MUSCLE (3.8) multiple sequence alignment

TBLA0B01240        ------------------------------------------------------MTAKAP
KNAG0H03520        ------------------------------------------------------MSDGNG
NCAS0B07000        ------------------------------------------------------MGEQEQ
Suva_15.313        -----------------------------------------------MGSNTSNSTTTTT
Skud_8.177         -------------------------------------------------MANDTSGATNA
Smik_8.194         --------------------------------------------------MTKDTSDTTN
YHR116W            ----------------------------MEKPSPTRRQTSSLSTISNGMTMTNDNRDTTN
TDEL0B05150        ------------------------------------------------------MSNARP
TPHA0F01870        MYVVTDKWINNASTLPFLPIESISAFSNITIRLKQRSFHHIRLHSASINTNQYLATMSDD
NDAI0B04330        -----------------------------------------------------MSTTSEA
ABR130W            -----------------------------------------------------MPVDTAA
KAFR0F00730        ------------------------------------------------------MSKKEP
Kpol_505.20        ------------------------------------------------------MSKESK
ZYRO0G06534g       ------------------------------------------------------MADGDK
Ecym_8205          ------------------------------------------------------MSKEPP
CAGL0I02728g       ------------------------------------------------------MAADED
KLLA0F24024g       ------------------------------------------------------MTDKQE
SAKL0E10934g       ------------------------------------------------------MSNESQ
KLTH0B05148g       -------------------------------------------------------MEKEP
Kwal_33.14776      ------------------------------------------------------MAEENQ
                                                                               

TBLA0B01240        TQSSP------ESNPAKQLENGSVVQNDPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRF
KNAG0H03520        KGDT---------------PAVEGV-SGKETVDFAPL--GGNPDEFRYFPDTPDSITHKY
NCAS0B07000        PEEKG------------------NNSNRKQDVNFTPD--EKNPGSYKYFPDDPVQGLNKY
Suva_15.313        TATSKDSSESSDNSAPPTQPARRGPVTDRSKVNYVPQ--SNDPSSFQYYPDDPENPVNKY
Skud_8.177         ETDNGSSSINLEPSPPLAEPAPRGPITDRTKVNYVPK--NNDPSSFQYYPDDPENPINKY
Smik_8.194         INTTKIIDKDSQPSSSSVPATSKGPVTDRTKVNYVPK--SDDPSSFQYYPDDPENPVNKY
YHR116W            TNSGSTSSNNSQPSSSSTPPAASGPVTDRTKVNYVPK--SDDPSSFQYYPDDPENPVNKY
TDEL0B05150        EKPSE------DEKILSSEPNVNGAVKDSSKVDYAPK--GQDPSKFQYYPENPESGVNRL
TPHA0F01870        NHISNNNNGSNDITKDSYDPS--LV-TNKESVDFTKPDITLNENRFKFYPDNPESSFAKY
NDAI0B04330        NKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPD--EKDTSTFKYYPDDPEEGMNKY
ABR130W            PQSTA-----------NPDPS--VQ-TDRAAVNFTP---STDASSFQFYPDNLESPLARY
KAFR0F00730        EQDPK------------------LV-TDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRD
Kpol_505.20        DKLDS---------PSALDST--LE-TDKSKVDFANK---DDKKDLKFYPDNPESTLAKY
ZYRO0G06534g       DNLRE----------GNLDPQ--LV-VEPKKVDYAPQ--GDSPDKFQYYPDKPESSLSRY
Ecym_8205          KDHIP----------SQSPPKGNVV-TDKTKVNFTPT--SNDTSTFQFYPDDPEATLNRF
CAGL0I02728g       IIKDG-----------NYDPH--VQ-TDKDKVDYAPK--GVDTTEYRYYPDNPESTLNKY
KLLA0F24024g       TTQPAEKLQQPEKVAENVDPS--LE-LNKTKVNFTPE--KTDVNTYKFYPDDPESTLNRY
SAKL0E10934g       KVEPA---------PENSDPQ--LE-TDKEKVNFTPQ--ANDTSSFKFYPDNPESTLNKF
KLTH0B05148g       KTAPA----------ENADPQ--LQ-VDKTKVDYAPK--NTESGSFKFYPDNPESSFNKY
Kwal_33.14776      TKPAE-----------NADPQ--LQ-VDKSKIDYAPQ--DAKAGSYKFYPDNPESSFNKF
                                                  :.:.           .::*:       . 

TBLA0B01240        NFADKESSKFYDPCHESAQMSVRCMTDHPDDHKTVCAEFFAAYRDCKKAWIDAKKRGEY-
KNAG0H03520        KFQTKGDSKFYDPCQESSKMSFTCL-EQNDYDRSKCKAYFDAYRECKKQWLKARRANKS-
NCAS0B07000        KFIMKGDSEYYDPCQECSEMSRKCL-ERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRK-
Suva_15.313        KFALKGDSQYYDPCEESSKLSFQCL-ERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQ-
Skud_8.177         KFALKADSQYYDPCEESSKLSFQCL-ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQ-
Smik_8.194         KFALKADSQYYDPCEESSKLSFQCL-ERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQ-
YHR116W            KFALKADSQYYDPCEESSKLSFQCL-ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQ-
TDEL0B05150        MFAIKGPSQYYDPCQESAQMSLNCL-DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRS-
TPHA0F01870        RFMSKDSSQYYDPCDESAKMSFKCL-DMNDYDRDKCRAYFDAYRECKKQWLRARRNNEDG
NDAI0B04330        KFMMKDTSEYYDPCQESSQMSFKCL-DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRS-
ABR130W            RXAAKGPSQYXDPCQESANMSMKCL-ERNNYDRDLCREYFDAYRECKKQWLSARRKDNS-
KAFR0F00730        QFRTKQPTKYYDPCQESAQLSFKCL-ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRS-
Kpol_505.20        RFITKETSQYYDPCQESAQMSFNCL-DRNNYDKSKCRAYFDAYRECKKQWLRARRQDRS-
ZYRO0G06534g       RFAVKDASQYFDPCQESSRMSFNCL-DRNNYDREMCKEYFDAYRECKKQWLRARRENRS-
Ecym_8205          KFYSKGASMYYDPCEESSKMSFKCL-ELNNYDRSLCHDYFDAYRECKKQWLKARREDNS-
CAGL0I02728g       RFAMKDHSQYYDPCQESAKMSFKCL-ELNDYDRDQCKEYFDAYRECKKQWLEARRKDRT-
KLLA0F24024g       RFAVKGASEYYDPCQESSKMSFKCL-ELNNYDRDLCHDYFDAYRECKKQWLKARREKRE-
SAKL0E10934g       RFAAKDPSRYFDPCQESSKMSFKCL-EMNNYDRDMCKEYFDAYRECKKQWLQSRRENRS-
KLTH0B05148g       RFAAKDASQFYDPCQESSKMSMKCL-ELNNYDRSMCQEYFDAYRECKKQWLQARRRNRS-
Kwal_33.14776      RFAAKDVSQFYDPCQESSKMSMKCL-ELNDYDRSMCQEYFDAYRECKKQWLQARRKNRS-
                       *  : : *** *.: :*  *: :     .  *  :* ***:*** *: :..     

TBLA0B01240        ----
KNAG0H03520        QWE-
NCAS0B07000        QWEK
Suva_15.313        QWE-
Skud_8.177         QWE-
Smik_8.194         QWE-
YHR116W            QWE-
TDEL0B05150        QWE-
TPHA0F01870        NWGI
NDAI0B04330        QWQK
ABR130W            QWT-
KAFR0F00730        KWE-
Kpol_505.20        QWE-
ZYRO0G06534g       LWE-
Ecym_8205          KWQ-
CAGL0I02728g       NWS-
KLLA0F24024g       FWE-
SAKL0E10934g       QWE-
KLTH0B05148g       QWE-
Kwal_33.14776      QWE-
                       

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B01240
------------------------------------------------------MTAKAP
TQSSP------ESNPAKQLENGSVVQNDPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRF
NFADKESSKFYDPCHESAQMSVRCMTDHPDDHKTVCAEFFAAYRDCKKAWIDAKKRGEY-
----
>KNAG0H03520
------------------------------------------------------MSDGNG
KGDT---------------PAVEGV-SGKETVDFAPL--GGNPDEFRYFPDTPDSITHKY
KFQTKGDSKFYDPCQESSKMSFTCL-EQNDYDRSKCKAYFDAYRECKKQWLKARRANKS-
QWE-
>NCAS0B07000
------------------------------------------------------MGEQEQ
PEEKG------------------NNSNRKQDVNFTPD--EKNPGSYKYFPDDPVQGLNKY
KFIMKGDSEYYDPCQECSEMSRKCL-ERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRK-
QWEK
>Suva_15.313
-----------------------------------------------MGSNTSNSTTTTT
TATSKDSSESSDNSAPPTQPARRGPVTDRSKVNYVPQ--SNDPSSFQYYPDDPENPVNKY
KFALKGDSQYYDPCEESSKLSFQCL-ERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQ-
QWE-
>Skud_8.177
-------------------------------------------------MANDTSGATNA
ETDNGSSSINLEPSPPLAEPAPRGPITDRTKVNYVPK--NNDPSSFQYYPDDPENPINKY
KFALKADSQYYDPCEESSKLSFQCL-ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQ-
QWE-
>Smik_8.194
--------------------------------------------------MTKDTSDTTN
INTTKIIDKDSQPSSSSVPATSKGPVTDRTKVNYVPK--SDDPSSFQYYPDDPENPVNKY
KFALKADSQYYDPCEESSKLSFQCL-ERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQ-
QWE-
>YHR116W
----------------------------MEKPSPTRRQTSSLSTISNGMTMTNDNRDTTN
TNSGSTSSNNSQPSSSSTPPAASGPVTDRTKVNYVPK--SDDPSSFQYYPDDPENPVNKY
KFALKADSQYYDPCEESSKLSFQCL-ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQ-
QWE-
>TDEL0B05150
------------------------------------------------------MSNARP
EKPSE------DEKILSSEPNVNGAVKDSSKVDYAPK--GQDPSKFQYYPENPESGVNRL
MFAIKGPSQYYDPCQESAQMSLNCL-DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRS-
QWE-
>TPHA0F01870
MYVVTDKWINNASTLPFLPIESISAFSNITIRLKQRSFHHIRLHSASINTNQYLATMSDD
NHISNNNNGSNDITKDSYDPS--LV-TNKESVDFTKPDITLNENRFKFYPDNPESSFAKY
RFMSKDSSQYYDPCDESAKMSFKCL-DMNDYDRDKCRAYFDAYRECKKQWLRARRNNEDG
NWGI
>NDAI0B04330
-----------------------------------------------------MSTTSEA
NKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPD--EKDTSTFKYYPDDPEEGMNKY
KFMMKDTSEYYDPCQESSQMSFKCL-DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRS-
QWQK
>ABR130W
-----------------------------------------------------MPVDTAA
PQSTA-----------NPDPS--VQ-TDRAAVNFTP---STDASSFQFYPDNLESPLARY
RXAAKGPSQYXDPCQESANMSMKCL-ERNNYDRDLCREYFDAYRECKKQWLSARRKDNS-
QWT-
>KAFR0F00730
------------------------------------------------------MSKKEP
EQDPK------------------LV-TDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRD
QFRTKQPTKYYDPCQESAQLSFKCL-ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRS-
KWE-
>Kpol_505.20
------------------------------------------------------MSKESK
DKLDS---------PSALDST--LE-TDKSKVDFANK---DDKKDLKFYPDNPESTLAKY
RFITKETSQYYDPCQESAQMSFNCL-DRNNYDKSKCRAYFDAYRECKKQWLRARRQDRS-
QWE-
>ZYRO0G06534g
------------------------------------------------------MADGDK
DNLRE----------GNLDPQ--LV-VEPKKVDYAPQ--GDSPDKFQYYPDKPESSLSRY
RFAVKDASQYFDPCQESSRMSFNCL-DRNNYDREMCKEYFDAYRECKKQWLRARRENRS-
LWE-
>Ecym_8205
------------------------------------------------------MSKEPP
KDHIP----------SQSPPKGNVV-TDKTKVNFTPT--SNDTSTFQFYPDDPEATLNRF
KFYSKGASMYYDPCEESSKMSFKCL-ELNNYDRSLCHDYFDAYRECKKQWLKARREDNS-
KWQ-
>CAGL0I02728g
------------------------------------------------------MAADED
IIKDG-----------NYDPH--VQ-TDKDKVDYAPK--GVDTTEYRYYPDNPESTLNKY
RFAMKDHSQYYDPCQESAKMSFKCL-ELNDYDRDQCKEYFDAYRECKKQWLEARRKDRT-
NWS-
>KLLA0F24024g
------------------------------------------------------MTDKQE
TTQPAEKLQQPEKVAENVDPS--LE-LNKTKVNFTPE--KTDVNTYKFYPDDPESTLNRY
RFAVKGASEYYDPCQESSKMSFKCL-ELNNYDRDLCHDYFDAYRECKKQWLKARREKRE-
FWE-
>SAKL0E10934g
------------------------------------------------------MSNESQ
KVEPA---------PENSDPQ--LE-TDKEKVNFTPQ--ANDTSSFKFYPDNPESTLNKF
RFAAKDPSRYFDPCQESSKMSFKCL-EMNNYDRDMCKEYFDAYRECKKQWLQSRRENRS-
QWE-
>KLTH0B05148g
-------------------------------------------------------MEKEP
KTAPA----------ENADPQ--LQ-VDKTKVDYAPK--NTESGSFKFYPDNPESSFNKY
RFAAKDASQFYDPCQESSKMSMKCL-ELNNYDRSMCQEYFDAYRECKKQWLQARRRNRS-
QWE-
>Kwal_33.14776
------------------------------------------------------MAEENQ
TKPAE-----------NADPQ--LQ-VDKSKIDYAPQ--DAKAGSYKFYPDNPESSFNKF
RFAAKDVSQFYDPCQESSKMSMKCL-ELNDYDRSMCQEYFDAYRECKKQWLQARRKNRS-
QWE-