MUSCLE (3.8) multiple sequence alignment

KLTH0E16566g       ------------------------------------------MPFSSTATIHGDD-RLNR
Kwal_55.22221      ------------------------------------------MPFSATNAIHSDD-YLNR
KLLA0E21319g       -------------------------------------------MSLSTELVHADD-KHNR
ZYRO0F09768g       ------------------------------------------MVDLETLLLHGDD-EHNR
KNAG0C04990        ------------------------------------------MEHLATTLIHADD-RDNR
Kpol_1031.23       ------------------------------------------MVELSTLLIHADD-KNNR
TBLA0A03680        MAINS-------------------------------------EPDLETLLIHGDD-VNNR
SAKL0G02222g       ------------------------------------------MVSLPTTLIHADD-KDNR
CAGL0I01276g       MT----------------------------------------RQDLATTLIHGDD-IKNR
KAFR0E03860        ------------------------------------------MTHLGTSLIHADD-KDNR
Suva_15.308        ------------------------------------------MVDLSTALIHADD-KDNR
Skud_8.173         ------------------------------------------MVNLSTVLIHGDD-KDNR
Smik_8.190         MALCNTRYINVIYSSITSCNRYFLNVMDCIDVKADCVKRVSKMVDLSTSLIHGDD-KDNR
YHR112C            ------------------------------------------MVDLSTALIHGDD-KDNR
NDAI0B05590        ------------------------------------------MAHLSTALIHSDD-KDNR
NCAS0F03290        MIRYTLNTRSHLLKVAPRVARQLATR----------------PIHLSTTLIHGDD-KDNR
Ecym_5523          ------------------------------------------MAGLSTLLIHADDGVSDH
AER250C            ------------------------------------------MVELCTSLIHADD-NSNR
                                                                  *  :*.**   :.

KLTH0E16566g       VSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNADRLEVVLTEILDG
Kwal_55.22221      VSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDS
KLLA0E21319g       VTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAHPNSLRVESVLSKVLEG
ZYRO0F09768g       VTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLEALFSRFLGG
KNAG0C04990        VPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLAHPNSTRLESLFSQILGG
Kpol_1031.23       VTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREGHPNGTRLETLFSEYLGG
TBLA0A03680        VTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPNSSRLETLFSKILDG
SAKL0G02222g       VTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNATRLESIFSEILGG
CAGL0I01276g       VPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFSEILEG
KAFR0E03860        VSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPNATRLESLFSEILEG
Suva_15.308        VTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNSTRLESVFSDILDG
Skud_8.173         VTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESVFSEILDG
Smik_8.190         VTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLAHPNSTRLESIFSEILDG
YHR112C            VTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILDG
NDAI0B05590        VSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSEILDG
NCAS0F03290        VSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNG
Ecym_5523          VTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSREGHPNSNRCGSILSHALNG
AER250C            VNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPNGARCEVLLAEALGG
                   * *:..***:::*:**.   *            .   .*** .***. *   :::  * .

KLTH0E16566g       PTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGMEILPL--ENLEDKC
Kwal_55.22221      HAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL--EDIEAKC
KLLA0E21319g       EAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNWNLEQHKLEIDEILQHA
ZYRO0F09768g       HAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVERYGL--ADIEKHA
KNAG0C04990        HAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRTTGMQQCSL--DDVPQMA
Kpol_1031.23       HAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRNGMVKKYTL--DEIEQYA
TBLA0A03680        NAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTLKKHTH--KEIEEFA
SAKL0G02222g       HAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGMKQYPL--DRIEELA
CAGL0I01276g       HAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLIQRSL--DDIEEYA
KAFR0E03860        HAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGVEQYTL--DDIEKYA
Suva_15.308        YAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIKQHPL--EDIERYA
Skud_8.173         YAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARNYDVKQYPL--EDIEKYA
Smik_8.190         YAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRNYDIKQYPL--EDIEKYA
YHR112C            YAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQHPL--EDIEKCA
NDAI0B05590        HAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQTKQHTL--DEIEQFA
NCAS0F03290        HAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPL--EDIEKYA
Ecym_5523          YAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVRNYGLLKLGL--DEIEERA
AER250C            EAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQKLSL--EEVSERS
                    :: *  * ..: . :   :**.:*    ***    . :  *             :   .

