------YKLKKDENLSQKKRS------ILFNLHSR
Skud_11.338        IDD----------------------------SKLKTGENSSQKKRS------PLFSFHSR
Smik_11.362        TTD----------------------------LKTKINESTSQKKKS------TFFSFHSR
YKR098C            ITD----------------------------SKSKKEEITSQKKKS------TIFGFHSR
Ecym_4009          SPS----------DYMSYDHKG-----KRKISTSFESLNGGNSSRS------KLFKFGYK
ZYRO0B16544g       VTVQKEKSESNQRHNKQSSSSGSTASPEPRKAKKKDEEGSSLKSKT------KFLLFPRK
KLTH0E00814g       TSA-----------SGTGPEEE-----KKKKRFLLNPDTRASGNRS------RFFKLRSK
Kwal_55.19645      SAV-----------SGNGPDGD-----KKKRKFLSTSDNSNGRSRS------RFFKLRSK
TBLA0E01760        SAA-----------PKQEPIHR-----HREKKHIHDISPPPRSPSSPEPRSKRFFLLNAP
KLLA0A00396g       THS------NSSDGSMNSDETV-----DKKKKKNFLSVNGDHKSRS------KFFKLSSS
AFR296C            VNS---------SGDRQMNSEK-----SKRKNKFFMGSENANSANSNRDHLPRLFKIGSK
SAKL0E15136g       TSM---------SGSGPGEGKA-----KKKRKFLLPHDHVNNNRTS------RFFKFRSK
CAGL0H06721g       SKA-------------VEPRFT-----SRTSTQTILPNSPHHHKKS------KFFGLPTG
Suva_9.30          PTA-STSLSASASALENDSNIV-----KSRKKKSRFFTLHTRSKRR------HLDFFGDS
Skud_9.12          PTASSSSASASASAFESESPIA-----KSKKKKSRFFTLHTGSKRR------HLDFFGDN
Smik_9.13          PTA-SFTASASASALENESSIL-----KSKKKKSRFFTLHTGSKRR------HLDIFGDS
YIL156W            PTA---SVSTSVSALENEPSIV-----KSKKKKSRFFTLHTGTKRR------HLDFFGDG
KNAG0L02200        KIT------KDYKGMVEKTKRN-----KAARDTLSPGSSSSSSKKG------KLFSFSLH
TPHA0D04660        SQS---------DNFVKTSHND-----HHKEHTSETTDDSKQNRKS------RLFLLPKK
TDEL0B02080        SAV-----------TDMGPNHL-----KKSKKKKKSELGEERRSKS------GFFRIHSK
NCAS0G00170        SNA-------------QDRVRV-----NTDQSVKKKRQGEEHRHKS------RFFGLPTR
NDAI0F00200        SSA-----------SSTISDSEKLLNVTSSKKKNMSSHNEHHRYKS------KFFTLHTR
Kpol_2001.78       SSS--------------VHNVE-----QRKDKTTGNGEEKKRSRKS------RLFLLPNI
                                                                               

Kpol_304.6         ------------------------------------------------------------
KAFR0H00150        L----------------SPSSGNHHRHHHHHH--------HHKSDGKNK-----------
KAFR0D02160        K--------------NRSHNDLTFSEYNHNSS--------SDD-----------------
Suva_11.335        P-----------------RSKSPRHRHHHHHH--------RHKNDDAKKNDDATKNS---
Skud_11.338        S-----------------RSKSPHHHHHYHHH--------GSDNTTKNS-----------
Smik_11.362        S-----------------RSKSPHHHHHHHHH--------SHDNTEKHS-----------
YKR098C            S-----------------RSKSPHHHHHHHHS--------SDDSTKNA------------
Ecym_4009          M---------------RSRSEAP--KFSSKLS----------------------------
ZYRO0B16544g       R------------KSSSSKSLSPFNLLNSSSS--------SSNTNNNSSSNSG-------
KLTH0E00814g       S---------------RSRSVSPFRKQSSQQQ--------NL------------------
Kwal_55.19645      S---------------RSRSVSPFHKPSSQSP--------AS------------------
TBLA0E01760        R--------------EVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQN
KLLA0A00396g       R--------------SGKRSLSPFKSNSVKPE--------KLHI----------------
AFR296C            S---------------RSRSSSPFISGPKSSG--------KTHE----------------
SAKL0E15136g       S---------------RSRSSSPFNSSNGHNS--------GSSMPGS-------------
CAGL0H06721g       K--------------AISRSKSPFRKLGLLEK--------HEGKQEKLDKMERDEI----
Suva_9.30          SNE---STSNNPVHFERERSRSPFKMLGGGGK--------RSHSNTPFANSSNDGNNF--
Skud_9.12          INE---SNSSNTVTFERERSRSPFKMLGSSGK--------RSNSSTPFANNNNDGNNI--
Smik_9.13          N--GEGNNINNTMIFERERSRSPFKMLGGSGK--------RSSSSTPFANGGNDSNNT--
YIL156W            ITEGHNSNNNNTTIFERERSRSPFRMLGGSGK--------RSSSSTPFSTGGNDSNNS--
KNAG0L02200        HRHHHRSELGELNVSKINRSLSPFRVLGGSSS--------KSVRKSEDSHSRADVDAQRD
TPHA0D04660        Y-------------NPTSRSLSPFGRHSSHKS----------------S-----------
TDEL0B02080        S----------------KRSKSPFRMLGSTKF--------PLAM----------------
NCAS0G00170        P----------------HRSLSPFRKSGSSST--------NSTSKIKHE-----------
NDAI0F00200        S----------------HRSISPFRKKTSPAA--------VPSSTKN-------------
Kpol_2001.78       N-------------GRSSRSISPFRKSASPRP--------PH------------------
                                                                               

Kpol_304.6         ----------------------------NFI-----------------------------
KAFR0H00150        -----------NKY---KNEKLITLKQLNFIKLPPILVIHLSRF-YYNSTKKNNAVITYP
KAFR0D02160        -----------VKF---SKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYP
Suva_11.335        -----------KKW---KSKKLTTIKSLDFIVLPPILVIHLSRF-YYDLTKKNNTVITYP
Skud_11.338        -----------NKW---KSKRLTTIKSLDFIFLPPILVIHLSRF-YYDLTKKNNAVITYP
Smik_11.362        -----------KKW---NSRKLTTVKSSDFIVLPPILVIHLSRF-YYDLTRKNNTVITYP
YKR098C            -----------KKR---NSKKLTTIKSLDFIVLPPILVIHLSRF-YYDLTKKNSTVITYP
Ecym_4009          -----------DKV---SNGKPATVKSLNFITMPRILVIHLSRF-IYDLTKKNNIVVSYP
ZYRO0B16544g       -----------------SKKNSFSIRATNFVTLPPVLVIHLSRF-YYDLTKKNETVITYP
KLTH0E00814g       -----------EKL---KSKKLTTIKTLNFISLPTVLTIHLSRF-FYDLTKKNNKVITYP
Kwal_55.19645      -----------EKW---KSKKLSTIKTLNFVSLPSVLTIHLSRF-LYDLTNKNNKVITYP
TBLA0E01760        HTTPNGRAGRVRHY----SGKMVTIKSVNFVKAPRILVIHLSRF-YYDLTKKNNTVITYP
KLLA0A00396g       -----------------KSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINYP
AFR296C            -----------KRY----NKKLATIKSLNFITLPRILIIHLSRF-VYDLTKKNNTVVTYP
SAKL0E15136g       -----------EKW---KSKKLTTIKTFNFITMPPILVIHLSRF-FYDLTKKNSTVITYP
CAGL0H06721g       -----------EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRF-YYDLTKKNDAVVSYP
Suva_9.30          -----------NDF---KNKKLTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITYP
Skud_9.12          -----------NDF---KNKKLTTVKTINFVTLPKILVIHLSRF-YYDLTKKNSTVITYP
Smik_9.13          -----------GDF---KNKKMTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITYP
YIL156W            -----------SDY---KNKKLTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVVTYP
KNAG0L02200        IDELREMKEEMKQW---KSKKLFTIKTLNFIRMPRTLIIHLSRF-YYDLTKKNSTIVTYP
TPHA0D04660        -----------EKW---KSKKMETIKSLNFIKMPKILVIHLSRF-FYDMSKKNETVVAYP
TDEL0B02080        -----------EDW---KSKELSTKKTLNFIFLPPVLIIHLSRF-YYDLTKKNDTIVTYP
NCAS0G00170        -----------QQW---KTKKLITIKTLNFIMLPPVLVIHLSRF-FYDLTKKNKTVITYP
NDAI0F00200        -----------EPW---KSKKLITIKTLNFIVLPPILVIHLSRF-YYDLTKKNNTVITYP
Kpol_2001.78       -----------EKL---KHKKLVTIKSMNFISLPPTLVIHLSRF-YYDLSKKNETIVTYP
                                               .*:                             

Kpol_304.6         -----------RTENYQV--------NLLPNGPTK-------------------------
KAFR0H00150        LILNIIMKNNIDVVKYKLYGLINHQGGLT-KGHYTSIVNKDLNHSLDLNEQQWYNFDDEV
KAFR0D02160        AILTITLKNK-EKCRFKLYGVVNHFGNLN-NGHYTSLINKEPSHDLNPQRQKWFYFDDET
Suva_11.335        LILNIILKNN-KVVRYKLYATVNHSGNLI-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDV
Skud_11.338        LILNIILKNN-KVVRYKLYGTVNHSGNLI-TGHYTSVVNKERSHEIGLNKQVWVTFDDDF
Smik_11.362        LILNVILKNN-KVVRYKLYGTVNHIGNLV-NGHYTSDVNKEKNHEIGLNRQVWITFDDDY
