MUSCLE (3.8) multiple sequence alignment

CAGL0L04048g       -----MSSDSNTVGFWVKNKKAVVASVATVSAVV---AAYFYYKQVQELK----------
NDAI0B04340        --MSGNDNPSSFKNFFINHRKLIITTITAGTAAF---GAYYYYNQLQKLQPSGSISKETA
Suva_15.314        ------MAENSFSKFFARNKLAIVATVSAGAAAV---GAYVYYHQLKQQQQHHQQQLKGT
Skud_8.178         ------MAENSLLKFIAKNKVAILATVSAGTAAV---GAYAYYKQLKQRE----QQQLKG
Smik_8.195         ------MAENSLFRFIARNKVAILATVSAGTAAV---GAYVYYQQLKQQQ----QQHLKG
YHR117W            ------MAENSLLRFITKNKVAILATVSAGTAAV---GAYVYYQQIKQQQ----QQQLKG
KAFR0F00720        MPTDSGASQGGIGSFITRHRTAILATLAAGATAA---SAYYYYNNLRELK----------
KNAG0H03530        ---MSTASDNSVAAFFARNKRAILATVAAGTAAA---GAYYYYTQVQQQL----------
NCAS0B07010        ----MSSNDHPVGGFLTRNRTAIVATVAAGSAAI---GAFYYYHHLQQTH----------
CAGL0L12936g       -------------MALLKNRKAVVATVAAVATAAAAASAYYYYSNVRATT----------
TBLA0C05530        -----MSVDNSWVTFYQRNKRAILATVAAGTAAA---GAYYYYKQLQNAQ----------
TPHA0I01510        ----MSASDGSVGGFIARNKTAIIATVAAGSAAL---GAYYYYTQLQRQI----------
Smik_14.207        -----------MKNFISKNKTAILATIAATGTAL---GAYYYYSQLQQQQ----------
YNL121C            -----------MKSFITRNKTAILATVAATGTAI---GAYYYYNQLQQQQ----------
Suva_14.219        -----------MKSFISKNKTAILATIAATGTAV---GAYYYYTQLQQQQ----------
Skud_14.211        -----------MKSFISKNKTAILATIGATGAAV---GAYYYYTQLQQQQ----------
KLLA0F24046g       ------MSDNSVSSFVTRNKTAILATAAAGGAAI---GAYYYYNQLQRAE----------
Kpol_1048.21       -----MSSDNSIGAFVARNKTAIIATVAAGTTAV---AAYYYYSQLQQQQ----------
ABR131W            -----MSSENSFAGFVSRNRTAIIATAAAGASAV---GAYYYYQQLQRQS----------
Ecym_8204          -----MSSDNSFAGFISRNKTAIIATAAAGASAV---GAYYYYQQLQQQV----------
SAKL0E10956g       -----MSSDNSLANFVSRNKTAIIATAAAGVSAA---GAYYYYKQLQQQR----------
KLTH0B05170g       -----MSSDNSFGQFVARNKTAIVASVAAGATAV---GAYYYYQQLQRQP----------
Kwal_33.14767      -----MSSENSLGQFVARNKTAIVASVAAGATAV---GAYYYYQQLQKKP----------
ZYRO0G06512g       -----MSSDNSVAGFISRNKTAIITTAAAGTAAV---GAYLYYRQLQDAA----------
TDEL0B05140        -----MSSDNSVSSFVSRNKTAIIATAAAGSAAI---GAYYYYRQAQRAA----------
NDAI0F02810        -----MSSDNSIKGFVSRNRTAIIATIAAGTTAV---GAYYYYTQLQAQQ----------
NCAS0G02480        -----MSSNNSMRDFISRNKTAIIATVAAGTAAV---GAYMYYAQLQQQH----------
                                    .:.  ::::  :  :.    .*: ** : .             

CAGL0L04048g       ---------------KSLDDGNDVGTASSKVEYK--------------------------
NDAI0B04340        GSTEKNTKNHDTINNDLNTSSPPPPISKSKKKKLKKKLKKNHQKTDENNNNNNNSQSTSS
Suva_15.314        KDRQRQGEALPGQDGEEELGLKEDGSAAADSNKKKKKKNRR-------------------
Skud_8.178         TKNRRRPGETFTSQNEDEVSLKDDGSITSGSRKRKKNKRKR-------------------
Smik_8.195         SKDHRRQSEASTNLKEDEVGLKNKSSIANENKKKKNKRKRK-------------------
YHR117W            TKDNRRQSEAFAGQNEDEADLKDDGSVVSGSNKRKKKKNKR-------------------
KAFR0F00720        -------------DLKDHDKQAEDKSENATEKKLASKPKKK-------------------
KNAG0H03530        -------------DRDGASAKGSKKKSKKKSGSKKKQEKKT-------------------
NCAS0B07010        ---TSLEGEEDGNSTGRNPVNDEAHLSKNQKKKQRKKHKKK------------------A
CAGL0L12936g       -----------------------EKSKKDKKKKNKKKKKAT-------------------
TBLA0C05530        -----------DNLKDNKASSTASGESSSKKKKKKKKSKSA-------------------
TPHA0I01510        ---------------DDSSSSKKKKKKHSKKKKSTSTDEKS-------------------
Smik_14.207        -------------QQGKKNTITKDDKKEVKGSQKKTKDGSE-------------------
YNL121C            -------------QRGKKNTINKDEKKDTKDSQKETEGAKK-------------------