KLTH0E16566g       QSGDLVHLEDPGNPYGEV-VNLDEFAEKIHRAGALMLVDSTLAPPPLRNTWEFGADIVMH
Kwal_55.22221      QEGDLVHIEDPINPFGET-VDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMH
KLLA0E21319g       GKGDVVHIETPVNPYGTS-FDIKAFADATHSKGAILVIDSTFAPPPLQNPWDFGVDVILH
ZYRO0F09768g       QKGDIVHVETPINPFGTS-LDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMH
KNAG0C04990        QPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPPPLQDPWRFGCDMVMH
Kpol_1031.23       EKGDIVHLESPVNPFGTS-YDIEAFAKRAHAKGALLLVDGTFAPPPLQNVWDFGADIVMH
TBLA0A03680        QKGDIVHLESPVNPYGTS-YDIEEFVKKAHSKGVLVMIDSTFAPPPLQYVWDFDVDIVMH
SAKL0G02222g       SEGDIVHLETPVNPFGTS-YDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIH
CAGL0I01276g       QKGDIVHIETPVNPFGTS-YDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMH
KAFR0E03860        QEGDIVEVESPMNPYGTS-IDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLH
Suva_15.308        AEGDIVHLESPVNPYGTS-YDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLY
Skud_8.173         SEGDIVHLESPVNPYGTS-YDIESLAHRAHTKGALLIVDSTFASPPLQYAWNFGADVVLY
Smik_8.190         SEGDIVHLETPVNPYGTS-SDIESLAHRAHAKGALLIVDSTFASPPLQYVWNFGADIVLY
YHR112C            SEGDIVHLESPVNPYGTS-SDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLY
NDAI0B05590        QPGDIVHLETPVNPFGTS-LDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMH
NCAS0F03290        QKGDIVHLETPVNPYGTS-LDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMH
Ecym_5523          QPGDMVHIESPMNPYGTA-VDIEEYVSKGHKKGAIVMIDSTFAPPPLQNAWEFGVDILMH
AER250C            EPGDLVHIESPINPYGTL-VDVAGIAAAAHEKGAYVVLDATFAPPPLQDRWEQGADVVVH
                     **:* :* * ** *    ::   .   *  *  : :*.*:..***.  *  . *::::

KLTH0E16566g       SGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRSLRTMEIRVLK
Kwal_55.22221      SGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRSLRTMDIRVRR
KLLA0E21319g       SATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAFLLLRSLRTFEMRIQT
ZYRO0F09768g       SATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRR
KNAG0C04990        SATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAYLLLRSLRTFELRIQR
Kpol_1031.23       SATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYLLLRSLRTFEMRIMK
TBLA0A03680        SATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLRSLRTFEMRILK
SAKL0G02222g       SCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRK
CAGL0I01276g       SATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILK
KAFR0E03860        SATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILK
Suva_15.308        SATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINK
Skud_8.173         SATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITK
Smik_8.190         SATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITK
YHR112C            SATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITK
NDAI0B05590        SATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLK
NCAS0F03290        SATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIER
Ecym_5523          SCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSYLLIRSLRTLELRVMK
AER250C            SCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVR
                   * **::.******.*:  . .      :  **  **:  ..*::.:*:**:*: .:*:  

KLTH0E16566g       QSSNCTRLVEYLASHKDRYNSVVKDIRHASLQK-EEFVKKQLPGGYGPVFSLLLFSQEQC
Kwal_55.22221      QSQNCTELVSYLANNSEKFSSVVQEIRHASLQT-EAFVKQQMPGGFGPVFALILKSEDQC
KLLA0E21319g       QSENATKLVSYLIEHKSDFEGVLEGVFHSSLQT-EPFVKEQLKGGYGPVFAVTLNSKEQC
ZYRO0F09768g       QAENATKVVKYLNDHKDKYPALV-ELYHSSLQT-EEFVKKQLSGGYTPVFSLTFKTEEQC
KNAG0C04990        QSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGGHPPVFALTLRSIDQC
Kpol_1031.23       QSENVTKIVKYLDENKGKYGKVLRDITHSSLQK-EDFVKKQLKGGYNPVFSITLNTVEQC
TBLA0A03680        QSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQK-EDFVKKQLKGGYTPVFSIVLHNKEQC
SAKL0G02222g       QSENATALVKYLDDHKSEFNKVLDKIYHSSLQT-EDFVKKQLEGGYGPVFSIVLKSKVQC
CAGL0I01276g       QSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQD-ESFVKKQLIGGYTPVFSITLMNKEQC
KAFR0E03860        QSENATKVVEFLNLNKERFDKVLKEVYHSSLQK-EAFVKKQLVGGYGPVFSMSLQTIDQC
Suva_15.308        QSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGGYGPVFAITLRTKEQC
Skud_8.173         QSENATKLVKFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGGYGPVFAIILHNKEQC
Smik_8.190         QSENATKLVKFLSDHQSEFGKVLKKIYHSSLQR-EEFVKKQLVGGYGPVFAITLQTKEQC
YHR112C            QSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGGYGPVFAITLYTKEQC
NDAI0B05590        QSENATKIVSFLDSNRDKYDKVLKSITHSSLQK-ESFVKKQLKGGYGPVFSISLMNKEQC
NCAS0F03290        QSENATKVVKFLNDNKGKFGNVLDKIYHSSLQT-EPFVKKQLKGGYDPVFSITLKNKEQC
Ecym_5523          QSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQ-EEFVKKQLAGGHTPVFSIMLKTVDQC
AER250C            QSTSATKVVAYLESHKAEFGGVLVKVFHSSLQT-EPYVQQYLRGGNAPVFSILLRTVEQC
                   *: . * :* .*  :   :  ::  : *:***  * :* : : **  ***:: : .  **

KLTH0E16566g       KLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLIEDLAGTLEK
Kwal_55.22221      RKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK
KLLA0E21319g       RKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVENVDDLIKDFANALKT
ZYRO0F09768g       KKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLSTVLSQ
KNAG0C04990        KRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCENAEDLIADLTTALNA
Kpol_1031.23       KSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESADDLIKDLASALQN
TBLA0A03680        KALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDLINDLDQALTV
SAKL0G02222g       KKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQ
CAGL0I01276g       KQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDLIADLDAAFIE
KAFR0E03860        KKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDLIKDLETALQE
Suva_15.308        KVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLIRDLASALKE
Skud_8.173         KQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAEDLIKDLSSALKE
Smik_8.190         KQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKE
YHR112C            KQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKE
NDAI0B05590        KKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALET
NCAS0F03290        KKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNK
Ecym_5523          RELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCEDHNDLINDLANALRY
AER250C            KRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ
                   . .      * ****:** ***:****: *.     *:*.*:* *. :*** *:   :  

KLTH0E16566g       IEKGDLTW
Kwal_55.22221      INKGELD-
KLLA0E21319g       LQG--AKN
ZYRO0F09768g       L-------
KNAG0C04990        LQS--DP-
Kpol_1031.23       LQD--EAN
TBLA0A03680        IQL--KQL
SAKL0G02222g       LQD--EE-
CAGL0I01276g       LEK--LQ-
KAFR0E03860        LHN--GA-
Suva_15.308        LQD--AA-
Skud_8.173         LQD--TA-
Smik_8.190         LQD--AA-
YHR112C            LQD--AA-
NDAI0B05590        LQKESSN-
NCAS0F03290        LQD--TN-
Ecym_5523          LQTQVTN-
AER250C            L-------
                   :       

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0E16566g
------------------------------------------MPFSSTATIHGDD-RLNR
VSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNADRLEVVLTEILDG
PTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGMEILPL--ENLEDKC
QSGDLVHLEDPGNPYGEV-VNLDEFAEKIHRAGALMLVDSTLAPPPLRNTWEFGADIVMH
SGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRSLRTMEIRVLK
QSSNCTRLVEYLASHKDRYNSVVKDIRHASLQK-EEFVKKQLPGGYGPVFSLLLFSQEQC
KLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLIEDLAGTLEK
IEKGDLTW
>Kwal_55.22221
------------------------------------------MPFSATNAIHSDD-YLNR
VSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDS
HAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL--EDIEAKC
QEGDLVHIEDPINPFGET-VDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMH
SGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRSLRTMDIRVRR
QSQNCTELVSYLANNSEKFSSVVQEIRHASLQT-EAFVKQQMPGGFGPVFALILKSEDQC
RKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK
INKGELD-
>KLLA0E21319g
-------------------------------------------MSLSTELVHADD-KHNR
VTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAHPNSLRVESVLSKVLEG
EAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNWNLEQHKLEIDEILQHA
GKGDVVHIETPVNPYGTS-FDIKAFADATHSKGAILVIDSTFAPPPLQNPWDFGVDVILH
SATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAFLLLRSLRTFEMRIQT
QSENATKLVSYLIEHKSDFEGVLEGVFHSSLQT-EPFVKEQLKGGYGPVFAVTLNSKEQC
RKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVENVDDLIKDFANALKT
LQG--AKN
>ZYRO0F09768g
------------------------------------------MVDLETLLLHGDD-EHNR
VTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLEALFSRFLGG
HAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVERYGL--ADIEKHA
QKGDIVHVETPINPFGTS-LDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMH
SATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRR
QAENATKVVKYLNDHKDKYPALV-ELYHSSLQT-EEFVKKQLSGGYTPVFSLTFKTEEQC
KKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLSTVLSQ
L-------
>KNAG0C04990
------------------------------------------MEHLATTLIHADD-RDNR
VPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLAHPNSTRLESLFSQILGG
HAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRTTGMQQCSL--DDVPQMA
QPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPPPLQDPWRFGCDMVMH
SATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAYLLLRSLRTFELRIQR
QSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGGHPPVFALTLRSIDQC
KRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCENAEDLIADLTTALNA
LQS--DP-
>Kpol_1031.23
------------------------------------------MVELSTLLIHADD-KNNR
VTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREGHPNGTRLETLFSEYLGG
HAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRNGMVKKYTL--DEIEQYA
EKGDIVHLESPVNPFGTS-YDIEAFAKRAHAKGALLLVDGTFAPPPLQNVWDFGADIVMH
SATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYLLLRSLRTFEMRIMK
QSENVTKIVKYLDENKGKYGKVLRDITHSSLQK-EDFVKKQLKGGYNPVFSITLNTVEQC
KSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESADDLIKDLASALQN
LQD--EAN
>TBLA0A03680
MAINS-------------------------------------EPDLETLLIHGDD-VNNR
VTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPNSSRLETLFSKILDG
NAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTLKKHTH--KEIEEFA
QKGDIVHLESPVNPYGTS-YDIEEFVKKAHSKGVLVMIDSTFAPPPLQYVWDFDVDIVMH
SATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLRSLRTFEMRILK
QSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQK-EDFVKKQLKGGYTPVFSIVLHNKEQC
KALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDLINDLDQALTV
IQL--KQL
>SAKL0G02222g
------------------------------------------MVSLPTTLIHADD-KDNR
VTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNATRLESIFSEILGG
HAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGMKQYPL--DRIEELA
SEGDIVHLETPVNPFGTS-YDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIH
SCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRK
QSENATALVKYLDDHKSEFNKVLDKIYHSSLQT-EDFVKKQLEGGYGPVFSIVLKSKVQC
KKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQ
LQD--EE-
>CAGL0I01276g
MT----------------------------------------RQDLATTLIHGDD-IKNR
VPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFSEILEG
HAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLIQRSL--DDIEEYA
QKGDIVHIETPVNPFGTS-YDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMH
SATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILK
QSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQD-ESFVKKQLIGGYTPVFSITLMNKEQC
KQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDLIADLDAAFIE
LEK--LQ-
>KAFR0E03860
------------------------------------------MTHLGTSLIHADD-KDNR
VSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPNATRLESLFSEILEG
HAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGVEQYTL--DDIEKYA
QEGDIVEVESPMNPYGTS-IDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLH
SATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILK
QSENATKVVEFLNLNKERFDKVLKEVYHSSLQK-EAFVKKQLVGGYGPVFSMSLQTIDQC
KKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDLIKDLETALQE
LHN--GA-
>Suva_15.308
------------------------------------------MVDLSTALIHADD-KDNR
VTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNSTRLESVFSDILDG
YAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIKQHPL--EDIERYA
AEGDIVHLESPVNPYGTS-YDIESFARRAHAKGALLILDSTFASPPLQYAWNFGADIVLY
SATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRSLRTYELRINK
QSENATKIVKFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGGYGPVFAITLRTKEQC
KVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLIRDLASALKE
LQD--AA-
>Skud_8.173
------------------------------------------MVNLSTVLIHGDD-KDNR
VTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESVFSEILDG
YAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARNYDVKQYPL--EDIEKYA
SEGDIVHLESPVNPYGTS-YDIESLAHRAHTKGALLIVDSTFASPPLQYAWNFGADVVLY
SATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITK
QSENATKLVKFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGGYGPVFAIILHNKEQC
KQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAEDLIKDLSSALKE
LQD--TA-
>Smik_8.190
MALCNTRYINVIYSSITSCNRYFLNVMDCIDVKADCVKRVSKMVDLSTSLIHGDD-KDNR
VTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLAHPNSTRLESIFSEILDG
YAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRNYDIKQYPL--EDIEKYA
SEGDIVHLETPVNPYGTS-SDIESLAHRAHAKGALLIVDSTFASPPLQYVWNFGADIVLY
SATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITK
QSENATKLVKFLSDHQSEFGKVLKKIYHSSLQR-EEFVKKQLVGGYGPVFAITLQTKEQC
KQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKE
LQD--AA-
>YHR112C
------------------------------------------MVDLSTALIHGDD-KDNR
VTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILDG
YAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIEQHPL--EDIEKCA
SEGDIVHLESPVNPYGTS-SDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLY
SATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITK
QSENATKLVRFLSDHQSEFDKVLKTIYHSSLQT-EEFVKKQLVGGYGPVFAITLYTKEQC
KQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKE
LQD--AA-
>NDAI0B05590
------------------------------------------MAHLSTALIHSDD-KDNR
VSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSEILDG
HAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQTKQHTL--DEIEQFA
QPGDIVHLETPVNPFGTS-LDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMH
SATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLK
QSENATKIVSFLDSNRDKYDKVLKSITHSSLQK-ESFVKKQLKGGYGPVFSISLMNKEQC
KKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALET
LQKESSN-
>NCAS0F03290
MIRYTLNTRSHLLKVAPRVARQLATR----------------PIHLSTTLIHGDD-KDNR
VSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNG
HAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPL--EDIEKYA
QKGDIVHLETPVNPYGTS-LDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMH
SATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIER
QSENATKVVKFLNDNKGKFGNVLDKIYHSSLQT-EPFVKKQLKGGYDPVFSITLKNKEQC
KKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNK
LQD--TN-
>Ecym_5523
------------------------------------------MAGLSTLLIHADDGVSDH
VTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSREGHPNSNRCGSILSHALNG
YAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVRNYGLLKLGL--DEIEERA
QPGDMVHIESPMNPYGTA-VDIEEYVSKGHKKGAIVMIDSTFAPPPLQNAWEFGVDILMH
SCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSYLLIRSLRTLELRVMK
QSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQ-EEFVKKQLAGGHTPVFSIMLKTVDQC
RELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCEDHNDLINDLANALRY
LQTQVTN-
>AER250C
------------------------------------------MVELCTSLIHADD-NSNR
VNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPNGARCEVLLAEALGG
EAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQKLSL--EEVSERS
EPGDLVHIESPINPYGTL-VDVAGIAAAAHEKGAYVVLDATFAPPPLQDRWEQGADVVVH
SCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVR
QSTSATKVVAYLESHKAEFGGVLVKVFHSSLQT-EPYVQQYLRGGNAPVFSILLRTVEQC
KRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ
L-------