YKR098C            LILNIILKNG-KVIRYKLYGTVNHSGNLI-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDY
Ecym_4009          LILNIVLKNS-EVAKFRLYSIVNHFGTLI-SGHYTSLVNKELNHEISHGKQKWYYFDDEI
ZYRO0B16544g       LILNIVLKNN-ETLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEV
KLTH0E00814g       LILSIVLKNE-QIMKYRLYAIANHFGNLI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDET
Kwal_55.19645      LTLSIVLKNN-EVVNYRLYAIANHFGNLI-SGHYTSLVNKDLSHDLGNGRQKWYYFDDEV
TBLA0E01760        LHLNISLKNG-EVARYKLYGLVNHTGTLV-SGHYTSLVNKDTDHELGSEKQKWFYFDDEI
KLLA0A00396g       LILDVVLKNN-EIARYRLYGIINHFGNLV-SGHYTSLVNKHLSHEIRKGQQKWYYFDDEV
AFR296C            LILNIVLKNN-EVAKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEI
SAKL0E15136g       LILNIVLKNN-EVAKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDEV
CAGL0H06721g       LVLNIVLKNE-EIVRYKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQKWYYFDDEV
Suva_9.30          LILNIILKNN-DTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDDEV
Skud_9.12          LILNIILKNN-ETMKYRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEV
Smik_9.13          LILNIILKNN-DTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEV
YIL156W            LILNIILKNN-DTMKYKLFGVVNHTGTLI-SGHYTSLVNKDLEHNVNIGRSKWYYFDDEV
KNAG0L02200        LILNIVLKSN-EVVKYKLYGVVNHTGNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDEV
TPHA0D04660        LILNIVLKNE-EVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEV
TDEL0B02080        LVLNIILKNN-ETARYRLYAVVNHTGNLI-SGHYTSLVNKEPMHKLDKGRQKWYYFDDEV
NCAS0G00170        LILNIVLKNN-EVAKYKLYGIVNHTGNLI-SGHYTSLVNKEPGHNLNHNQQRWYYFDDEV
NDAI0F00200        LILNIVLKNN-EVAKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDET
Kpol_2001.78       LILNIVLNNN-ETAKYRLYGIVNHTGNLI-SGHYTTLVNKEKNHELKKDKQKWYYFDDEV
                                 .:.:            .*  .                         

Kpol_304.6         ----------------------------------------------
KAFR0H00150        IKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE---------
KAFR0D02160        VKQ-----QFNY-FDLDKNVNRISSSDVYVLFYEKIIE--------
Suva_11.335        IKQ-----HHKDRDDFETGRTEISSNEVYVLFYERVDEEDYEEECC
Skud_11.338        IIQ-----HHKDRDGFEAGKTKMSSSEVYVLFYERMDEEDYKEDCC
Smik_11.362        IKQ------HHH-DDFEAGKTEVSSSEVYVLFYERMDESEYKEECF
YKR098C            IQQ-----HRKDRNNFEAGKTEMSSDEVYVLFYERMDEENYEEEFC
Ecym_4009          VKF-----DTNH-GDYDNGIASVSSSNVYVLFYERIFD--------
ZYRO0B16544g       VKH-----ETSH-GNLSQGVNKVSSKDVYVLFYERID---------
KLTH0E00814g       VKK-----DINH-GDIDAGITSISSSDVYVLFYEKIDESQ------
Kwal_55.19645      AKR-----DLNH-GNIDAGITSVSSSDVYVLFYEKI----------
TBLA0E01760        VKE-----EKNH-GDIEGGVTSISSSHVYVLFYQRIK---------
KLLA0A00396g       VKK-----EFNH-GDFDRGITSISSGDVYVLFYERIHSI-------
AFR296C            VKL-----DPNH-GNYDRGITSVSSSDVYLLFYERIS---------
SAKL0E15136g       VKQ-----DNNH-GDFDAGIASVSSSDVYVLFYERIYD--------
CAGL0H06721g       VKA-----EKTH-GNVDKGITKVSSKNVYVLFYERVD---------
Suva_9.30          VKA-----DKKH-GSDKS--LKISSSDAYVLFYERVHD--------
Skud_9.12          VKA-----DNKH-GSDKN--LKISSSDVYVLFYERVHDQ-------
Smik_9.13          VKA-----DKKH-GSDKN--LKISSSDVYVLFYERVYD--------
YIL156W            VKA-----DRKH-GSDKN--LKISSSDVYVLFYERVYD--------
KNAG0L02200        VKR-----ETRH-GDVKHGVMKISSSDVYVLFYERI----------
TPHA0D04660        VKH-----ELNH-GNIDEGVNKVSSSHVYVLFYEKID---------
TDEL0B02080        VKE-----ETKH-GNIDQGILKVSSSDVYVLFYERLD---------
NCAS0G00170        VKA-----EGNH-GDIDNGISKVSSKDVYVLFYERLYE--------
NDAI0F00200        VKE-----ERNH-GDMDKGILQVSSRDVYVLFYERIYE--------
Kpol_2001.78       VKE-----ENNH-GNIDEGVIKVSSSQVYVLFYERVYN--------
                                                                 

FASTA FORMAT for MUSCLE Version 3.6

>Kpol_304.6
-----------MVIQTDFSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEH
TAYLLEAFHHFLPSG-RYDDALSAYIVGCYYLYLIIPQSTQF--QTKNKSYSMYNDWKIL
YQNEANMTNVCSMVRNEVDSILDK--SYQEPEPTKRV--------------------IPR
GRAFSVKDDT------------------------------------------PKDYNTIE
FPIRERKSS-------------TTQRPLSMAKPYDSLP----------------------
----------------MELDDSTPLWTAPSLNPNDQLKLALE------------------
------------------------------------------------------------
-------------------------------------------------------QPELT
LDEQLSDKTQHNLIDDKYNNFTIPLPHQIPLPVKVTDF----------------------
NHDKKIQKI--Y----------------------------------------PVDRSETH
RKDSYHSVYMDNDNSAGYVRKND---EANNYIQTLERLQKQNVITCPELFSILSDPTTKD
DILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKIL-N---DQLFN
IRKSFAYVVYYTDLKTYMKIN-FDYNFTLFYLLTSSRT-SVLKTFPTSLLGGLEKWKKVI
RTYYHENGINALNYLHK------------------------------FHVHNIDQKEGDR
SNIGV-----EHYFWNAPEIPMRIRQRPPPPIPST-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------IIHP---------------
-----PLPPKIGL-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------IDSTLEGPNQNDTILASSKVDYSS
SN----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------NFI-----------------------------
-----------RTENYQV--------NLLPNGPTK-------------------------
----------------------------------------------
>KAFR0H00150
MASLSSDKMNLEDSSLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDH
TTYLLDLFKVYTSHKSRKRQATLAFVNGSFYLFLIIPYCVQF--QTKNKLFTRYKDLKID
YEGQISMKNILDTVKEKSVSILEQ-----DLSGINRR--------------------ILK
KRAYTEPSIR--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------SGLSRDRSSTSV----------------
--------LSRKPTLSHV------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------PSNPQRTLSTPKRSSTLM-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------TESLSFVLARPAE
IKKHT------------------------------------VPIIDATDNIPKMLSLVGL
RNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETK--------ISEPFARLL
LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN
NY----VSDDINLG----KEYMPWLQNNLKANGKSPIDLIFQG--QIENCLQCQRCGNTS
YNYSMFYMLSLAIP-------KIAKENSK-NRVKLEDCINFFTSDEILTGENAWNCPKCC
PTT-----IETYDEADSPATVE-----NRVKNKSINPL--------------NFFKLHKV
L----------------SPSSGNHHRHHHHHH--------HHKSDGKNK-----------
-----------NKY---KNEKLITLKQLNFIKLPPILVIHLSRF-YYNSTKKNNAVITYP
LILNIIMKNNIDVVKYKLYGLINHQGGLT-KGHYTSIVNKDLNHSLDLNEQQWYNFDDEV
IKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE---------
>KAFR0D02160
--------------MESISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEY
TEQLFEYFLK------GNTDSLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKY
YESQPNLSDLLFIIRSESENILQS------------------------------------
---FDVDAPS--------------------------------------------------
----------------------------SHSQHEEDNT----------------------
------------------ADSSTTIWQAPFLEPNDQLKLAIIS-----------------
------------------------------------------------------------
---------------------------------------------------SESELESET
EVEAEIDINANESKYTNF------------------------------------------
INDKTINDE---------------------------------------------------
--DTY-----------------------------LKHLYEECFITPHELFSILSNPSDRL
KILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSLFS-------NPLFQ
KIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSSSM----KVTPNFLLGGFEKWEQLI
SSYSEQYGIETSNYIFT-------------------------------------------
----NNKRFTEPPSWNPPPVPHEIRKRPPPPPPPN-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------LPSRTY-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------STRHTQGYREQQQ
QQQQHHHNHRPK-------------------RIVTRYTKYGLPHLPHSSNLYVQLSISGL
RNLGNTCYINSMLQCLFATTAFRNLFLSN-RYKEYIGTKVDPH--------LSNSFHILF
RKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVS
EHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQG--QLENSLECQRCNYTS
TNYSNFCTLSLSIP--------NKRRKFR-KLVDLEDCISLFIENEMLTGENAWNCPKCS
SSS--------------------------------NNNTSKRKSR-------GFFKFSKH
K--------------NRSHNDLTFSEYNHNSS--------SDD-----------------
-----------VKF---SKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYP
AILTITLKNK-EKCRFKLYGVVNHFGNLN-NGHYTSLINKEPSHDLNPQRQKWFYFDDET
VKQ-----QFNY-FDLDKNVNRISSSDVYVLFYEKIIE--------
>Suva_11.335
-------------------MFLNP---NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEH
AAYLFDVYVRDLKNN-QKKNALTAFIVGGFYLYLVIPHSLQF--QTRNNVYSSYAKLKNK
YQDEQGMSYVLKLVKDESTIIVDQ--CLSDSKRISRS--------------------MKR
KRAYSLPLRP-----------------------------------------LPVHMASLS
IH----------------------------------------------------------
------------------NQLDVPLREMPI------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
EISKPINDT---------------------------------------------------
------------------------------LVKGLAK--EENELKFSNELEEGTDTEGRD
STSTEPLSIP--------------------------------------------------
---------------SYLRLD---------------------------------------
---------TGKDSLFK-------------------------------------------
-------------TLSSPAAAASTRDSLDVLLQFE-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------EPSQDSSSILKSK
EQEEEETVSAST------------------------SKTFKLPVIENSDNLLSELSITGL
RNPCNTCYINSMVQCLFSTTLFRDLFLTK-KYKLFLENEKYPK-----GLQLSHSIYVLF
KKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILARIHEEL--SNNNVTK
YYSDLILNDATALQVNP-SKYQKWCEETVLSDGLSPIDHIFQG--QMENILKCQRCGNSS
YSYSTFYVLSLAIP----KASLYSFTSKS-KKIKLEDCINFFTSDEELSDDNAWDCPKCR
TAE----------------------------YKLKKDENLSQKKRS------ILFNLHSR
P-----------------RSKSPRHRHHHHHH--------RHKNDDAKKNDDATKNS---
-----------KKW---KSKKLTTIKSLDFIVLPPILVIHLSRF-YYDLTKKNNTVITYP
LILNIILKNN-KVVRYKLYATVNHSGNLI-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDV
IKQ-----HHKDRDDFETGRTEISSNEVYVLFYERVDEEDYEEECC
>Skud_11.338
-------------------MLLNP---DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDH
TSHLFDVYLRDLEIN-REVEALTAFIIGGYYLYLIIPQSLQF--QTRSNLYSSYAKLKNS
YQDEQLMSYVLRLVRDESTSIVDQ--YLSDSNRITVT--------------------ITR
KRAYSLPLRP-----------------------------------------LPVHMASLS
IH----------------------------------------------------------
------------------NQSDDPPREMPN------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
YLAKPINDT----------------------------------------------SGKDL
RRE-----------------------------NNEIRLCSKHDVSAEDI-----DSTSRE
SL----------------------------------------------------------
------------SIPSYSKLN---------------------------------------
---------TGKDTLFK-------------------------------------------
-------------THSSPAAASTAHSCDTSSQAAV-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------SSQDSSSQSKKAK
QKEEAASSFISE--------------------------TFEPPTIEDSKGLLSKLSITGL
QNPCNTCYINSIIQCLFGSTPFRDLFLTK-KYRLFLKTEEYPK-----EVQLSRSIYSLF
KKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIHEEL--SNENVTK
YYCDLVSYDTNALQVNP-IKYQKWYEETILADGLSPIDHIFRG--QMENILKCQRCGNSS
FSYSTFYVLSLAIP----KNSVHSFTSKS-KKIKLEDCINLFTSDEELTGDNAWDCPECR
IDD----------------------------SKLKTGENSSQKKRS------PLFSFHSR
S-----------------RSKSPHHHHHYHHH--------GSDNTTKNS-----------
-----------NKW---KSKRLTTIKSLDFIFLPPILVIHLSRF-YYDLTKKNNAVITYP
LILNIILKNN-KVVRYKLYGTVNHSGNLI-TGHYTSVVNKERSHEIGLNKQVWVTFDDDF
IIQ-----HHKDRDGFEAGKTKMSSSEVYVLFYERMDEEDYKEDCC
>Smik_11.362
-------------------MLLNP---DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDH
AAHLFEVYLRDSEIN-QEMEALTAFIIGGYYLYLVIPQSLQF--QTRNNLYSSYAKLKND
YQDEQIMSYVLKIVKEESNMIVDR--YLSDSNRISRT--------------------ITR
KRAYSLPLRP-----------------------------------------LPVHMASLS
IL----------------------------------------------------------
------------------NQLENPRHETPKVSAKS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
INDTSVKDI-------------------------------------------PGERNQAH
------------------------------------------------------------
--------FSKKLGADSESTENTSKV----------------------------------
----------FLSMPSYSKLN---------------------------------------
---------TGKDFLFK-------------------------------------------
----TLSSPATAPTVHSFEVSSQVEDSTEDLSSIS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----KVEKQ--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------KEEEEKEDIDKER
EKKTVRSSALNK-----------------------------LPTIEDSTSLLSQLSITGL
QNPCNTCYINSIIQCLFGTTLFRDLFLTK-KYRLFLQTDKYPR-----EVQLSRSIYVLF
KKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL--SNGTVTE
YYPDLVSYDANAFQVNP-SKYQKWYEGSVLTDGLSPIDYIFRG--QMENILKCQRCGNSS
HSYSTFYVLSLAIP----KISLYSFTSKS-KKIKLEDCINLFTSDEELSGDNSWDCPNCG
TTD----------------------------LKTKINESTSQKKKS------TFFSFHSR
S-----------------RSKSPHHHHHHHHH--------SHDNTEKHS-----------
-----------KKW---NSRKLTTVKSSDFIVLPPILVIHLSRF-YYDLTRKNNTVITYP
LILNVILKNN-KVVRYKLYGTVNHIGNLV-NGHYTSDVNKEKNHEIGLNRQVWITFDDDY
IKQ------HHH-DDFEAGKTEVSSSEVYVLFYERMDESEYKEECF
>YKR098C
-------------------MLLNP---DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDH
AAHLFNVYLRDLEIN-QEMEALTAFIIGCYYLYLIIPQSLQF--QTRNNLYSSYAKLKND
YQDEHVMGYVLKVVRDESTVIVDR--YLAESNGICRT--------------------IKR
KRAYSLPLRP-----------------------------------------LPVHMASLS
IH----------------------------------------------------------
------------------NKFDGSLHEIPN------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
ELTKPTNDN---------------------------------------------------
--------------------------------------SKEDIVR---------------
-------------ESNQIASSNKLEAGSE-------------------------------
-------VAYYTSKEALSKPS---------YLKLSTGK----------------------
------------DALFK-------------------------------------------
----TLSSPATAPPVHSLEVSSQIRDSSQDSSSSL-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------SKVEKPKEEEGK
IEAIESSAP----------------------------KAYNLPVIEDSNDLLSELSITGL
QNPCNTCYINSIIQCLFGTTLFRDLFLTK-KYRLFLNTNKYPK-----EVQLSRSIYVLF
KKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEEL--SNENVVK
YYPDLVSYDANALQVNP-SKYEKWYERNVITDGLSPIDHIYRG--QLENILKCQRCGNSS
YSYSTFYVLSLAIP----KLSLYSFTSKS-RKIKLEDCINLFTGDEELSGDNAWDCPNCR
ITD----------------------------SKSKKEEITSQKKKS------TIFGFHSR
S-----------------RSKSPHHHHHHHHS--------SDDSTKNA------------
-----------KKR---NSKKLTTIKSLDFIVLPPILVIHLSRF-YYDLTKKNSTVITYP
LILNIILKNG-KVIRYKLYGTVNHSGNLI-NGHYTSVVNKEKSHEIGLNRQVWVTFDDDY
IQQ-----HRKDRNNFEAGKTEMSSDEVYVLFYERMDEENYEEEFC
>Ecym_4009
-----------------MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEH
GAYLLESYRELLGRG-QVEAGITAYVVGAFYLYLIIPQSIEF--HTRNLSYSIYVDLKRH
YESDPNMMNVMLLVAAKVGSVMQLYLSGEGDEKYGARF-------------------TGR
KRAYSMQSCD--------------------------------------SSKLADTLGKLS
IERSSTRGT-------------TVFEGKTEQGAFGQQQ----------------------
----------------QDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHD---------
-------------------T----------------------------------------
---------------------------------------------------SDSKTKDSG
LENNSAAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNN---------------------
DELPSIGDH-ND----------------------------------------VLDRFYTH
GQDLRYPICNDGVVPCEN--------------SSIMWLYESSSIKCLDLLSKLTS-SERS
SMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVI-D---NHLFR
SRRQFATIVCYTDNYTYMQID-FDFVFLLFRLLYLGRP----QLVLKTLSGGYEQWKSFL
KELKRTESIILSDFLWKRPHKNEHSNDIVIASGEPSDSNNSKSFPPSLVENSIPAFQSDH
KPIAQQSSVGIEPIHRFSSVSTYSKPVVPPPIPVTRPLLNPATNPLSQYCSQMLVNAVKP
PSTNENSVSQSHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD
AKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSV
SQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATPESNLSATPD
ANSASQSNLSNTPDAKSVSHVSITTTTVPMVLPPIPVTRPLIPPPFENNRADSSLSSTRE
TNETVPLPLQTVRNSGSIPFYPVVQDNKPTLSAIFSDEKLTSQSIVNHDDDDGTSSKSVS
SSHKGIMPVKTVEHDCDTSPLPNLLPKIPKIVSSVENINSGLSQFVSASSSRPVSSHNIK
YSKFNMSQPPIPITKPLLTPSNTVSTFHVPLAPSSIPIRATTITASQSSHPNYMASQKRM
ELFESGSVRSVTTSKYPLPLVNPIHDPAQVASTQRTEIYDNIWRALDRRSERRNHRSNAY
ASAYRKNSSISHKGADRSPEETNNIKVDGHKLIRNPIPHFSIPTIENSYNEYVALSITGL
RNMSNTCYINSMLQCLFSTSAFRNLFLSN-KYAHYLKSPEMDT--------MSRSFYMLF
RKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKLHDEL-SSIESVSN
DYSHLLLHDNVRLYVDD-AQYNKWFDQNIDQNGLSPIDDLFQG--QMENQLSCQRCGYSS
YTYSTFYVLSLALP----NPVAKAFGKTK-K-LRLEDCINFFTCDEVLSDQNAWDCPRCC
SPS----------DYMSYDHKG-----KRKISTSFESLNGGNSSRS------KLFKFGYK
M---------------RSRSEAP--KFSSKLS----------------------------
-----------DKV---SNGKPATVKSLNFITMPRILVIHLSRF-IYDLTKKNNIVVSYP
LILNIVLKNS-EVAKFRLYSIVNHFGTLI-SGHYTSLVNKELNHEISHGKQKWYYFDDEI
VKF-----DTNH-GDYDNGIASVSSSNVYVLFYERIFD--------
>ZYRO0B16544g
--------------MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDH
TRYLYESFSDEMKNR-NKQDALTAYIIGCYFLYLIIPQSTQF--QARNKTFQVHNALKKL
YENQVNMTNVLLMVKDEVDSVLDR-----DFRKLKD---------------------VER
KRAFSSPDNG-----------------------------------------LDSEISRLT
LAGNGS----------------TLPKMHKKWDFIRSDS-------------NFH------
----------------SHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVD--------
-------------------T----------------------------------------
---------------------------------------------------VGKEAPELS
LSPLGYPKHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKD-----------------
DDEQHFWDA--K----------------------------------------V-DRAVAH
RKDSYHSVYMDDGDHDFGENKGAT--FPESEVQAMKRLQKQSIITSPELFSILSNKKERN
RLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERL-K---NSIFN
KRGSFDFIVYYTDMKTYMEMD-FDYLFVFYNLVVASQE-VSLRSLPSYLLGGYEKWKAVL
KKYLTQFGIRVDDYLYR-----------------P-YSSNKEGKEKSANAKHI-------
----------EPVPWKPPALPERMRNLPPPPPPAT-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------LPITKE-----MPP---------------
-----PVPPKIQLEQ---------------------------------------------
---------------------------------------------------------QED
KNH------TRPRSRTV-------------------------------------------
-----------------------------------------------SSPAEVPKNVVAP
EQLSQLDSYPMR------------------------QRQFSVPTIERSNNKYVALSITGL
RNLGATCYINSMLQCLFATNMFRDLFEPS-NYERFFNP-ELED-----TGKLSKSFSVLI
RKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL-SNQTEVLN
AHPELLLYDAETSKVQK-EEYKQWFENSLINTKFSPIDKIFQG--QLENGLHCKKCGYSS
YSYSTFYILSLAIP----KPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCG
VTVQKEKSESNQRHNKQSSSSGSTASPEPRKAKKKDEEGSSLKSKT------KFLLFPRK
R------------KSSSSKSLSPFNLLNSSSS--------SSNTNNNSSSNSG-------
-----------------SKKNSFSIRATNFVTLPPVLVIHLSRF-YYDLTKKNETVITYP
LILNIVLKNN-ETLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEV
VKH-----ETSH-GNLSQGVNKVSSKDVYVLFYERID---------
>KLTH0E00814g
-----------------MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEH
AEYLFESYRHALAAN-QAEDLLTAFVAGCFYIYLIIPHSIQF--QSRDKSYAIYADLKKY
YQDEANMTNVLLMVTEVIESMSKD-----EVETAR----------------------IMR
KRAYSVPYGK-----------------------------------------SPVTIQALS
KAN---------------------SATVEPDAPTETEF----------------------
-------------------ENGTTMWTAPELEPNDHLKVSLGSHHSSTSSAS--------
------------------------------------------------------------
---------------------------------------------------SNEQFPKIH
NESHSFPFEEPELHALSLGGSRTRRSSVPARASRKLGTTQA-------------------
SNSSDFNDQ-------------------------------------------KINRYATH
RKDSYHSVHMSND-------------DYDAFTFNLARLQKQSVVTCDQLMRIL-CSQDRD
NLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL-D---NKLLN
ARSQFEYIVYYTDMKTFMKLD-FDYQLVFFQLIYTSNK--NLKCTPKVLLGGYEQWKKFL
SKSSQAY-CDKDAFLYS-------------------------------------STNNGR
NAPVTSHSLPEHYPVAPPSIP-------PPPPPIA-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------KTEEMTKTPYNRAPFPTP---------------
-----LVQAQRADHF---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------PASSQNHTRDKNE
IQKHSVPALSGN---------------------GNYSKHTAIPTIEQSPNEYVALSITGL
RNIGCTCYVNSMLQCLFATKAFRDLFLST-KYEHYFSRKYTNP------NQLSKYFNVLF
KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL-SESNRVAN
DYPGLLLHDDKKLDVDQ-KEYDTWFEKHISENGISPIDNIFQG--QMENGLFCQRCGHSS
FNYSVFYVLSLAIP-----SSTSTFSQRK-K-VRLEDCINLFTSDEQLTNENAWDCPKCG
TSA-----------SGTGPEEE-----KKKKRFLLNPDTRASGNRS------RFFKLRSK
S---------------RSRSVSPFRKQSSQQQ--------NL------------------
-----------EKL---KSKKLTTIKTLNFISLPTVLTIHLSRF-FYDLTKKNNKVITYP
LILSIVLKNE-QIMKYRLYAIANHFGNLI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDET
VKK-----DINH-GDIDAGITSISSSDVYVLFYEKIDESQ------
>Kwal_55.19645
-----------------MNHLYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEH
AEYLFESYRRSLEAK-QNSELLTAFVVGCFYIYLIIPHSIQF--HSRDKSYAIYADLRKY
YQDETNMTNVLLMVTGVIESVSRD-----ELESAK----------------------IMR
KRAYSVPHKK-----------------------------------------LSDKMQALT
LS----------------------PETASSTNAGPETD----------------------
------------------NENDSTMWTAPELEPNDHLKVNLGGHNSSVSS----------
------------------------------------------------------------
---------------------------------------------------RSSNEQAFK
VGNEGNSSSSDDIEMAVHSTTQDQRPRRSSVPIKVEAPQN--------------------
SLQSTVDDIYCQ----------------------------------------KVDRYNTH
RKGSYHSVHMTGD-------------EYDSFTFNTARLQKQSIITCDKLLRIL-DSEEAE
RLLLVDLRFIKRFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLN-K---NHALK
DLSQFKHIVYYTDMKTFMRLD-FDYQLVFFQMLYTSNW--RISCTPKVLLGGYEQWKKFL
AKVPQSRVPIKEAFLFR-------------------------------------------
LKPGGKETVASAIIHQKASTPLPPSIPPPPPPVEK-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------VSKADSGSYTRAPF---------------
-----PLPAKEMVI----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------QSSLDSISRTQIP
SHLESHYTHEKV------------------LQNKMHHAEGTIPTIEQSSNEYVALSITGL
RNMGNTCYINSMLQCLFATRKFRDLFLSP-KYEDYFSKRYSNP------HQLSKYFNILF
KKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDEL-SESNHVAN
DYPNLLLHDDESLAVDQ-KEYDKWFESNISENGISPIDAIFQG--QMENGLLCQRCGHSS
YNYSMFYVLSLAIP-----ASMSSFGQKK-K-MRLEDCINLFTSDEKLTNENAWDCPKCG
SAV-----------SGNGPDGD-----KKKRKFLSTSDNSNGRSRS------RFFKLRSK
S---------------RSRSVSPFHKPSSQSP--------AS------------------
-----------EKW---KSKKLSTIKTLNFVSLPSVLTIHLSRF-LYDLTNKNNKVITYP
LTLSIVLKNN-EVVNYRLYAIANHFGNLI-SGHYTSLVNKDLSHDLGNGRQKWYYFDDEV
AKR-----DLNH-GNIDAGITSVSSSDVYVLFYEKI----------
>TBLA0E01760
------------MKRTKTLPNYTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDH
SSFLFETYTKSLRDS-HFDDALSAFIVGSFYMYFIIPQSTQF--LTKNRHYRMYHELKNL
YEDELNMTNVLSMVKTEITKILDS--NYKSQNESSNNLFVDSKF-------------IRR
ERAFSVPNAS---------------------------NPFSLMNDTSLDSQLDNSMDTLN
TSSTTVLSNKGTSAGPSFSNNSVTPNPTFRITLAKDANNMSANGNNSNSNSGINSSLQLP
RYQYTNEVHSDVEYSIEDTDESSPLWTAPQLDSKNQLKLAPDAGNPQIVDDAYSNQLPSV
TRVLSNIRRNQPKQSKLSLN----------------------------------------
---------------------------------------------------TNTNSPRSI
ISQTPTSPTSRNIPYTNSHNNNTNSNNNSSSTYIHSASSFDSSNDIFKDALANNLNSKIN
NSPTNIYNHGLTINTKDVEEDEEEDDFAETNPYHSSSVKEFPRKKSPTPLKSPVDRSVTH
RKDSYHSVYMFNDSNEDNNNHGYD--ETSEYIESLEHIQKQDVITCPELFSLLSNNVERE
KVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQII-N---NPLFS
KRDTFKYVVYYSDMKTYMNMT-FDYLFTLFYLLVTCTS-KPVKSLPTSLLGGYEKWYKVI
NSYVNQYSITMNDYVYR------------------------------------KDAGASA
GRPLNNNEKPKMEIWTPPQLPIRIRKRAPPPPPSS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------LPKPNSGK---MPP---------------
-----PLPPKINLH----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------GNPSLPPIHSPLE
NQVHSLDTHKQN---------------------GAIHRHFSIPILEKSENDYVSLSITGL
RNLGNTCYINSMLQCLFATTEFRNIFLSH-KYEKYMDHDIPTN------QRLSKSFNMLF
KKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLILDRLHDEL-SNQHEVKL
DYPDLVDYDVDDMEVQP-GQYIKWYNESVKSNGLSPIDHVFQG--QTEDGLVCQRCGCSS
FTYSTFYILSLAIP----KASTNAFGKIK-R-VNLEDCIKMFTNDEILSDENAWDCPRCG
SAA-----------PKQEPIHR-----HREKKHIHDISPPPRSPSSPEPRSKRFFLLNAP
R--------------EVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQN
HTTPNGRAGRVRHY----SGKMVTIKSVNFVKAPRILVIHLSRF-YYDLTKKNNTVITYP
LHLNISLKNG-EVARYKLYGLVNHTGTLV-SGHYTSLVNKDTDHELGSEKQKWFYFDDEI
VKE-----EKNH-GDIEGGVTSISSSHVYVLFYQRIK---------
>KLLA0A00396g
-----------------MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQ
AESLFESYRESLSVE-KYEDCLCEYVIGSFYVFLIIPGSVQF--SARNKSYSIYSDLKKL
YQDELNMSNVLLMVLHKVDSVLNQNMEILAKQHLD----------------------PSR
KRAFSVEEPI-----------------------------------------IRYQLHNLQ
LNN-------------------------ADQKSVDDDY----------------------
------------------KSFASTEWKAPQLDPNDRLHLAIASSKTTESSSLNSIS----
-------------------L----------------------------------------
---------------------------------------------------DENLYKEQD
DTDALDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQN-----------
DSSLMLENM--D----------------------------------------SFDRSRTH
RKDSYHSVYLGDELEDLNNIS-----------TGLARHQQENTIDCFALFSLLKDAESRE
NLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV-A---NPILD
KISQYDNIVYYTDYKSFMHLT-FNYELILFELLFKKTG----TAIPKSLLGGYEQWKAFL
NKQLRDSEFDKSLFLFR-----------------K-SKSAPSDKTASKPSVQTDNIIKSS
PSILSKEHNDDTLISSTPPIP-KVAPPPLPGSPLS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------APTIVY-----NRP---------------
-----PVPLPI-------------------------------------------------
------------------------------------------------------------
------NSPAPLLKPSI-------------------------------------------
-----------------------------------------------AKELRTPQRNDWT
VQTQHLHVP------------------------------FSIPTIERSPNEFVSLSITGL
RNMGNTCYINSMLQCLFGCSQFRDLFLGG-KYHRYLNPKRSNT-------IISKWFSLLF
RKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDEL-SEPTKVAN
DYPNLLLHDDEKLLVDN-KEYDKWFDEGLKNNGLSPIDDIFQG--QMENSLKCQRCGFTS
YNYSTFYVLSLAIPA---MPPPKTFSRSK-KIIRLEDCINLYTQDELLTGENAWDCPKCG
THS------NSSDGSMNSDETV-----DKKKKKNFLSVNGDHKSRS------KFFKLSSS
R--------------SGKRSLSPFKSNSVKPE--------KLHI----------------
-----------------KSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINYP
LILDVVLKNN-EIARYRLYGIINHFGNLV-SGHYTSLVNKHLSHEIRKGQQKWYYFDDEV
VKK-----EFNH-GDFDRGITSISSGDVYVLFYERIHSI-------
>AFR296C
-----------------MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLER
AANLFESYQDLVREG-QTREGLMAYVIGAFYLYLIIPQSIEF--HTRNLSYSLYTDLRKH
YEREPNMTNVVQMVTEKVDAVLLR-QTPEDGERGDTK--------------------LYR
KRAYSVPEKG--------------------------------------VARSSDSLQHLT
VDG---------------------KRRGGHHAIGGAIP----------------------
----------------EVAVQADTLWSAPKLEENDLLRTVVSVSRSPSVSLSRPSSRGGD
FVENALDGNSTKNGGRNTSKREGRRNSRRSDRSGRRNDGAKQRNGRSPNRSRSRGRSRSR
VRNRSRSQTRIGGPTSDMADAKERGRTRSRSWSRSGSRSPSYSIRSTGGSRSPSRSPSRS
ASRSPIRGRSRSRSGSRTPELGSATASVHSWSYLQTTGQQSRWSVLPNDLPNAGQNKYNQ
ESAVSFEQQ-------------------------------------------ELDRPHNS
RVEPYNPFANGNAAGLESCNP-------------LTRLYETSSIKCSDLMIILESDIQ-D
RVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRL-D---NPLFT
TRGQFSYLVCYTDNHTSMNMD-FKFELTFFELVYMGKP----RLLTKCLQGGYDQWRLYL
KTNTKSIHAKISDFMWR-----------------------ANFLGRDTSVSDHNPFRATP
PVPTARPPVPPLPTAPPPVAPYISSPRPVPFIPLQ-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------QPSLSLLHTSANIVK--------------
-----PGKAELRNELSRI------------------------------------------
---------------------------------------------------------TGQ
IDHTQYNQPEKYRYLPD-------------------------------------------
-----------------------------------------------SRESPYPIEYEDP
KHTERSRGWLSA---------------------GSSEAHFSVPTIEKNPNEYIALSITGL
RNMSNTCYINSMLQCLFSTTEFRNLFLSN-KYSRYLKSSNMDN--------MSRSFYMLF
KKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRLRDEL-SYLAAVVN
DYPQLLLHESSVLKVND-KEYTTWFDQNFEKNGLSPIDSIFQG--QIEHQLSCQRCDFSS
YSYSTFYVLSLALP----NPGSKAFGKAK-K-LRLEDCINFFTCDEVLTGQNPWDCPKCG
VNS---------SGDRQMNSEK-----SKRKNKFFMGSENANSANSNRDHLPRLFKIGSK
S---------------RSRSSSPFISGPKSSG--------KTHE----------------
-----------KRY----NKKLATIKSLNFITLPRILIIHLSRF-VYDLTKKNNTVVTYP
LILNIVLKNN-EVAKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEI
VKL-----DPNH-GNYDRGITSVSSSDVYLLFYERIS---------
>SAKL0E15136g
-----------------MECSYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEH
AEYLFESYHMMLKQG-NQEDALTAFIIGSFYVYLIIPQSIQF--HTRNKSYGIYVDLRKY
YQDETSMTNVLLMVTKKVDAIL---CKSRDFDDTK----------------------ITR
KRAYSVPSQA-----------------------------------------LANQLRSLT
LNN-------------------TDGLEQLPEVSKESDT--------------LT------
----------------NYADDYTTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSS----
------F------------V----------------------------------------
---------------------------------------------------MDQHSKKFS
IGESSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSV---------
ESVANIYVQ--N----------------------------------------V-DRYNTH
RKDSYHSVYMLNEDDDTNEYDFF---------QNLSRLQKQYVISCEELMDILQS-DERN
NVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGS---YQTFQ
SRSKFKYIVYYTDMKTFLNID-FDYRLVFFQLLYASSS-TRLRSPPKALLGDYEQWKTFI
GQYAKHHDIVTGDYLFR-----------------P-YASSAKSQKDKVKPISAPPVPATR
----------PPPPPLPAQAPPALPSQAPPTLPSQ-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------AP-PTQSIPAVHLP---------------
-----PLPPKSAINL---------------------------------------------
---------------------------------------------------------HYS
VAT--GMQPPMPQVTTV-------------------------------------------
-----------------------------------------------SHAHRHRYLSHSK
RSQHQHYSPISH-------------------------QYISVPTIEQSSNVYVSLSITGL
RNLGSTCYINSMLQCLFATRKFRDIFLSP-KYHDYISKGYIHR------AQISRSFHMLF
KKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQLHDEL-SDPEQVAN
DYPQLLLHDDDNLQVDG-KEYDKWFEDSISKNGLSPIDSIFQG--QMENCLQCQRCGHSS
YNYSTFYVLSLAIP----TPGTSTFGKTK-K-VLLEDCINLFTSDEVLSGENAWDCPRCG
TSM---------SGSGPGEGKA-----KKKRKFLLPHDHVNNNRTS------RFFKFRSK
S---------------RSRSSSPFNSSNGHNS--------GSSMPGS-------------
-----------EKW---KSKKLTTIKTFNFITMPPILVIHLSRF-FYDLTKKNSTVITYP
LILNIVLKNN-EVAKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDEV
VKQ-----DNNH-GDFDAGIASVSSSDVYVLFYERIYD--------
>CAGL0H06721g
------------------MDRFTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQ
AQCMLEDYMGCVDVD--TSKAVRVFITGCFYIYLVMPESMQF--QTRSKSYSLYTELRHL
YESQLNMTNVIAMVKEEVAQIQEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITR
RSAYSISSPSGMSTLSLHDELPEHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNP
ITNINQPRKSLDVTLNANNEIPTLSLHSDDKAVFDQHN-EAKSLPGTATDSDEE------
----------------YYVEHGSPIWTAPDLDPNDQLKLALG------------------
------------------------------------------------------------
------------------------------------------------------------
--------TELLSPPVMGLDGDTLGDDIYYETVSKGDDVS--------------------
YRGKDFEDL--H----------------------------------------A-NRLITH
RKDSYHSIYMID-DDNNNSKNYFD--GSNAFIQGLERLQKQSIITAPELFSILSNPEERH
KLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRL-N---NPLFN
GRLKYDYIVYYSDMKTYMNFE-YDYSFILFYLLTTSGK--HLSSVPTALLGGYEKWKKVM
NTYVSQYQIELDDYLYR-----------------P-YA----------PSNNKGEQNNAQ
IP--------DVPTWKPPPVPVMVRKRPPPPVPVS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------IPIPPE-----TPP---------------
-----PLPQKIKLES---------------------------------------------
---------------------------------------------------------IEE
SAP---------------------------------------------------------
------------------------------------------------SDNSQYIRPPAK
LPIHALHSPRNQ----------------------TLTRKFSIPTIEKNSNPYVAYSVTGL
RNLGNTCYINCMLQSLFATNELKNLFISG-KYREYQMKPNDNK-----ESAISNTFANLF
NKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDEL-SNQVNVIN
DYPNLLLYDDDKMMVDK-EKYKKWFDKTVVANGLSPVDGVFQG--QMENALQCQRCGYES
VNYSTFYVLSLALP----KPSAPAFYKSG-R-VKLEDCINMFTSDEVLTGENAWDCPKCG
SKA-------------VEPRFT-----SRTSTQTILPNSPHHHKKS------KFFGLPTG
K--------------AISRSKSPFRKLGLLEK--------HEGKQEKLDKMERDEI----
-----------EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRF-YYDLTKKNDAVVSYP
LVLNIVLKNE-EIVRYKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQKWYYFDDEV
VKA-----EKTH-GNVDKGITKVSSKNVYVLFYERVD---------
>Suva_9.30
--------------MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEH
TEYLFELYLDSMRHE-RPNDALTAFVIGCYYVFLIIPQSLQF--QTRNKSYSIYSDLKKM
YENEMNMTNVVLMVKKEIGVVLDD--SVKHVVGIEHR--------------------ITK
KRAFSVPGID-----------------------------------------LSDQLASLS
LDA-------------------AGPRGHLHKTSSTEED----------------------
------------------ADQSSPVWTAPNLEPNDQLKLALL------------------
------------------------------------------------------------
----------------------------------------------------PEVIPTPA
FPESGRKTSTPVRQSVLL--------EDVPYTHNDNDGTSA-------------------
SSDQPFGEI--T----------------------------------------A-DRSVTH
RKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESE
KLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEG---NEHFI
NRDKFQYVVCYSDVKTFMTMN-FDYSFIFFYLLLTSQK-TRLATVPTALLGGYEKWKKTL
HTYAQQYHISIDDYLYR-----------------P-YSQKQQQQQQQQQQQQQPSSQDSS
SSKESSAKIPEPPSWKPPDLPIRLRKRPPPPLPVT-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MPTTPE-----NPP---------------
-----PLPPKIMVHP---------------------------------------------
---------------------------------------------------------HDN
FQL---RQPPIPARQHV-------------------------------------------
-----------------------------------------------KKQQLNSNEIIQK
KRQHQHQHYDQQ------------------LLQPQPQRVYHIPTIEQSSNAYVSLSITGL
RNLGNTCYINSMIQCLFAAKVFRTLFISS-KYKSYLQQSRGNR---LHSPRLSNSLNMLF
DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SNQPHVAN
DYPNLLLYDADGLKVSN-KEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
FNYSTFYVLSLAIPRRSMKLSKLGRPNEK-R-VKLEDCINMFTSDEVLSGENAWDCPRCG
PTA-STSLSASASALENDSNIV-----KSRKKKSRFFTLHTRSKRR------HLDFFGDS
SNE---STSNNPVHFERERSRSPFKMLGGGGK--------RSHSNTPFANSSNDGNNF--
-----------NDF---KNKKLTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITYP
LILNIILKNN-DTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDDEV
VKA-----DKKH-GSDKS--LKISSSDAYVLFYERVHD--------
>Skud_9.12
--------------MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEH
TEYLYELYLDSMRHN-RPNDALTAFIIGCYYVFLIIPQSLQF--QTRNKSYSIYTDLKKM
YENEMNMTNVVLMVKKEIGVVLDE--SVKHAVGIEHR--------------------ITK
KRAFSVPAND-----------------------------------------LSGQVASLS
LEN-------------------AGPHGHGFKASFTEED----------------------
------------------AEQSSPVWTAPNLEPNDQLKLALL------------------
------------------------------------------------------------
----------------------------------------------------PEVIPTPI
YPESGRKTSSPVRPSVLL--------EDVPYNCYDGGASSA-------------------
SLNPSFGEI--T----------------------------------------V-DRSITH
RKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIERE
KILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEE---NEIFI
NRDKFEYVVYYTDVKTFMYMN-FDYVFIFFYLMLTSQK-THLTSVPTALLGGYEKWKKTL
HTYAQEYDVSIEDYLYR-----------------P-YSQKAHQQ--QQQEQQQSNAQDSS
SSKESSAKVPEPPSWKPPDLPIRLRKRPPPPPPVS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MPTTPG-----IPP---------------
-----PLPPKIMVYS---------------------------------------------
---------------------------------------------------------HDN
SFS---RKPPIPAKQHV-------------------------------------------
-----------------------------------------------KKQQLNSNEIIQR
KRQQQKHRHYGQ-----------------QLLQPQPQRAYNIPTIEQSSNVYVSLSITGL
RNLGNTCYINSMIQCLFAAKIFRTLFISA-NYKNYLQPPKGSRSAH--SSKLSNSLNMLF
NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SNQQHVAN
DYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
FNYSTFYVLSLAIPRRSMKLSKLGRSTEK-R-VKLEDCINMFTDDEVLSGENAWDCPRCG
PTASSSSASASASAFESESPIA-----KSKKKKSRFFTLHTGSKRR------HLDFFGDN
INE---SNSSNTVTFERERSRSPFKMLGSSGK--------RSNSSTPFANNNNDGNNI--
-----------NDF---KNKKLTTVKTINFVTLPKILVIHLSRF-YYDLTKKNSTVITYP
LILNIILKNN-ETMKYRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEV
VKA-----DNKH-GSDKN--LKISSSDVYVLFYERVHDQ-------
>Smik_9.13
--------------MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEH
TEYLFELYLDSMHHG-RPNDALTAFVIGCYYVFLIIPQSLQF--QTRNKSYSIYTDLKKM
YENEMNMTNVVLMVKKEIGVVLDE--SVKHVVGIEHR--------------------INK
KRAFSVPAND-----------------------------------------LSGQVASLS
LDT-------------------AGPQQHNIKVPLTEDD----------------------
------------------MDQSSPVWTAPNLEPNDQLKLALL------------------
------------------------------------------------------------
----------------------------------------------------PEVIPTST
FNEPERKSTSPARPSVLL--------EDVPCTYHDNDASTA-------------------
SLNPPFRDI--T----------------------------------------A-DRSVTH
RKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVERE
KVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKE---NENFA
NRDKFDYIVYYSDVKTFMTIN-FDYVFIFFYLMLTSQK-TPLTTVPTALLGGYEKWKKTL
HSYAQEYHISVEDYLYR-----------------P-YSQKARAQ--QQQQQQQPNSQDSS
SSKETPTKVPEPPSWKPPDLPIRLRKRPPPPPPAS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MPTTPE-----IPP---------------
-----PLPPKIMVYP---------------------------------------------
---------------------------------------------------------HEG
SVP---RKPPIPAKQHV-------------------------------------------
-----------------------------------------------KKKQSNSNEIIQR
KRQQQHYGQQLL--------------------QPLPPKDYSIPTIERNPNVYVSLSITGL
RNLGNTCYINSMIQCLFAAKTFRTLFISS-NYKNYLEPLASNRPHH--SPKLSNSLSMLF
NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SNQQHVAN
DYPNLLLYNADVLKVSN-NEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
FNYSTFYVLSLAIPTRSMKLSKLGRSTEK-R-VKLEDCINMFTSDEVLSGENAWDCPRCG
PTA-SFTASASASALENESSIL-----KSKKKKSRFFTLHTGSKRR------HLDIFGDS
N--GEGNNINNTMIFERERSRSPFKMLGGSGK--------RSSSSTPFANGGNDSNNT--
-----------GDF---KNKKMTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITYP
LILNIILKNN-DTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEV
VKA-----DKKH-GSDKN--LKISSSDVYVLFYERVYD--------
>YIL156W
-----MLDDDKGTAMHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEH
TEYLFELYLDSIHHD-RPNDALTAFIIGCYYVFLIIPQSLQF--QTRNKSYSIYTDLKKM
YENEMNMTNVVLMVKKEIGVVLDE--SVKHGAGIEHR--------------------ITK
KRAFSVPADD-----------------------------------------LSGQVASLS
LDT-------------------AAPQDHGLKGTFTEDD----------------------
------------------AEQSSPVWTAPNLEPNDQLKLALL------------------
------------------------------------------------------------
----------------------------------------------------PEVIPTPA
FREPERKTSVPVRPSVLL--------EDVPSIYHEDDTSFA-------------------
SLNPPFREI--T----------------------------------------A-DRSVTH
RKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVERE
KVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKE---NENFI
NRNKFDYIVYYTDVKTFMTIN-FDYAFIFFYLMLTSQK-TPLTTVPTTLLGGYEKWKKTL
HSYAQEYHISIEDYLYR-----------------P-YSQKARLQQEQQQQQQQPDSQDSF
SAKESSTKVPEPPSWKPPDLPIRLRKRPPPPPPVS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MPTTPE-----IPP---------------
-----PLPPKIMVHS---------------------------------------------
---------------------------------------------------------QVS
SIS---RKPPIPAKQHV-------------------------------------------
-----------------------------------------------KKEQLNSNEIIQR
KRQHQHQHYDQQ--------------------ILQPQRAYNIPTIERSPNVYVSLSITGL
RNLGNTCYINSMIQCLFAAKTFRTLFISS-KYKSYLQPIRSNGSHY--SPKLSNSLSMLF
NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL-SDQQHVAN
DYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQG--QMENSLQCKRCGYTT
FNYSTFYVLSLAIPRRSMKLSKLGRSTEK-R-VKLEDCINMFTSDEVLSGENAWDCPRCG
PTA---SVSTSVSALENEPSIV-----KSKKKKSRFFTLHTGTKRR------HLDFFGDG
ITEGHNSNNNNTTIFERERSRSPFRMLGGSGK--------RSSSSTPFSTGGNDSNNS--
-----------SDY---KNKKLTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVVTYP
LILNIILKNN-DTMKYKLFGVVNHTGTLI-SGHYTSLVNKDLEHNVNIGRSKWYYFDDEV
VKA-----DRKH-GSDKN--LKISSSDVYVLFYERVYD--------
>KNAG0L02200
--------MRSMYGDDSTALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEH
TEWLYELYLSCLGKD-QNMDALGSFINGCFYVYLVMPQSIQF--HTRNRAHTVYSDVRAL
YESQVNMTNVLLMVKEEVQVVLES---QWDSASLNER--------------------IPR
NRAYSVPDEA----------------------------------------RVVQNLDKLT
LQSPTETRGGRPRSQKKQLL--QLPRPGNVPVHSDSEFIAEQGISLHGDDSGWS------
----------------DLDDQSSPLWRAPQLEPNDQLKLAAEVHDLPPGAISRGSDADEE
EDVDDLE------------I----------------------------------------
---------------------------------------------------GYEEMGIYG
LAHHSVAPPQHAPPPVPLSSQSPITSGGTPAAIDDLMMRRRRTHTMTQMTPAAQTVPPGG
AHDRSFKDF--T----------------------------------------P-DRSLTH
RKNSYHSVYMLEESESSQGNLYYD--ESNAYIQSLERLQKQSIITAPELFSILSNEQQSK
QLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKL-N---NPLFN
RRDEFDYVVYFSDMKTFMKLN-FDYHFTFFYLLNTARG-KPLKCVPTVLLGGYEKWKKVI
LEYGKQYNICVTDYLVR----------------------ITEGEDDTPARHDCQELPYRQ
QNFAGINGPGAVEPWKPHEVPATIRKRPPPPPPAS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------VPQSPD-----VVP---------------
-----VIPPRIMLDS---------------------------------------------
---------------------------------------------------------KVS
QHRAPFQSNLNFVTGQI-------------------------------------------
-----------------------------------------------LEADEDTALQVAP
TKRIQQEPFRSA--------------------TNGLHETYSIPTIEQNPNIYVSLSITGL
RNLGNTCYINSMIQCLFATKSFRNLFISM-KYKEFLKEVAPKPGANGSQPVISRTFYILF
KKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL-SNQDAVVN
EYPDLILYDEKKLNVQN-KEYKKWFDKSVIGNGLSPIDDIFQG--QMENSLHCQRCGHSS
FNYSTFYVLSLAIP----KATSSTFSRSK-R-VSLEECLNMYTSDEVLSGENAWDCPNCC
KIT------KDYKGMVEKTKRN-----KAARDTLSPGSSSSSSKKG------KLFSFSLH
HRHHHRSELGELNVSKINRSLSPFRVLGGSSS--------KSVRKSEDSHSRADVDAQRD
IDELREMKEEMKQW---KSKKLFTIKTLNFIRMPRTLIIHLSRF-YYDLTKKNSTIVTYP
LILNIVLKSN-EVVKYKLYGVVNHTGNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDEV
VKR-----ETRH-GDVKHGVMKISSSDVYVLFYERI----------
>TPHA0D04660
---------------MKVESTFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEH
TAYLLESYLDLLHEQ-KYDECLSAYIVGCFYLYLIIPNSTQF--QIRNKSFRIYNELKIL
YQNQANMTNVLAIVKNEVDSILDE--SILELEGIEKV--------------------IKR
DRAYSSPAPK---------------------------------------VNNISKFSKLS
INDNHHNGETISTDNKLQSHFPQTPNYSNSNNSTGSFN-------NVKSNSNSS------
----------------EEAEDTAPIWHIPSLEPNDQLKLALEQPVE--------------
-------------------F----------------------------------------
---------------------------------------------------SDEEIDASS
ISEPLGRRYSPLSPYQKKRNSSISSAFLVPFPHNENDKVH--------------------
DNSMLIEDL-------------------------------------------PVDRSVTH
RKDSYHSVYMNNQDEESDSGAHYG--LSNSYIQSMDRLQKQNVITCSELYSILSSPTERQ
KLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYSFEELVKRI-N---NPLIS
EVNKFDYIVYYSDIRTFMVTD-YDFCFTFFYLLLSTKS-LNLKQVPTNLLGGFEKWKKVL
KTYNKEYGIDITPFIKK----------------------------------LHATELNKN
TVPTGEMKTLEATSWKQPEVPLRIRKRPPPPPPSS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------IPEIPSTYQNN------------------
-----ELTTLIEDKR---------------------------------------------
---------------------------------------------------------LEN
IDVQGKHRRIEYISPPI-------------------------------------------
-----------------------------------------------PPRTPSPNHQPSY
NQKKHQYKALKS-------------------------YATPVPTIEQNPNTYVSLSITGL
RNLGNTCYISSMLQCLFATTTLRDLFITT-KYESYINHKVTDK------INLSRSFSILF
RKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLHDEL-SKEDTVLN
DYSNLLLYDAERMHVKV-DQYKKWFENSNLSGGVSPIDDIFQG--QIENSINCQRCGYSS
FNYSSFYVLSLAIP----KISVMSFSRTN-R-VKLEDCINMFTRDEVLSGENAWDCSRCG
SQS---------DNFVKTSHND-----HHKEHTSETTDDSKQNRKS------RLFLLPKK
Y-------------NPTSRSLSPFGRHSSHKS----------------S-----------
-----------EKW---KSKKMETIKSLNFIKMPKILVIHLSRF-FYDMSKKNETVVAYP
LILNIVLKNE-EVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEV
VKH-----ELNH-GNIDEGVNKVSSSHVYVLFYEKID---------
>TDEL0B02080
--------------MADTEVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEH
TEYLFESYLQFLHEK-NNQDALTAFIIGCYYLYLIVPQSIEF--QTRNKSYSIFNDLMKM
YQNQANMTNVLLMVKDEVDSILDR--NAREFKEFEHQ--------------------KAR
TRAYSVPDRN-----------------------------------------FESRLTNLN
IHN-------------------ENPLPLGDHQAASKSE-------QGREDMNNL------
----------------QNDEDSSPVWTAPPLEPNDQLRIALD------------------
-------------------A----------------------------------------
---------------------------------------------------TPLSPSIMA
LDQPMATKELAISTSRKALSRRASAMGPTPYPIEELDISGQDGNSHYDEL----------
GFNKTLWNA--N----------------------------------------V-DRQTTH
RKDSYHSVYMFEGGSDDHMPS-----ISKDFTQGLERLQKQSIITAPELFTILSSSEESE
KLLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEII-K---KPAFL
ERGSYDYIVYYTDMKTYMTID-YDYMFTLFYLLTASPT-VNLRSLPTHLLGGYEKWKKIM
KNYSVDHGVNMDNYIYR---------------------------PYGESKKALPDTSSKR
TP--------ELPSWKPPAIPPRIRKRPPPPPPIS-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------VPVPTEKPPAAPPP---------------
-----PIPPKVSLET---------------------------------------------
---------------------------------------------------------HPE
EPPAVDDHSVE-------------------------------------------------
-----------------------------------------------TTRPTRITRKAIG
SRPLHTHPHDQR---------------------LSLQRHYSIPTIEKSSNTYVSLSITGL
RNLGNTCYINSMLQCLFATTKFRDLFVSG-KFEEFFNQNYSNR------PQLSKSFNILF
RKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRLHDEL-SNQAAVAN
EYPDLLLYDEHQMDVNG-KEYKKWFEESVIGNGLAPIDHIFQG--QIENILECQRCGNSS
FSYSTFYVLSLAIP----KPSTSTFSRAK-R-VKLEDCINMFTNDEILSGENAWDCPKCG
SAV-----------TDMGPNHL-----KKSKKKKKSELGEERRSKS------GFFRIHSK
S----------------KRSKSPFRMLGSTKF--------PLAM----------------
-----------EDW---KSKELSTKKTLNFIFLPPVLIIHLSRF-YYDLTKKNDTIVTYP
LVLNIILKNN-ETARYRLYAVVNHTGNLI-SGHYTSLVNKEPMHKLDKGRQKWYYFDDEV
VKE-----ETKH-GNIDQGILKVSSSDVYVLFYERLD---------
>NCAS0G00170
------------MPSAYEKSTFTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEH
TEYLFELFLHFGHEG-NNKDALTSFIVGCYYLFLIMPQSIQF--QSRNKSYGIYSDLKKL
YENQASMTNVLLMVKDEIETILEK-TAEREINETNNR--------------------IVR
QRAYSVPDSN----------------------------------------DLTEQLHSLS
VSDRNLK---------------SPPRKILMNNSFEHSD----------------------
-----------SDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLP------------
------------------------------------------------------------
---------------------------------------------------PPVIPYEAD
IQERTDLLKQPSIPELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREP-----------
SNNRSFRET-------------------------------------------NADRSQTH
RKDSYHSVYMIDEESTDKLNQFY---DSTDYIQDLQRLQKQSIITAQELLSILSCPPERI
KLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLL-D---NELFN
RRHEFEYVVYYTDMKTYMHSD-FDYNFTLFYLLTTETT-NILRSTPTYLLGGYDKWKVFL
HHYAKEYDINIPDYLYR------------------------------PYDKALKSETPEE
FEETKNKHVLEPPSWRPPELPVRIRKRPPPPPPAL-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------LPVPPS-------P---------------
-----PVKPRIVDDV---------------------------------------------
------------------------------------------------------------
------NRPKK-------------------------------------------------
-----------------------------------------------TLMNLHSARPLLH
ERNYQIPPHLQQ--------------------TTTLTRRPSIPTIERSPNLYVSLSITGL
RNLGNTCYINSMLQCLFATRRFRDLFLTS-KYSSFLNGSKFPN-----SPMISNSFNLLF
KKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRLHDEL-SNQQEVVN
EYPSLMLYDTNHLRVQH-EEYKHWFEKSVIGNGLSPIDEIFQG--QIENGLQCQRCGHSS
FNYSTFYVLSLAIP----KPSPTGFSRSK-R-VKLEDCINMFTNDEMLSGENAWDCPNCG
SNA-------------QDRVRV-----NTDQSVKKKRQGEEHRHKS------RFFGLPTR
P----------------HRSLSPFRKSGSSST--------NSTSKIKHE-----------
-----------QQW---KTKKLITIKTLNFIMLPPVLVIHLSRF-FYDLTKKNKTVITYP
LILNIVLKNN-EVAKYKLYGIVNHTGNLI-SGHYTSLVNKEPGHNLNHNQQRWYYFDDEV
VKA-----EGNH-GDIDNGISKVSSKDVYVLFYERLYE--------
>NDAI0F00200
-------------MSVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEH
TEYLLELFFTYNKNNTNNKDVLTAFIVGCYYLFLIIPQSIQF--QSKNKSYGIYTELKKL
YENETHMTNVLLMVKDEIENVLDM-DENNNGSDLNHRI-------------------IKR
QRAYSISINE-----------------------------------------LSNQVKSLS
ISNSIDQEHINNKTETSLTNQPPNHHLLPIILHCDEEF---------SNEEINA------
----------------TDFDRASPLWTAPSLEPKDQLKLAYTNNTNTKTNTDNNNGQKDS
TANDFP-------------F----------------------------------------
---------------------------------------------------APIQMPFDN
GSAPDIPPKIPITKATTNIINNSESENNVNEGTMPFTTSSLENINNINNI----------
NNYKTIEQT--N----------------------------------------P-DRASNH
RKDSYHSIYMVDDGSADGITQYY---DSNPYIHSLERLQKQCIITAQELFSILSNPIEKS
KLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQ
NRTQFEYIVFYTDNKTYMNTN-FDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVL
YSYSEQYNFNMGDYLYK-----------------P-------HRHSGDSIKHHDDLVDSH
IL--------QPPSWKPPELPLRMRKRPPPPPPVA-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------IPTP-------------------------
-----PVPHLLTNST---------------------------------------------
---------------------------------------------------------LPP
ISSTTEQSPGIVLKT---------------------------------------------
-----------------------------------------------KTMTDLHSTKSQQ
HRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGL
RNLGNTCYINSMLQCLFATRLFRDLFISS-KFQSFINDSKFPN-----TPKISNSFNLLF
KKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL-SNQQEVVN
EYPNLLLYDENNLKVQN-KEYKHWFDKNVIGNGLSPIDHIFSG--QMENSLQCQRCGNSS
YNYSTFYVLSLAIP----KPSSTTFSRSK-R-VKLEECINMFTSDEVLSGENAWDCPKCG
SSA-----------SSTISDSEKLLNVTSSKKKNMSSHNEHHRYKS------KFFTLHTR
S----------------HRSISPFRKKTSPAA--------VPSSTKN-------------
-----------EPW---KSKKLITIKTLNFIVLPPILVIHLSRF-YYDLTKKNNTVITYP
LILNIVLKNN-EVAKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDET
VKE-----ERNH-GDMDKGILQVSSRDVYVLFYERIYE--------
>Kpol_2001.78
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MVQCLFGTKLLRDLFISS-KYEKYLSKRIDRS------SNLSRSFSILF
KKMYLNGGCSVVPTSFLKTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDEL-SNQETVGI
DYPDLVLYDTRKLRVNN-KEYSKWFDKTIFANGLSPIDHIFQG--QIENTLTCQRCGFVS
YNYSTFYVLSLAIP----KPSSGTFSRSK-R-VKLEDCINMFTNDEVLSGENAWDCSNCG
SSS--------------VHNVE-----QRKDKTTGNGEEKKRSRKS------RLFLLPNI
N-------------GRSSRSISPFRKSASPRP--------PH------------------
-----------EKL---KHKKLVTIKSMNFISLPPTLVIHLSRF-YYDLSKKNETIVTYP
LILNIVLNNN-ETAKYRLYGIVNHTGNLI-SGHYTTLVNKEKNHELKKDKQKWYYFDDEV
VKE-----ENNH-GNIDEGVIKVSSSQVYVLFYERVYN--------