Suva_14.219        -------------QQGKKETLSRDEKKEAKGSQKKSEGSKK-------------------
Skud_14.211        -------------QRGKKDTITKDEKKDVKGSQKKAEGSKK-------------------
KLLA0F24046g       ------------------LGSGSSGSKKTSKSEKKKRAGKK-------------------
Kpol_1048.21       -------------------QQQQKGSDDSVSKKKKKNKKKK-------------------
ABR131W            ---------------SGEVSKDATGSTDVKSKKKKKRNNKK-------------------
Ecym_8204          -------------ESQGKVGGVNSPSGETRYGKKKKKRANK-------------------
SAKL0E10956g       ------------------LSSDDASDGEAKPLKKKKKSKKK-------------------
KLTH0B05170g       -------------------ANKKEPESESKSSKKKKKTKKK-------------------
Kwal_33.14767      ------------------FEDGKEVGDEPKPSKKKKKGKKK-------------------
ZYRO0G06512g       -------------GSDDKKGESPDGTAASKKKRKNKKKKQG-------------------
TDEL0B05140        ------------------LDEDEKGAEGSESSKKKKKNKKK-------------------
NDAI0F02810        -------------QENVRPKEDTDKSTATKKEKKKSKGKES------------------K
NCAS0G02480        ---------------EKKPAKKTKKSKKSVTEEEKKK-----------------------
                                                                               

CAGL0L04048g       --------------Y--LMI-NDEPDIELMKLA---ETAEKNEYASELKKRGNAYFKVKD
NDAI0B04340        ASSSNSASPILKPSY--PLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKD
Suva_15.314        -KKKSKPKSAEDVEY--PLLPHGEPDMDRLRGL---SAPQRQAFAVQLKDKGNHFFTAKS
Skud_8.178         ---KNKPKLAESFEY--PLLSDGEPDMAQLRGL---PLSQRQEYAVQLKDKGNHFFTSKN
Smik_8.195         ----NRAKSAEDFQC--TFLPNGEPDISQLKGL---TLSQKQTYAVQLKNKGNHFFTTKN
YHR117W            -KRNNKAKSGEGFDY--PSLPNGEPDIAQLKGL---SPSQRQAYAVQLKNRGNHFFTAKN
KAFR0F00720        -------KVSKASQF--PAKENGEPDFTGVDNL---TADQKDKWAIELKDKGNEYFKEKD
KNAG0H03530        ------ELATETPVY--PITASGEPDLSQLDSY---TPEQRETYALALKDKGNELFKEKA
NCAS0B07010        TPDQTTATADVLTSY--PTNDSNDPDMIQITSL---PLEEQKKISMQLKDKGNKYFKAKD
CAGL0L12936g       ----ASEPATSDKAYLTINGDEEKPDMAAMLAS---SEDQKKVYATALKDKGNALFKEKR
TBLA0C05530        -KELSPATTDGKPIY--PVRDNGEPNLDNKDQF---TEEEKEKYSIALKDKGNSLFKADK
TPHA0I01510        ----NSKNETAKVIY--PVASNGEPDLSGKDSF---SDELKEKYAMALKDKGNDYFKKQD
Smik_14.207        -----STAESNTPVY--PVSSNGDPDFSNKANF---TAEEKDRYALALKDKGNQFFRNKK
YNL121C            -----STAPSNPPIY--PVSSNGEPDFSNKANF---TAEEKDKYALALKDKGNQFFRNKK
Suva_14.219        -----SAGESKPPIY--PVAANGEPDFSKKADF---TAEEKDKYALALKDKGNQYFRNKK
Skud_14.211        -----TASESKAPVY--PVSSNGEPDFSKKANF---TAEEKDKYALALKDKGNQYFRNKK
KLLA0F24046g       KKDSSSSSNGSDVVY--PVDANGQPDLSKKDEF---TPEQVDKYALALKDKGNEFFKAKD
Kpol_1048.21       -----NSSSSAKPCY--PIDSNGEPDLKDSANF---TEEQKETYSVALKDKGNQFFKEQK
ABR131W            -------------KY--PVDQNGEPDLSGMATF---TEEQKEKYAMALKDKGNECFKDQR
Ecym_8204          ------------KKY--PVDSNGEPDLSGVDSF---TEEQKERYSMAMKDKGNECFKEKK
SAKL0E10956g       ---KPTSGSPTASAY--PVDENGEPKLDDIDQL---TDEQKEKYAMGLKDKGNEFFKEKK
KLTH0B05170g       ---------APGPSY--PVNEKGEPDLSNLAEL---SDEQKDKYAMGLKDKGNEFFKNKK
Kwal_33.14767      ---------TQGPSF--PVDEKGEPDLGKVDEL---SAEEKDKFAMGLKDKGNEFFKNKQ
ZYRO0G06512g       ----SSPSPSAAVSY--PVDEKGEPKLDNVAEM---SEEQKESWSTALKDKGNEFFKQKD
TDEL0B05140        ----KSGENGGTPVY--PVGQNGEPLLENIEEL---SQELRETYATALKDRGNEFFKKKD
NDAI0F02810        K-PQEDTPTTKKPIY--LVDSNGEPNLSDIDSL---TEETKNEWAMALKDKGNELFKTSK
NCAS0G02480        ---------EEPPIY--PIDANGEPVLGDVDLL---NDKTKEEWAGALKEKGNALFKKKD
                                          .* :              .  :  :*..**  *  . 

