MUSCLE (3.8) multiple sequence alignment

Klac_YGOB_MFA1      MQPTQQASQNESAENKENWIIPGFVWVPQCVVA
Sklu_YGOB_MFA2      MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII
                    ***..:*:*::*****:**** *:.* ****: 

FASTA FORMAT for MUSCLE Version 3.6

>Klac_YGOB_MFA1
MQPTQQASQNESAENKENWIIPGFVWVPQCVVA
>Sklu_YGOB_MFA2
MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII