MUSCLE (3.8) multiple sequence alignment

AGR354W            MRRPSPPPPPRAMHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTL
KNAG0C05490        ------------MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTL
KLLA0C16753g       ------------MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTL
TPHA0D02080        ------------MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTL
Ecym_8179          ------------MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTL
Suva_15.263        ------------MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTL
YHR072W-A          ------------MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTL
Skud_8.132         ------------MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTL
Smik_8.149         ------------MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTL
SAKL0G08800g       ------------MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTL
Kwal_34.15976      ------------MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTL
KLTH0H14894g       ------------MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTL
Kpol_1051.6        ------------MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTL
TDEL0E02740        ------------MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTL
CAGL0J10802g       ------------MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTL
ZYRO0D10208g       ------------MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTL
TBLA0H01960        ------------MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTL
NCAS0H01630        ------------MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTL
KAFR0C01840        ------------MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTL
                               ****:**. :*** ***.* *  .****.***********:*******

AGR354W            KRRFDMLPR-------
KNAG0C05490        KKRFGMLP--------
KLLA0C16753g       KKRYNLLPN-------
TPHA0D02080        KKRFSLLPNQQ-----
Ecym_8179          KKRFNMLPTQ------
Suva_15.263        KKRFGLVPGQ------
YHR072W-A          KKRFGLVPGQ------
Skud_8.132         KKRFGLVPGQ------
Smik_8.149         KKRFGLVPGQ------
SAKL0G08800g       KKRFNMLPGKN-----
Kwal_34.15976      KKRYNMIPGQN-----
KLTH0H14894g       KKRYNMIPGQE-----
Kpol_1051.6        KKRFGLLPTQ------
TDEL0E02740        KKRYNLLPTE------
CAGL0J10802g       KKRYNLLPQ-------
ZYRO0D10208g       KRRYGLLPGQQQQQQQ
TBLA0H01960        KKRYNLLPGQ------
NCAS0H01630        KKRYGLLPTQ------
KAFR0C01840        KKRYGLLPGQ------
                   *.*:.::*        

FASTA FORMAT for MUSCLE Version 3.6

>AGR354W
MRRPSPPPPPRAMHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTL
KRRFDMLPR-------
>KNAG0C05490
------------MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTL
KKRFGMLP--------
>KLLA0C16753g
------------MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTL
KKRYNLLPN-------
>TPHA0D02080
------------MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTL
KKRFSLLPNQQ-----
>Ecym_8179
------------MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTL
KKRFNMLPTQ------
>Suva_15.263
------------MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTL
KKRFGLVPGQ------
>YHR072W-A
------------MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTL
KKRFGLVPGQ------
>Skud_8.132
------------MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTL
KKRFGLVPGQ------
>Smik_8.149
------------MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTL
KKRFGLVPGQ------
>SAKL0G08800g
------------MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTL
KKRFNMLPGKN-----
>Kwal_34.15976
------------MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTL
KKRYNMIPGQN-----
>KLTH0H14894g
------------MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTL
KKRYNMIPGQE-----
>Kpol_1051.6
------------MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTL
KKRFGLLPTQ------
>TDEL0E02740
------------MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTL
KKRYNLLPTE------
>CAGL0J10802g
------------MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTL
KKRYNLLPQ-------
>ZYRO0D10208g
------------MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTL
KRRYGLLPGQQQQQQQ
>TBLA0H01960
------------MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTL
KKRYNLLPGQ------
>NCAS0H01630
------------MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTL
KKRYGLLPTQ------
>KAFR0C01840
------------MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTL
KKRYGLLPGQ------