CAGL0L04048g       YENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRA
NDAI0B04340        NENAIKYYEYALRLD-QDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRA
Suva_15.314        FGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRA
Skud_8.178         FDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRA
Smik_8.195         FTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRA
YHR117W            FNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRA
KAFR0F00720        YENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRA
KNAG0H03530        VEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRA
NCAS0B07010        YTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRA
CAGL0L12936g       FEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRA
TBLA0C05530        FEEAIKYYNWAIELK-ENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRA
TPHA0I01510        FENALKYYNYALTLK-QDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRA
Smik_14.207        YDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA
YNL121C            YDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA
Suva_14.219        YDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA
Skud_14.211        YDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRA
KLLA0F24046g       FEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRA
Kpol_1048.21       YEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRA
ABR131W            YEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRA
Ecym_8204          YEEAIKYYSCALRLK-KDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRA
SAKL0E10956g       FDDAIKYYNLALELK-KDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRA
KLTH0B05170g       YDEAIQYYSWAIEVK-EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRA
Kwal_33.14767      FEDALKYYSLAIEVK-EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRA
ZYRO0G06512g       YDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA
TDEL0B05140        YDNALKYYNYALVVK-KDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRA
NDAI0F02810        FEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRA
NCAS0G02480        FENAIKYYTFALSLK-EDPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRA
                     .*:::*  *: .  .:*::::* :*.: .    .: ::  . ** :.  .**  :.**

CAGL0L04048g       AVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEAS-------
NDAI0B04340        NAYEALGNNKEALYDFSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNK-K-----
Suva_15.314        SANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGD-----
Skud_8.178         SANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSG-----
Smik_8.195         SANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKGDG-----
YHR117W            SANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEG-----
KAFR0F00720        TANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNP-S-----
KNAG0H03530        NTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQD-----
NCAS0B07010        SANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERM--N-K-----
CAGL0L12936g       SAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDM--GID-----
TBLA0C05530        NANEKLENYADAMFDLSVLSLNGDYNGASIEPILERNLNKQAMSVLKDKL--K-N-----
TPHA0I01510        SAYESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKI--A-E-----
Smik_14.207        SANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKF--G-DIDTAT
YNL121C            SANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKF--G-DIDTAT
Suva_14.219        SANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF--G-DIDAAT
Skud_14.211        SANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF--G-DVDAAT
KLLA0F24046g       SAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKEN-Q-----
Kpol_1048.21       SANENLENFAEAMFDLSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKM--S-S-----
ABR131W            TANESLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKL--S-G-----
Ecym_8204          TANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKL--A-D-----
SAKL0E10956g       SANESLGNYADAMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKL--E-E-----
KLTH0B05170g       SANESLGNFADAMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKL--E-K-----
Kwal_33.14767      SANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKL--E-K-----
ZYRO0G06512g       SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKL--G-Q-----
TDEL0B05140        SANESLENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKL--G-N-----
NDAI0F02810        LAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKI--S-A-----
NCAS0G02480        NAYEKLGNFGDAMFDLSVCSLNTDMSDASIEPILERNLNQQAMFVLNTKL--GVT-----
                    . * : .  :*: *::  **    .   :: :::* ::: :   *              

CAGL0L04048g       ---------------EKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKI---LSDAL
NDAI0B04340        ---------------TDNFILLSDSALVSFFGIFPPETTITNYNPDDEADKE---LVQGL
Suva_15.314        --------------DKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEAL
Skud_8.178         --------------DRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEAL
Smik_8.195         ---------------RGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDAL
YHR117W            ---------------RGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDAL
KAFR0F00720        ---------------KNESELPSNTSMASFFSIFTPEISFDSYDEESDADKE---LLNGL
KNAG0H03530        ---------------KFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRT---LQTGL
NCAS0B07010        ----------MTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVE---LLTGL
CAGL0L12936g       ------ASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIPAYDESNEADVT---LVRGL
TBLA0C05530        ---------------SKDDQLPSDTSLSAFFGIFKPELSFENYDETNDADKE---LLNGL
TPHA0I01510        ---------------NKPQLLPSNTSLASFFGVFKPEVSLNNFNENSESEKE---LLNGL
Smik_14.207        ATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKD---LMNGL
YNL121C            ATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKE---LMNGL
Suva_14.219        ATPTELSTQPPKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKE---LMNGL
Skud_14.211        ATPTELSTQPPKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKE---LMDGL
KLLA0F24046g       ---------------GKESPLPSNTSLASFFGIFNPETSFDDYDGENEADVE---LKKGL
Kpol_1048.21       ---------------DAKQQLPSNTFLASFFGIFTPETTLKNFDESNEADVE---LLNAL
ABR131W            ---------------GEKHELPSNTSLASFFRIFPSETSLENYDETSEADRI---LLKGL
Ecym_8204          ---------------GSKHQLPSNTSLASFFGIFPSETSFANYDEQSEADNF---LLKGL
SAKL0E10956g       ---------------KKDHRLPSNTSLASFFGIFEPETSFENYDESVEADRL---LLQGL
KLTH0B05170g       ---------------QQEYKLPSNTSLASFFGIFQPETTFENYDDNSEADKY---LLEGL
Kwal_33.14767      ---------------QQEYKLPSNTSLASFFGIFQPETSFENYDENSEADKA---LLDGL
ZYRO0G06512g       ---------------QKNQLLPSDTALASFFGIFTPETEFANYDETSEADQK---LKAGL
TDEL0B05140        ---------------NVSQQLPSNTALASFFGIFPPETTFANYNENDEADVG---LKNGL
NDAI0F02810        ---------------NKEQNLPSSTPLASFFRVFKPETSFANYEESNEADRE---LMNGL
NCAS0G02480        ---------------DKKSQLPSNTALTSFFGIFKPELSFANYDDTCEGDKE---LLNGL
                                       * * : : :** :* .       .     :     *  .*

CAGL0L04048g       THLYSQTKEGYDRCDSEFTKATELYKAKL---ENDRTNSV----TNEKAAIAFEHTAILS
NDAI0B04340        EALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSG----LLEKVAIALEYSGVFK
Suva_15.314        QSLYSATSEGYLIADDLLTKATDEYHSLL---RANKEDRV----IRENAALAFCYAGIFQ
Skud_8.178         QRLYSATSEGYLIANALFTKATDAYHSLL---SASRVDGA----IRGNAALAFCYKGIFQ
Smik_8.195         QKLYSATNEGYLTADKLFTSATDAYHSLL----ASQVDGP----LKENAALAFCYTGIFH
YHR117W            QRLYSATDEGYLVANDLLTKSTDMYHSLL---SANTVDDP----LRENAALALCYTGIFH
KAFR0F00720        KELYSAKTGCYEIAESSFNKSMELYKILL---ESTEDKET----ISKKFAIALEYVGIFN
KNAG0H03530        LELFAATHVGFVKADTCFNEAVNQYRELF---SKASDEEKLAQNLNEKFAIALEYSGIFK
NCAS0B07010        TNLFKRTDQGYLDADKNFVKASSLFMEEL---AKNPKDKH----LLEKTAIALEYNGIFR
CAGL0L12936g       KALYGATSDGYQLADECFAKAAKLYREQL----ANNNDAA----FKEKAATALEYLGIFD
TBLA0C05530        THLFKRQSESYLIADKSFMNALELYIKQL---EETPDDTD----LKVKASIAYEYAGIFN
TPHA0I01510        TNLYSRTNDGYLVADESFQKAVKLLEKEY---EENKENND----IKEKYAIALEYNGILK
Smik_14.207        TNLYKRSPESYDKADESFTKAVKLFDEQL---DKNNEDEK----SKEKLAISLEHTGIFK
YNL121C            SNLYKRSPESYDKADESFTKAARLFEEQL---DKNNEDEK----LKEKLAISLEHTGIFK
Suva_14.219        ANLYKRSPDSYDRADESFTKAVKLFEDQL---DKDNEDEK----VKEKLAISLEHTGIFK
Skud_14.211        ANLYKRSPESYDRADESFTKAAKLFEEQL---DKSNEDEK----LKEKLAISLEHTGIFK
KLLA0F24046g       ENLYKCQTGCYELADEEFTKAAELYKKEL---ESSPDNES----LKKKAAIAFEHVGIFK
Kpol_1048.21       VNLYKRKSESYLIADESFSKAAESYVKQL---EANPDDEV----LKEKTATALEYNGIFK
ABR131W            CALHARQAGSYEIADEAFTDAVEKFTAAH---EANPDNAA----LKQKLAIALEHVGILK
Ecym_8204          RCLSERKTGSYEMSDEYFNKAADLLSLSH---QADSEDPA----LRMKLAIALEHVGIFK
SAKL0E10956g       TNLYKRTSEGYDTADESFTKAAAAYKTLL---EESPENEI----LKQKAAIALEHVGIFK
KLTH0B05170g       TNLYKRTADGYETADLSFAKARDAFKVLL---EQNPEDAD----LKRKAAIALEHVGIFK
Kwal_33.14767      TNLYKRTSGGYEAADAAFSKARDEYKTLL---EHNSEDAS----LKQKAAIALEHVGIFK
ZYRO0G06512g       ENLYKRSSEGYQKADEFFSQAVDAYAKLR---EGNSDDAA----LKEKDAIALEHRGIFR
TDEL0B05140        EDLYKRSSEGYKLADEAFVKSASFFTNKL---SEFPDDAV----LKEKTAIALEHNGIFK
NDAI0F02810        TNLYKNSEEGFQIADKSFLKAAELFKDQL---SQNKDNEA----IKEKTAIALEYSGILY
NCAS0G02480        KNLYRCTAEGYETADLSFTKATEYFLKQL---SETPDDET----VKEKTAIALEHQGIFK
                     *       :  .:  : .:                .         : : :  : .:: 

CAGL0L04048g       FLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEE---YYSNFQKAIDLDPNMA
NDAI0B04340        FLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYFKYFDKATTLNPNFA
Suva_15.314        FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQE---FFKFFQNAIDLDPEYP
Skud_8.178         FLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQE---FFSFFQKAIDLDPEYS
Smik_8.195         FLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQE---FFKYFQKAIDLDSEYP
YHR117W            FLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQE---FFKFFQKAVDLNPEYP
KAFR0F00720        FLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDE---SNKYFDEALKLDPNCS
KNAG0H03530        FLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE---YVTNFDKALELNPNSS
NCAS0B07010        FLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQE---YSKYFDKALELNPDSL
CAGL0L12936g       FLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSED---YFSYFEKAIALDPNNA
TBLA0C05530        FLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQD---YLDYFDKALKLDDKSC
TPHA0I01510        FLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEE---SIKNFDAAINLDATNA
Smik_14.207        FLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLDSNNS
YNL121C            FLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLDSNNS
Suva_14.219        FLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLDLNNS
Skud_14.211        FLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLNPNNS
KLLA0F24046g       FFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQ---YKEYFDKALELDPNCS
Kpol_1048.21       FLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKN---YFDFFDKALDVDPNSA
ABR131W            FLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADE---YAQNFEKALELDPKSS
Ecym_8204          FLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE---YLQYFDKALELAPNSS
SAKL0E10956g       FLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATE---YFENFDKALELDPNCA
KLTH0B05170g       FLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATE---YFDNFEKALKLDPSCA
Kwal_33.14767      FLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATE---YFDNFEKALELDPNCA
ZYRO0G06512g       FLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEE---YYEFFDKAIKLDPKNA
TDEL0B05140        FLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEE---YYQYFDKAIALDPNYG
NDAI0F02810        YMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSE---YLQNFDKALELEPNNP
NCAS0G02480        FLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDN---YFANYEKAMKLDDKNA
                   ::. :   :   .  ::   *  .:*:: .:  :*     :       :: *  :     

CAGL0L04048g       AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA
NDAI0B04340        PTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYYNSTFKKCQELFDEA
Suva_15.314        PTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA
Skud_8.178         PTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNET
Smik_8.195         PTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNET
YHR117W            PTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNET
KAFR0F00720        PIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELA
KNAG0H03530        ATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEA
NCAS0B07010        SVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDET
CAGL0L12936g       AVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEA
TBLA0C05530        AVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETLFSEA
TPHA0I01510        ATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCETLFSEA
Smik_14.207        SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
YNL121C            SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
Suva_14.219        SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
Skud_14.211        SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
KLLA0F24046g       AVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEA
Kpol_1048.21       PVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCETLFSEA
ABR131W            AAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEA
Ecym_8204          AVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEA
SAKL0E10956g       AVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCETLFSEA
KLTH0B05170g       AVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSETLFSEA
Kwal_33.14767      AVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEA
ZYRO0G06512g       AVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEA
TDEL0B05140        PAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCETLFSEA
NDAI0F02810        AIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEA
NCAS0G02480        ALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLFSEA
                   . ****.*   :  .: ::   * * :.    .: .*** **: : :  :  .:  *. :

CAGL0L04048g       RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESK---SENIHVGIAPLVGKATT
NDAI0B04340        RTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETA---YKYIHVGIAPLIGKAAA
Suva_15.314        KLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEV---QKKIHVGIGPLIGKATI
Skud_8.178         KLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEV---QRKIHVGIGPLIGKATI
Smik_8.195         KLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEV---QEKIHVGIGPLIGKATI
YHR117W            KLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEV---QEKIHVGIGPLIGKATI
KAFR0F00720        RKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENT---QKSIHVGIAPLIGKATA
KNAG0H03530        REKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATV
NCAS0B07010        RQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKA---QKNIHVGIAPLVGKATV
CAGL0L12936g       RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESL---QKQIHVGIAPLVGKATI
TBLA0C05530        KRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEA--SKDGIHVGVAPLIGKATL
TPHA0I01510        RRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEA---VEGIHVGIAPMIGKATL
Smik_14.207        KRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENK---LDGIYVGIAPLVGKATL
YNL121C            KRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENK---LDGIYVGIAPLVGKATL
Suva_14.219        KRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENK---LEGIYVGIAPLVGKATL
Skud_14.211        KRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENK---LDRIYVGIAPLVGKATL
KLLA0F24046g       RRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDA---LPGIHVGIAPMIGKATA
Kpol_1048.21       KRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEES---LDAIHVGVSPLVGKATL
ABR131W            RRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDA---QEGIHVGVAPLVGKAAL
Ecym_8204          RRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDA---QEGIHVGVAPLVGKATV
SAKL0E10956g       RRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDA---LDGIHVGIAPLVGKATL
KLTH0B05170g       RRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDA---LDGIHVGVSPLIGKATL
Kwal_33.14767      RRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESA---LDGIHVGVSPLIGKATL
ZYRO0G06512g       KRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEA---VDGIHVGISPLVGKATL
TDEL0B05140        KRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEA---LDGIHVGVAPLVGKATL
NDAI0F02810        RRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAK--TPEEIHVGIAPLIGKATL
NCAS0G02480        RRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKK---QDAVHVGIAPLVGKATL
                   .  *.  .*:* * .: *  ...   *  ::: .  *:        : **:.*::***: 

CAGL0L04048g       LLKYPTV-------ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEE
NDAI0B04340        LARIPTQ-------ENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAIALFEE
Suva_15.314        LARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQE
Skud_8.178         LARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQD
Smik_8.195         LARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQD
YHR117W            LARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFED
KAFR0F00720        LARQPTP-------ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEK
KNAG0H03530        LARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEE
NCAS0B07010        LARQPNL-------LNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK
CAGL0L12936g       LARQPTP-------ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEE
TBLA0C05530        LAREPTL-------ENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEE
TPHA0I01510        LARNPIV-------ENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEE
Smik_14.207        LTRNPTV-------ENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEE
YNL121C            LTRNPTV-------ENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEE
Suva_14.219        LTRNPTV-------ENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEE
Skud_14.211        LTRNPTV-------ENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEE
KLLA0F24046g       LIRNPTV-------ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFED
Kpol_1048.21       LARQPTV-------ENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEE
ABR131W            LARQPSA-------SNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEA
Ecym_8204          LARQSHS-------GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEE
SAKL0E10956g       LAREPTV-------ENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEE
KLTH0B05170g       LSREPSV-------ENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEE
Kwal_33.14767      LSREPSV-------ENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEE
ZYRO0G06512g       LARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEE
TDEL0B05140        LARQPSV-------ENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEE
NDAI0F02810        LISKPTV-------ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEE
NCAS0G02480        LVRTPTV-------ENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFES
                   *   .          .:      :  *   *. **:. :.*.*  ** *.:* :* :*: 

CAGL0L04048g       AAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF
NDAI0B04340        TADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII--
Suva_15.314        SATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI--
Skud_8.178         SATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI--
Smik_8.195         SAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI--
YHR117W            SAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML--
KAFR0F00720        ASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM--
KNAG0H03530        AADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI--
NCAS0B07010        AADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI--
CAGL0L12936g       AAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF--
TBLA0C05530        SADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQNSF--
TPHA0I01510        AAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM--
Smik_14.207        SADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLREQGLM--
YNL121C            SADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLREQGLM--
Suva_14.219        SADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLREQGLM--
Skud_14.211        SADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLREQGLM--
KLLA0F24046g       AADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGLA--
Kpol_1048.21       ASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI--
ABR131W            AADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMVV-
Ecym_8204          ATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVVS-
SAKL0E10956g       AADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI--
KLTH0B05170g       AADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI--
Kwal_33.14767      AADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI--
ZYRO0G06512g       AASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI--
TDEL0B05140        AANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM--
NDAI0F02810        AAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM--
NCAS0G02480        AATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRASDFANL
                   ::  ..  ::*:** *****:*:*  :. :     *   ::   . .     

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L04048g
-----MSSDSNTVGFWVKNKKAVVASVATVSAVV---AAYFYYKQVQELK----------
---------------KSLDDGNDVGTASSKVEYK--------------------------
--------------Y--LMI-NDEPDIELMKLA---ETAEKNEYASELKKRGNAYFKVKD
YENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRA
AVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEAS-------
---------------EKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKI---LSDAL
THLYSQTKEGYDRCDSEFTKATELYKAKL---ENDRTNSV----TNEKAAIAFEHTAILS
FLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEE---YYSNFQKAIDLDPNMA
AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA
RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESK---SENIHVGIAPLVGKATT
LLKYPTV-------ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEE
AAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF
>NDAI0B04340
--MSGNDNPSSFKNFFINHRKLIITTITAGTAAF---GAYYYYNQLQKLQPSGSISKETA
GSTEKNTKNHDTINNDLNTSSPPPPISKSKKKKLKKKLKKNHQKTDENNNNNNNSQSTSS
ASSSNSASPILKPSY--PLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKD
NENAIKYYEYALRLD-QDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRA
NAYEALGNNKEALYDFSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNK-K-----
---------------TDNFILLSDSALVSFFGIFPPETTITNYNPDDEADKE---LVQGL
EALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSG----LLEKVAIALEYSGVFK
FLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYFKYFDKATTLNPNFA
PTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYYNSTFKKCQELFDEA
RTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETA---YKYIHVGIAPLIGKAAA
LARIPTQ-------ENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAIALFEE
TADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII--
>Suva_15.314
------MAENSFSKFFARNKLAIVATVSAGAAAV---GAYVYYHQLKQQQQHHQQQLKGT
KDRQRQGEALPGQDGEEELGLKEDGSAAADSNKKKKKKNRR-------------------
-KKKSKPKSAEDVEY--PLLPHGEPDMDRLRGL---SAPQRQAFAVQLKDKGNHFFTAKS
FGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRA
SANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGD-----
--------------DKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEAL
QSLYSATSEGYLIADDLLTKATDEYHSLL---RANKEDRV----IRENAALAFCYAGIFQ
FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQE---FFKFFQNAIDLDPEYP
PTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEA
KLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEV---QKKIHVGIGPLIGKATI
LARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQE
SATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI--
>Skud_8.178
------MAENSLLKFIAKNKVAILATVSAGTAAV---GAYAYYKQLKQRE----QQQLKG
TKNRRRPGETFTSQNEDEVSLKDDGSITSGSRKRKKNKRKR-------------------
---KNKPKLAESFEY--PLLSDGEPDMAQLRGL---PLSQRQEYAVQLKDKGNHFFTSKN
FDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRA
SANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSG-----
--------------DRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEAL
QRLYSATSEGYLIANALFTKATDAYHSLL---SASRVDGA----IRGNAALAFCYKGIFQ
FLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQE---FFSFFQKAIDLDPEYS
PTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNET
KLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEV---QRKIHVGIGPLIGKATI
LARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQD
SATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI--
>Smik_8.195
------MAENSLFRFIARNKVAILATVSAGTAAV---GAYVYYQQLKQQQ----QQHLKG
SKDHRRQSEASTNLKEDEVGLKNKSSIANENKKKKNKRKRK-------------------
----NRAKSAEDFQC--TFLPNGEPDISQLKGL---TLSQKQTYAVQLKNKGNHFFTTKN
FTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRA
SANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKGDG-----
---------------RGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDAL
QKLYSATNEGYLTADKLFTSATDAYHSLL----ASQVDGP----LKENAALAFCYTGIFH
FLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQE---FFKYFQKAIDLDSEYP
PTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNET
KLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEV---QEKIHVGIGPLIGKATI
LARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQD
SAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI--
>YHR117W
------MAENSLLRFITKNKVAILATVSAGTAAV---GAYVYYQQIKQQQ----QQQLKG
TKDNRRQSEAFAGQNEDEADLKDDGSVVSGSNKRKKKKNKR-------------------
-KRNNKAKSGEGFDY--PSLPNGEPDIAQLKGL---SPSQRQAYAVQLKNRGNHFFTAKN
FNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRA
SANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEG-----
---------------RGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDAL
QRLYSATDEGYLVANDLLTKSTDMYHSLL---SANTVDDP----LRENAALALCYTGIFH
FLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQE---FFKFFQKAVDLNPEYP
PTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNET
KLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEV---QEKIHVGIGPLIGKATI
LARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFED
SAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML--
>KAFR0F00720
MPTDSGASQGGIGSFITRHRTAILATLAAGATAA---SAYYYYNNLRELK----------
-------------DLKDHDKQAEDKSENATEKKLASKPKKK-------------------
-------KVSKASQF--PAKENGEPDFTGVDNL---TADQKDKWAIELKDKGNEYFKEKD
YENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRA
TANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNP-S-----
---------------KNESELPSNTSMASFFSIFTPEISFDSYDEESDADKE---LLNGL
KELYSAKTGCYEIAESSFNKSMELYKILL---ESTEDKET----ISKKFAIALEYVGIFN
FLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDE---SNKYFDEALKLDPNCS
PIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELA
RKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENT---QKSIHVGIAPLIGKATA
LARQPTP-------ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEK
ASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM--
>KNAG0H03530
---MSTASDNSVAAFFARNKRAILATVAAGTAAA---GAYYYYTQVQQQL----------
-------------DRDGASAKGSKKKSKKKSGSKKKQEKKT-------------------
------ELATETPVY--PITASGEPDLSQLDSY---TPEQRETYALALKDKGNELFKEKA
VEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRA
NTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQD-----
---------------KFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRT---LQTGL
LELFAATHVGFVKADTCFNEAVNQYRELF---SKASDEEKLAQNLNEKFAIALEYSGIFK
FLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE---YVTNFDKALELNPNSS
ATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEA
REKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATV
LARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEE
AADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI--
>NCAS0B07010
----MSSNDHPVGGFLTRNRTAIVATVAAGSAAI---GAFYYYHHLQQTH----------
---TSLEGEEDGNSTGRNPVNDEAHLSKNQKKKQRKKHKKK------------------A
TPDQTTATADVLTSY--PTNDSNDPDMIQITSL---PLEEQKKISMQLKDKGNKYFKAKD
YTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRA
SANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERM--N-K-----
----------MTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVE---LLTGL
TNLFKRTDQGYLDADKNFVKASSLFMEEL---AKNPKDKH----LLEKTAIALEYNGIFR
FLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQE---YSKYFDKALELNPDSL
SVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDET
RQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKA---QKNIHVGIAPLVGKATV
LARQPNL-------LNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK
AADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI--
>CAGL0L12936g
-------------MALLKNRKAVVATVAAVATAAAAASAYYYYSNVRATT----------
-----------------------EKSKKDKKKKNKKKKKAT-------------------
----ASEPATSDKAYLTINGDEEKPDMAAMLAS---SEDQKKVYATALKDKGNALFKEKR
FEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRA
SAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDM--GID-----
------ASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIPAYDESNEADVT---LVRGL
KALYGATSDGYQLADECFAKAAKLYREQL----ANNNDAA----FKEKAATALEYLGIFD
FLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSED---YFSYFEKAIALDPNNA
AVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEA
RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESL---QKQIHVGIAPLVGKATI
LARQPTP-------ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEE
AAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF--
>TBLA0C05530
-----MSVDNSWVTFYQRNKRAILATVAAGTAAA---GAYYYYKQLQNAQ----------
-----------DNLKDNKASSTASGESSSKKKKKKKKSKSA-------------------
-KELSPATTDGKPIY--PVRDNGEPNLDNKDQF---TEEEKEKYSIALKDKGNSLFKADK
FEEAIKYYNWAIELK-ENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRA
NANEKLENYADAMFDLSVLSLNGDYNGASIEPILERNLNKQAMSVLKDKL--K-N-----
---------------SKDDQLPSDTSLSAFFGIFKPELSFENYDETNDADKE---LLNGL
THLFKRQSESYLIADKSFMNALELYIKQL---EETPDDTD----LKVKASIAYEYAGIFN
FLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQD---YLDYFDKALKLDDKSC
AVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETLFSEA
KRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEA--SKDGIHVGVAPLIGKATL
LAREPTL-------ENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEE
SADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQNSF--
>TPHA0I01510
----MSASDGSVGGFIARNKTAIIATVAAGSAAL---GAYYYYTQLQRQI----------
---------------DDSSSSKKKKKKHSKKKKSTSTDEKS-------------------
----NSKNETAKVIY--PVASNGEPDLSGKDSF---SDELKEKYAMALKDKGNDYFKKQD
FENALKYYNYALTLK-QDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRA
SAYESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKI--A-E-----
---------------NKPQLLPSNTSLASFFGVFKPEVSLNNFNENSESEKE---LLNGL
TNLYSRTNDGYLVADESFQKAVKLLEKEY---EENKENND----IKEKYAIALEYNGILK
FLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEE---SIKNFDAAINLDATNA
ATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCETLFSEA
RRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEA---VEGIHVGIAPMIGKATL
LARNPIV-------ENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEE
AAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM--
>Smik_14.207
-----------MKNFISKNKTAILATIAATGTAL---GAYYYYSQLQQQQ----------
-------------QQGKKNTITKDDKKEVKGSQKKTKDGSE-------------------
-----STAESNTPVY--PVSSNGDPDFSNKANF---TAEEKDRYALALKDKGNQFFRNKK
YDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA
SANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKF--G-DIDTAT
ATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKD---LMNGL
TNLYKRSPESYDKADESFTKAVKLFDEQL---DKNNEDEK----SKEKLAISLEHTGIFK
FLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLDSNNS
SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
KRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENK---LDGIYVGIAPLVGKATL
LTRNPTV-------ENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEE
SADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLREQGLM--
>YNL121C
-----------MKSFITRNKTAILATVAATGTAI---GAYYYYNQLQQQQ----------
-------------QRGKKNTINKDEKKDTKDSQKETEGAKK-------------------
-----STAPSNPPIY--PVSSNGEPDFSNKANF---TAEEKDKYALALKDKGNQFFRNKK
YDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA
SANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKF--G-DIDTAT
ATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKE---LMNGL
SNLYKRSPESYDKADESFTKAARLFEEQL---DKNNEDEK----LKEKLAISLEHTGIFK
FLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLDSNNS
SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
KRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENK---LDGIYVGIAPLVGKATL
LTRNPTV-------ENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEE
SADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLREQGLM--
>Suva_14.219
-----------MKSFISKNKTAILATIAATGTAV---GAYYYYTQLQQQQ----------
-------------QQGKKETLSRDEKKEAKGSQKKSEGSKK-------------------
-----SAGESKPPIY--PVAANGEPDFSKKADF---TAEEKDKYALALKDKGNQYFRNKK
YDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA
SANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF--G-DIDAAT
ATPTELSTQPPKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKE---LMNGL
ANLYKRSPDSYDRADESFTKAVKLFEDQL---DKDNEDEK----VKEKLAISLEHTGIFK
FLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLDLNNS
SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
KRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENK---LEGIYVGIAPLVGKATL
LTRNPTV-------ENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEE
SADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLREQGLM--
>Skud_14.211
-----------MKSFISKNKTAILATIGATGAAV---GAYYYYTQLQQQQ----------
-------------QRGKKDTITKDEKKDVKGSQKKAEGSKK-------------------
-----TASESKAPVY--PVSSNGEPDFSKKANF---TAEEKDKYALALKDKGNQYFRNKK
YDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRA
SANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF--G-DVDAAT
ATPTELSTQPPKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKE---LMDGL
ANLYKRSPESYDRADESFTKAAKLFEEQL---DKSNEDEK----LKEKLAISLEHTGIFK
FLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTE---YYNYFDKALKLNPNNS
SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA
KRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENK---LDRIYVGIAPLVGKATL
LTRNPTV-------ENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEE
SADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLREQGLM--
>KLLA0F24046g
------MSDNSVSSFVTRNKTAILATAAAGGAAI---GAYYYYNQLQRAE----------
------------------LGSGSSGSKKTSKSEKKKRAGKK-------------------
KKDSSSSSNGSDVVY--PVDANGQPDLSKKDEF---TPEQVDKYALALKDKGNEFFKAKD
FEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRA
SAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKEN-Q-----
---------------GKESPLPSNTSLASFFGIFNPETSFDDYDGENEADVE---LKKGL
ENLYKCQTGCYELADEEFTKAAELYKKEL---ESSPDNES----LKKKAAIAFEHVGIFK
FFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQ---YKEYFDKALELDPNCS
AVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEA
RRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDA---LPGIHVGIAPMIGKATA
LIRNPTV-------ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFED
AADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGLA--
>Kpol_1048.21
-----MSSDNSIGAFVARNKTAIIATVAAGTTAV---AAYYYYSQLQQQQ----------
-------------------QQQQKGSDDSVSKKKKKNKKKK-------------------
-----NSSSSAKPCY--PIDSNGEPDLKDSANF---TEEQKETYSVALKDKGNQFFKEQK
YEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRA
SANENLENFAEAMFDLSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKM--S-S-----
---------------DAKQQLPSNTFLASFFGIFTPETTLKNFDESNEADVE---LLNAL
VNLYKRKSESYLIADESFSKAAESYVKQL---EANPDDEV----LKEKTATALEYNGIFK
FLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKN---YFDFFDKALDVDPNSA
PVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCETLFSEA
KRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEES---LDAIHVGVSPLVGKATL
LARQPTV-------ENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEE
ASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI--
>ABR131W
-----MSSENSFAGFVSRNRTAIIATAAAGASAV---GAYYYYQQLQRQS----------
---------------SGEVSKDATGSTDVKSKKKKKRNNKK-------------------
-------------KY--PVDQNGEPDLSGMATF---TEEQKEKYAMALKDKGNECFKDQR
YEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRA
TANESLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKL--S-G-----
---------------GEKHELPSNTSLASFFRIFPSETSLENYDETSEADRI---LLKGL
CALHARQAGSYEIADEAFTDAVEKFTAAH---EANPDNAA----LKQKLAIALEHVGILK
FLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADE---YAQNFEKALELDPKSS
AAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEA
RRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDA---QEGIHVGVAPLVGKAAL
LARQPSA-------SNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEA
AADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMVV-
>Ecym_8204
-----MSSDNSFAGFISRNKTAIIATAAAGASAV---GAYYYYQQLQQQV----------
-------------ESQGKVGGVNSPSGETRYGKKKKKRANK-------------------
------------KKY--PVDSNGEPDLSGVDSF---TEEQKERYSMAMKDKGNECFKEKK
YEEAIKYYSCALRLK-KDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRA
TANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKL--A-D-----
---------------GSKHQLPSNTSLASFFGIFPSETSFANYDEQSEADNF---LLKGL
RCLSERKTGSYEMSDEYFNKAADLLSLSH---QADSEDPA----LRMKLAIALEHVGIFK
FLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE---YLQYFDKALELAPNSS
AVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEA
RRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDA---QEGIHVGVAPLVGKATV
LARQSHS-------GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEE
ATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVVS-
>SAKL0E10956g
-----MSSDNSLANFVSRNKTAIIATAAAGVSAA---GAYYYYKQLQQQR----------
------------------LSSDDASDGEAKPLKKKKKSKKK-------------------
---KPTSGSPTASAY--PVDENGEPKLDDIDQL---TDEQKEKYAMGLKDKGNEFFKEKK
FDDAIKYYNLALELK-KDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRA
SANESLGNYADAMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKL--E-E-----
---------------KKDHRLPSNTSLASFFGIFEPETSFENYDESVEADRL---LLQGL
TNLYKRTSEGYDTADESFTKAAAAYKTLL---EESPENEI----LKQKAAIALEHVGIFK
FLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATE---YFENFDKALELDPNCA
AVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCETLFSEA
RRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDA---LDGIHVGIAPLVGKATL
LAREPTV-------ENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEE
AADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI--
>KLTH0B05170g
-----MSSDNSFGQFVARNKTAIVASVAAGATAV---GAYYYYQQLQRQP----------
-------------------ANKKEPESESKSSKKKKKTKKK-------------------
---------APGPSY--PVNEKGEPDLSNLAEL---SDEQKDKYAMGLKDKGNEFFKNKK
YDEAIQYYSWAIEVK-EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRA
SANESLGNFADAMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKL--E-K-----
---------------QQEYKLPSNTSLASFFGIFQPETTFENYDDNSEADKY---LLEGL
TNLYKRTADGYETADLSFAKARDAFKVLL---EQNPEDAD----LKRKAAIALEHVGIFK
FLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATE---YFDNFEKALKLDPSCA
AVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSETLFSEA
RRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDA---LDGIHVGVSPLIGKATL
LSREPSV-------ENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEE
AADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI--
>Kwal_33.14767
-----MSSENSLGQFVARNKTAIVASVAAGATAV---GAYYYYQQLQKKP----------
------------------FEDGKEVGDEPKPSKKKKKGKKK-------------------
---------TQGPSF--PVDEKGEPDLGKVDEL---SAEEKDKFAMGLKDKGNEFFKNKQ
FEDALKYYSLAIEVK-EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRA
SANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKL--E-K-----
---------------QQEYKLPSNTSLASFFGIFQPETSFENYDENSEADKA---LLDGL
TNLYKRTSGGYEAADAAFSKARDEYKTLL---EHNSEDAS----LKQKAAIALEHVGIFK
FLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATE---YFDNFEKALELDPNCA
AVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEA
RRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESA---LDGIHVGVSPLIGKATL
LSREPSV-------ENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEE
AADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI--
>ZYRO0G06512g
-----MSSDNSVAGFISRNKTAIITTAAAGTAAV---GAYLYYRQLQDAA----------
-------------GSDDKKGESPDGTAASKKKRKNKKKKQG-------------------
----SSPSPSAAVSY--PVDEKGEPKLDNVAEM---SEEQKESWSTALKDKGNEFFKQKD
YDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA
SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKL--G-Q-----
---------------QKNQLLPSDTALASFFGIFTPETEFANYDETSEADQK---LKAGL
ENLYKRSSEGYQKADEFFSQAVDAYAKLR---EGNSDDAA----LKEKDAIALEHRGIFR
FLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEE---YYEFFDKAIKLDPKNA
AVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEA
KRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEA---VDGIHVGISPLVGKATL
LARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEE
AASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI--
>TDEL0B05140
-----MSSDNSVSSFVSRNKTAIIATAAAGSAAI---GAYYYYRQAQRAA----------
------------------LDEDEKGAEGSESSKKKKKNKKK-------------------
----KSGENGGTPVY--PVGQNGEPLLENIEEL---SQELRETYATALKDRGNEFFKKKD
YDNALKYYNYALVVK-KDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRA
SANESLENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKL--G-N-----
---------------NVSQQLPSNTALASFFGIFPPETTFANYNENDEADVG---LKNGL
EDLYKRSSEGYKLADEAFVKSASFFTNKL---SEFPDDAV----LKEKTAIALEHNGIFK
FLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEE---YYQYFDKAIALDPNYG
PAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCETLFSEA
KRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEA---LDGIHVGVAPLVGKATL
LARQPSV-------ENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEE
AANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM--
>NDAI0F02810
-----MSSDNSIKGFVSRNRTAIIATIAAGTTAV---GAYYYYTQLQAQQ----------
-------------QENVRPKEDTDKSTATKKEKKKSKGKES------------------K
K-PQEDTPTTKKPIY--LVDSNGEPNLSDIDSL---TEETKNEWAMALKDKGNELFKTSK
FEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRA
LAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKI--S-A-----
---------------NKEQNLPSSTPLASFFRVFKPETSFANYEESNEADRE---LMNGL
TNLYKNSEEGFQIADKSFLKAAELFKDQL---SQNKDNEA----IKEKTAIALEYSGILY
YMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSE---YLQNFDKALELEPNNP
AIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEA
RRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAK--TPEEIHVGIAPLIGKATL
LISKPTV-------ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEE
AAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM--
>NCAS0G02480
-----MSSNNSMRDFISRNKTAIIATVAAGTAAV---GAYMYYAQLQQQH----------
---------------EKKPAKKTKKSKKSVTEEEKKK-----------------------
---------EEPPIY--PIDANGEPVLGDVDLL---NDKTKEEWAGALKEKGNALFKKKD
FENAIKYYTFALSLK-EDPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRA
NAYEKLGNFGDAMFDLSVCSLNTDMSDASIEPILERNLNQQAMFVLNTKL--GVT-----
---------------DKKSQLPSNTALTSFFGIFKPELSFANYDDTCEGDKE---LLNGL
KNLYRCTAEGYETADLSFTKATEYFLKQL---SETPDDET----VKEKTAIALEHQGIFK
FLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDN---YFANYEKAMKLDDKNA
ALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLFSEA
RRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKK---QDAVHVGIAPLVGKATL
LVRTPTV-------ENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFES
AATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRASDFANL