MUSCLE (3.8) multiple sequence alignment

KLLA0E18613g      MNAISFLSNALPAPQEVPIKEK------------EGILVDPTPT----------NTQPNK
TBLA0I01460       MNAITYLYNNLLLPLQ------------------NAPAPAPTPD----------TPIQSK
CAGL0K02959g      MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV
Smik_8.53         MNALKYFSNHLITTKKPRK-NH-----VEVTNN-QDILDTSNED----------SNTYAT
YHR004C           MNALKYFSNHLITTKKQKK-IN-----VEVTKN-QDLLGPSKEV----------SNKYTS
Suva_8.58         MNALKYFSNHLITTNKPKKTIN-----VEVTKS-QDSLSASNET----------FDTGAS
Skud_8.49         MNALKYFSNHLITTKKPKKTIN-----VELTKS-QDLVNASNET----------SKTGAR
KNAG0C05850       MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKL-----KTTANV
NDAI0H01420       MNALSYVSDSLVLPLQLFKKKDKKDARNVIEKK-VAAGAATEINLEQPYVDRIGKQVGTK
NCAS0F00930       MNALSYISSHLASPIHYLKKKEP----TIVPVE-QEPTNNNEKI----------KSHSKA
KAFR0A01830       MNALSYITNHVQLPFSKLRDNNKVKANIVPENI-VGKKDWSSIS----------NDQKGT
SAKL0A09416g      MNAISYITNHVTPPKFDEA---------------NSIKKDQADA----------QAHGTV
KLTH0D06776g      MNAISYLTNNILPPKH------------------EESTATPHRV----------EDSEKA
Kwal_26.8001      MNAISYLTNNALTPKP------------------EGPSSSPENI------------EGSA
ZYRO0B01958g      MNAISYLSNLSSTPSNP-----------------ISSSSSSSSS----------SSHGVL
TDEL0A03050       MNAVSYISDQLSK---------------------RDKNGKTEDV----------EDKVAV
AGL070W           MNSLSYLTGATQHAAG------------------KGDGRWPGSE----------RGLAKV
Ecym_7257         MNSLSYLTGSSQPTSSS-----------------KEELRFPFSE----------SSLPNV
Kpol_348.8        MNALSYISSNLITPIEEE----------------ELPSGSQSED----------VQTYTN
TPHA0G03500       MNTISYISNSLITSI---------------------------------------REEGGK
                  **::.:.                                                     

KLLA0E18613g      VKN------------KTTTASTTTSTTTTSTATNKRNR---------------------P
TBLA0I01460       PSN------------TSQQPPPQPQ----------------------------------P
CAGL0K02959g      NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK
Smik_8.53         HIE------------NNCTIEVNQHFDHSSDHLKDFNQNEERKLFISAKPKSLRSILKEK
YHR004C           HSE------------NDCVSEVDQQYDHSSSHLKESDQNQERKNSVPKKPKALRSILIEK
Suva_8.58         NTE------------KDPTVKENHQHNSSTEGPNEPKQDEECTYSVSTKRKALHSILKEK
Skud_8.49         HTE------------NDIIG-GNHQHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRRK
KNAG0C05850       EKQ------------ENSTLKEELLDRQGSDAEKASKPIIVINDGDILNENILHQ----K
NDAI0H01420       KAE------------ESLKKPTPGLEFTDNNFIVEEEGHSSLNVTDDRKTKN-------N
NCAS0F00930       TTN------------NDEDYSTPMADSSSSNTIEKSIAVYGSDRAL-------------R
KAFR0A01830       ITR------------ENASPEKGLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFN
SAKL0A09416g      SKS------------EQNAPEDDEDKNQTKKA---------------------------T
KLTH0D06776g      NAR------------IDVAPKEAQKRKR-------------------------------A
Kwal_26.8001      DVN------------VSGNGKNPQLKVKKTRKSRG------------------------I
ZYRO0B01958g      VES------------EEEQEDNDEVNQFQNENDEGES-----------------------
TDEL0A03050       QKR------------EKIVRRRS------------------------------------K
AGL070W           REE------------QDAARAGVG-----------------------------------A
Ecym_7257         TEE------------QEVENGEVSQDSKG------------------------------G
Kpol_348.8        DVS------------DTCVSSQTQIISKVEDVLNED-----------------------N
TPHA0G03500       EEQ------------EELQPALPDEKP---------------------------------
                                                                              

KLLA0E18613g      FMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKG-LIQVGSETDSRTEKL
TBLA0I01460       QLPLLYKLFA-----ILIKPLIFLWYIFTFPLLLIEQHTNRKYK-----------DTPPL
CAGL0K02959g      FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGK-ATENEHLS--QSPAT
Smik_8.53         IGSILWALLLFLPYYLVIKPLMSLWYVFTFPLSVIERRVKHTDK-RNKESSDNENGSPTS
YHR004C           IASILWALLLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDK-RNRGSNASENELPVS
Suva_8.58         IVSILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDK-RHKESGDSGHEPSTD
Skud_8.49         IASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDK-RHKEPGNSGNVSSTS
KNAG0C05850       VWNVLVFVIFFLPTYLIYKPLLLLWFLVTLPLALVERGIKLRNR-PKM-------KTEKV
NDAI0H01420       VTSILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMR-PFSQSKD---SSPEK
NCAS0F00930       FSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTL-LKN-------KLDEN
KAFR0A01830       LFSLLANIILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDR-KKKAE-----LRGNF
SAKL0A09416g      KLSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDED-ERNGE-----EGNST
KLTH0D06776g      RWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQ-GMGFDNA---EGDSK
Kwal_26.8001      RWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESA-GGTESSLQ--RTGNL
ZYRO0B01958g      ---------------IFLKPFHLIWFVITSPLILIEYGLKSKQK-----------VESTS
TDEL0A03050       FTSYAWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYGLKSRLQ-R---------KSTKR
AGL070W           GAAWVWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEAD-GA--------PGPEA
Ecym_7257         RPSWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSKDGS-VEEEE-----VIPTN
Kpol_348.8        QRSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPK-SSA-------NLDTM
TPHA0G03500       ----FWFVLLFLPRLLLVKPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSI
                                 :. :*    *::.: *: :.*                        

KLLA0E18613g      SKY--------------------VVEED-LSPTDEIIINQDKMKPRPI------------
TBLA0I01460       IDP-------------KIASSSATDLDD-LNSNDEIILQTDSIKGSLLEKKNT------S
CAGL0K02959g      NKD--------NSPSKRLNVIEEAIEDD-LISGEVMELQKDALKGSLLPTNKD-------
Smik_8.53         SSSAGDSSEKINSKNCNLNTISETVEDD-LNASDEIILQRDNVKGSLLRAQSV-------
YHR004C           SSNINDSSEKTNPKNCNLNTIPEAVEDD-LNASDEIILQRDNVKGSLLRAQSV-------
Suva_8.58         SSHSGDFNEKQDAKNRNLNTIHEIVEDD-LNASDEIILQRDNVKGSLLQAADG-------
Skud_8.49         SGNGNDSNEKAGSKNGNLNTIPETVDDD-LNASDEIILQRDNVKGSLLKAQSV-------
KNAG0C05850       SEL-------VLSDPSKLGSINEEVEED-LAAGDEFYLQRDIVKGSLLKATTN-------
NDAI0H01420       DETLVHNNSFLPEEPSKLDAINELTEDD-LVSGDGIYLQRDNVKGSLLKASSV-------
NCAS0F00930       SQK---NAERVPTTSPELTVIDETTEDD-LAGGDEIYLQRDTIKGSLLKATSA-------
KAFR0A01830       GES---------SELSPLRSISEVGEED-LSTSDEFFLQRDTIKGSLLRASSD-------
SAKL0A09416g      GDE---------EKTPSINIIVEEDEED--LAGDEIILQTDAVKGSLSTISES-------
KLTH0D06776g      SEA---SAGTISPK--NSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDK
Kwal_26.8001      YSD--EQVSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCV-----PP
ZYRO0B01958g      RKG---------------EIIRKKEVDD-DLAEDEMFLQRDTVKGGL-------------
TDEL0A03050       STG-------------TLQSISELEEDD-LAGGDEIFLQRDAVKGSLAPA----------
AGL070W           AEE---------------EQLAEAVEDD-DLAGESMVLQEDSVKSS--------------
Ecym_7257         SQG---------------SGGGEVIEDD-DLVGESMVLHEDSIKSS--------------
Kpol_348.8        SKS---------------KNLNILVEED-LSGGGEIILQRDTLNGSLL------------
TPHA0G03500       ANNNAFYVTKGRKRTEQLQNLDSVLEDD--MKGGEMILQRDTVKGSLLNASNL-------
                                            ::       : :: * ::                

KLLA0E18613g      --------------------------------------TEYLGKFHFPKKLVPQSMLLST
TBLA0I01460       AAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTN
CAGL0K02959g      ------------SSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSE
Smik_8.53         -------------KLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQ
YHR004C           -------------KSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKKLIPKSVLNTQ
Suva_8.58         ---------VHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQ
Skud_8.49         -------------KSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQ
KNAG0C05850       ---------KHHTPLKSKKNSAQNQHGNETHPNSTVFGTKKMGRFLFPKKLIPKSILNRE
NDAI0H01420       ------------------RQPSLSRSMKTMVSNNTSFSSKRMGKFLFPKKLIPKSITQTE
NCAS0F00930       ------------------KQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLIPRSIVQTN
KAFR0A01830       -------------KPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCNE
SAKL0A09416g      --------------QQVKTIKASTRSSIRSGSTGTALGSRRMGRFLFPKKLIPQSVLNNE
KLTH0D06776g      GRRQPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRR
Kwal_26.8001      EHSQDLSRRQQHSKGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRR
ZYRO0B01958g      --------------------------------RGKAFGTKKMGRFLFPKKLVPQSILFAE
TDEL0A03050       ---------------------KYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAE
AGL070W           ----------------------------RPSTSRSSYTSTRLGKFLFPKKLIPQSILQTD
Ecym_7257         ----------------------------RPSTSRSSYTSTRLGKFLFPKKLIPQSILQTD
Kpol_348.8        -------------KSRANQQHSHQSRHAKSSSSSVGLISKKIGRFLFPKKLIPRSILHSG
TPHA0G03500       ------------YKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRFLFPKKLIPRSILHSG
                                                        :  :*.* *****:*.*:    

KLLA0E18613g      SRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTN-----------
TBLA0I01460       KRKKLILDLDETLIHSMSRNISSSTISNY---------HLIEVKFPTPTSAPTSAPGPSL
CAGL0K02959g      KKKTLVIDLDETLIHSVSRGTTHSNSSQA---------HIIEVRFAISG-----------
Smik_8.53         KKKKLVIDLDETLIHSASRSTTHSNSSQG---------HLVEVKFGISG-----------
YHR004C           KKKKLVIDLDETLIHSASRSTTHSNSSQG---------HLVEVKFGLSG-----------
Suva_8.58         KKKKLVIDLDETLIHSASRGTTHSNSSQG---------HLVEVKFGISG-----------
Skud_8.49         KKKKLVIDLDETLIHSASRSTTHSNSSQG---------HLVEVKFGISG-----------
KNAG0C05850       KKKTLVMDLDETLIHSVSRGTTHPNSSQG---------HIVEVKFSISG-----------
NDAI0H01420       RRKKLVLDLDETLIHSISRGTTHTNVSQG---------HIVEVKFSSSG-----------
NCAS0F00930       RRKKLVLDLDETLIHSMSRGTTHSNSSQG---------HIVEVKFSVSG-----------
KAFR0A01830       RKKTLVVDLDETLIHSVSRGTTHVNSSQG---------HLVEVKFSING-----------
SAKL0A09416g      KKKILVLDLDETLIHSMSRGTSSSNSSQG---------HMVEVKFAVSG-----------
KLTH0D06776g      KRRTLVLDLDETLIHSMSRGTSSSNSSQG---------HMVEVKFATSG-----------
Kwal_26.8001      KPRTLVLDLDETLIHSMSRGTSSSNSSQG---------HMVEVKFAISG-----------
ZYRO0B01958g      RKKRLVVDLDETLIHSATRSVSHSNSAQG---------HMVEVRFPPSS-----------
TDEL0A03050       KRKRLVVDLDETLIHSASRTTSHSNSAQG---------HMVEIRFAISG-----------
AGL070W           RKKLLVLDLDETLIHSMSRSTSSVSNSQG---------HMVEVTFAASG-----------
Ecym_7257         RKKVLVLDLDETLIHSMSRSTSSSNTSQG---------HMVEVTFSVSG-----------
Kpol_348.8        RKKKLVLDLDETLIHSISRSTPNSNNAQA---------HLVEVKFPISG-----------
TPHA0G03500       RKKKLVLDLDETLIHSISRSNSNSNNAQA---------HLVEVKFQISG-----------
                    . *::********* :.  .  . ::          *::*: *               

KLLA0E18613g      -ISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYRE
TBLA0I01460       PLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRN
CAGL0K02959g      -VSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRN
Smik_8.53         -IRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRS
YHR004C           -IRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRS
Suva_8.58         -ISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRS
Skud_8.49         -IPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRS
KNAG0C05850       -VSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRN
NDAI0H01420       -VSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRT
NCAS0F00930       -VSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRT
KAFR0A01830       -ISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRH
SAKL0A09416g      -ISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQ
KLTH0D06776g      -ISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ
Kwal_26.8001      -ISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ
ZYRO0B01958g      -ISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRH
TDEL0A03050       -VSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRN
AGL070W           -VSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRS
Ecym_7257         -VSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYRS
Kpol_348.8        -ISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRN
TPHA0G03500       -ISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRN
                   :  ** : ***.** **   . ** : :*****.**********:      *  * ** 

KLLA0E18613g      DCTLRPGVGYVKDIGTV--------------------------------------ATQIE
TBLA0I01460       HCILRDGIGYIKDLSVL----------------------------------------NTD
CAGL0K02959g      HCIARDGVGYIKDLGNI------------------------------------KDPYSKN
Smik_8.53         DCVLRDGVGYIKDLSII----------------------------------KNSEENEKG
YHR004C           DCVLRDGVGYIKDLSIV----------------------------------KDSEENGKG
Suva_8.58         DCVLRDGVGYIKDLSIL---------------------------------KSSEENGKGS
Skud_8.49         DCVLRDGVGYIKDLSII---------------------------------KSSEENGKGS
KNAG0C05850       DCILRDGVGYIKDLKMV-----------------------------------TRGSNLGT
NDAI0H01420       DCIRRDGVGYIKDLTII----------------------------------KDDSNVSVP
NCAS0F00930       DCILRDGVGYIKDLSVI--------------------------------SEASGMKNISA
KAFR0A01830       NCLLRDGVGYIKDLSVL------------------------------VNANHAQDNKTFL
SAKL0A09416g      DCILRDGVGYIKDLSLI-------------------------------------------
KLTH0D06776g      DCILRDGVGYIKDLSVV------------------------------------------V
Kwal_26.8001      DCILRDGVGYIKDLSAV------------------------------------------A
ZYRO0B01958g      NCVVREGVGYIKDLSVV-------------------------------------------
TDEL0A03050       NCILRDGVGYIKDLSIV-----------------------------------------CG
AGL070W           DCLLRDGVGYVKDLSII-------------------------------------------
Ecym_7257         DCILRDGIGYVKDLTMI-------------------------------------------
Kpol_348.8        DCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQL
TPHA0G03500       HCILRDGVGYIKDLSII------------------------------NDTNDDHGNELVR
                   *  * *:**:**:  :                                           

KLLA0E18613g      TSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCIL
TBLA0I01460       NQSTLNELILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNIL
CAGL0K02959g      ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVL
Smik_8.53         SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
YHR004C           SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
Suva_8.58         SLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
Skud_8.49         SPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
KNAG0C05850       SPDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNIL
NDAI0H01420       QTSTLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSIL
NCAS0F00930       LPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVL
KAFR0A01830       PVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVL
SAKL0A09416g      SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVL
KLTH0D06776g      PNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVL
Kwal_26.8001      PNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNIL
ZYRO0B01958g      -TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSIL
TDEL0A03050       PTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDIL
AGL070W           -SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNIL
Ecym_7257         -SKNLQDTIIVDNSPVSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNIL
Kpol_348.8        QNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNIL
TPHA0G03500       ANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNIL
                      * : .::**** *:* : :***** ***.**:*  ** *:*:*:.:   ** * :*

KLLA0E18613g      ALKSGRASISN--
TBLA0I01460       ALKNGERAFHFA-
CAGL0K02959g      ALKNSEKAFQLS-
Smik_8.53         ALKHGEKAFNIN-
YHR004C           ALKHGEKAFNIN-
Suva_8.58         ALKHGEKAFNMN-
Skud_8.49         ALKHGEKAFNIN-
KNAG0C05850       SLKNGEKAFNID-
NDAI0H01420       ALKNGERAFYANR
NCAS0F00930       ALKNGEKAFYTS-
KAFR0A01830       ALKNGEKMFENV-
SAKL0A09416g      SLKSGEQAFNI--
KLTH0D06776g      ALKSGEHAFTNV-
Kwal_26.8001      ALKSGEHAFSAT-
ZYRO0B01958g      GLKNGEKALG---
TDEL0A03050       ALKNSEQAFLS--
AGL070W           SLKNGERAFI---
Ecym_7257         SLKNGEHAFV---
Kpol_348.8        SLKNGERAFNVNN
TPHA0G03500       SLKNGERAFDIN-
                  .** .   :    

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E18613g
MNAISFLSNALPAPQEVPIKEK------------EGILVDPTPT----------NTQPNK
VKN------------KTTTASTTTSTTTTSTATNKRNR---------------------P
FMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKG-LIQVGSETDSRTEKL
SKY--------------------VVEED-LSPTDEIIINQDKMKPRPI------------
--------------------------------------TEYLGKFHFPKKLVPQSMLLST
SRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTN-----------
-ISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYRE
DCTLRPGVGYVKDIGTV--------------------------------------ATQIE
TSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCIL
ALKSGRASISN--
>TBLA0I01460
MNAITYLYNNLLLPLQ------------------NAPAPAPTPD----------TPIQSK
PSN------------TSQQPPPQPQ----------------------------------P
QLPLLYKLFA-----ILIKPLIFLWYIFTFPLLLIEQHTNRKYK-----------DTPPL
IDP-------------KIASSSATDLDD-LNSNDEIILQTDSIKGSLLEKKNT------S
AAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTN
KRKKLILDLDETLIHSMSRNISSSTISNY---------HLIEVKFPTPTSAPTSAPGPSL
PLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRN
HCILRDGIGYIKDLSVL----------------------------------------NTD
NQSTLNELILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNIL
ALKNGERAFHFA-
>CAGL0K02959g
MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV
NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK
FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGK-ATENEHLS--QSPAT
NKD--------NSPSKRLNVIEEAIEDD-LISGEVMELQKDALKGSLLPTNKD-------
------------SSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSE
KKKTLVIDLDETLIHSVSRGTTHSNSSQA---------HIIEVRFAISG-----------
-VSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRN
HCIARDGVGYIKDLGNI------------------------------------KDPYSKN
ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVL
ALKNSEKAFQLS-
>Smik_8.53
MNALKYFSNHLITTKKPRK-NH-----VEVTNN-QDILDTSNED----------SNTYAT
HIE------------NNCTIEVNQHFDHSSDHLKDFNQNEERKLFISAKPKSLRSILKEK
IGSILWALLLFLPYYLVIKPLMSLWYVFTFPLSVIERRVKHTDK-RNKESSDNENGSPTS
SSSAGDSSEKINSKNCNLNTISETVEDD-LNASDEIILQRDNVKGSLLRAQSV-------
-------------KLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQ
KKKKLVIDLDETLIHSASRSTTHSNSSQG---------HLVEVKFGISG-----------
-IRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRS
DCVLRDGVGYIKDLSII----------------------------------KNSEENEKG
SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
ALKHGEKAFNIN-
>YHR004C
MNALKYFSNHLITTKKQKK-IN-----VEVTKN-QDLLGPSKEV----------SNKYTS
HSE------------NDCVSEVDQQYDHSSSHLKESDQNQERKNSVPKKPKALRSILIEK
IASILWALLLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDK-RNRGSNASENELPVS
SSNINDSSEKTNPKNCNLNTIPEAVEDD-LNASDEIILQRDNVKGSLLRAQSV-------
-------------KSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKKLIPKSVLNTQ
KKKKLVIDLDETLIHSASRSTTHSNSSQG---------HLVEVKFGLSG-----------
-IRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRS
DCVLRDGVGYIKDLSIV----------------------------------KDSEENGKG
SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
ALKHGEKAFNIN-
>Suva_8.58
MNALKYFSNHLITTNKPKKTIN-----VEVTKS-QDSLSASNET----------FDTGAS
NTE------------KDPTVKENHQHNSSTEGPNEPKQDEECTYSVSTKRKALHSILKEK
IVSILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDK-RHKESGDSGHEPSTD
SSHSGDFNEKQDAKNRNLNTIHEIVEDD-LNASDEIILQRDNVKGSLLQAADG-------
---------VHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQ
KKKKLVIDLDETLIHSASRGTTHSNSSQG---------HLVEVKFGISG-----------
-ISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRS
DCVLRDGVGYIKDLSIL---------------------------------KSSEENGKGS
SLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
ALKHGEKAFNMN-
>Skud_8.49
MNALKYFSNHLITTKKPKKTIN-----VELTKS-QDLVNASNET----------SKTGAR
HTE------------NDIIG-GNHQHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRRK
IASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDK-RHKEPGNSGNVSSTS
SGNGNDSNEKAGSKNGNLNTIPETVDDD-LNASDEIILQRDNVKGSLLKAQSV-------
-------------KSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQ
KKKKLVIDLDETLIHSASRSTTHSNSSQG---------HLVEVKFGISG-----------
-IPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRS
DCVLRDGVGYIKDLSII---------------------------------KSSEENGKGS
SPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL
ALKHGEKAFNIN-
>KNAG0C05850
MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKL-----KTTANV
EKQ------------ENSTLKEELLDRQGSDAEKASKPIIVINDGDILNENILHQ----K
VWNVLVFVIFFLPTYLIYKPLLLLWFLVTLPLALVERGIKLRNR-PKM-------KTEKV
SEL-------VLSDPSKLGSINEEVEED-LAAGDEFYLQRDIVKGSLLKATTN-------
---------KHHTPLKSKKNSAQNQHGNETHPNSTVFGTKKMGRFLFPKKLIPKSILNRE
KKKTLVMDLDETLIHSVSRGTTHPNSSQG---------HIVEVKFSISG-----------
-VSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRN
DCILRDGVGYIKDLKMV-----------------------------------TRGSNLGT
SPDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNIL
SLKNGEKAFNID-
>NDAI0H01420
MNALSYVSDSLVLPLQLFKKKDKKDARNVIEKK-VAAGAATEINLEQPYVDRIGKQVGTK
KAE------------ESLKKPTPGLEFTDNNFIVEEEGHSSLNVTDDRKTKN-------N
VTSILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMR-PFSQSKD---SSPEK
DETLVHNNSFLPEEPSKLDAINELTEDD-LVSGDGIYLQRDNVKGSLLKASSV-------
------------------RQPSLSRSMKTMVSNNTSFSSKRMGKFLFPKKLIPKSITQTE
RRKKLVLDLDETLIHSISRGTTHTNVSQG---------HIVEVKFSSSG-----------
-VSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRT
DCIRRDGVGYIKDLTII----------------------------------KDDSNVSVP
QTSTLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSIL
ALKNGERAFYANR
>NCAS0F00930
MNALSYISSHLASPIHYLKKKEP----TIVPVE-QEPTNNNEKI----------KSHSKA
TTN------------NDEDYSTPMADSSSSNTIEKSIAVYGSDRAL-------------R
FSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTL-LKN-------KLDEN
SQK---NAERVPTTSPELTVIDETTEDD-LAGGDEIYLQRDTIKGSLLKATSA-------
------------------KQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLIPRSIVQTN
RRKKLVLDLDETLIHSMSRGTTHSNSSQG---------HIVEVKFSVSG-----------
-VSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRT
DCILRDGVGYIKDLSVI--------------------------------SEASGMKNISA
LPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVL
ALKNGEKAFYTS-
>KAFR0A01830
MNALSYITNHVQLPFSKLRDNNKVKANIVPENI-VGKKDWSSIS----------NDQKGT
ITR------------ENASPEKGLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFN
LFSLLANIILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDR-KKKAE-----LRGNF
GES---------SELSPLRSISEVGEED-LSTSDEFFLQRDTIKGSLLRASSD-------
-------------KPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCNE
RKKTLVVDLDETLIHSVSRGTTHVNSSQG---------HLVEVKFSING-----------
-ISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRH
NCLLRDGVGYIKDLSVL------------------------------VNANHAQDNKTFL
PVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVL
ALKNGEKMFENV-
>SAKL0A09416g
MNAISYITNHVTPPKFDEA---------------NSIKKDQADA----------QAHGTV
SKS------------EQNAPEDDEDKNQTKKA---------------------------T
KLSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDED-ERNGE-----EGNST
GDE---------EKTPSINIIVEEDEED--LAGDEIILQTDAVKGSLSTISES-------
--------------QQVKTIKASTRSSIRSGSTGTALGSRRMGRFLFPKKLIPQSVLNNE
KKKILVLDLDETLIHSMSRGTSSSNSSQG---------HMVEVKFAVSG-----------
-ISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQ
DCILRDGVGYIKDLSLI-------------------------------------------
SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVL
SLKSGEQAFNI--
>KLTH0D06776g
MNAISYLTNNILPPKH------------------EESTATPHRV----------EDSEKA
NAR------------IDVAPKEAQKRKR-------------------------------A
RWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQ-GMGFDNA---EGDSK
SEA---SAGTISPK--NSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDK
GRRQPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRR
KRRTLVLDLDETLIHSMSRGTSSSNSSQG---------HMVEVKFATSG-----------
-ISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ
DCILRDGVGYIKDLSVV------------------------------------------V
PNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVL
ALKSGEHAFTNV-
>Kwal_26.8001
MNAISYLTNNALTPKP------------------EGPSSSPENI------------EGSA
DVN------------VSGNGKNPQLKVKKTRKSRG------------------------I
RWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESA-GGTESSLQ--RTGNL
YSD--EQVSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCV-----PP
EHSQDLSRRQQHSKGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRR
KPRTLVLDLDETLIHSMSRGTSSSNSSQG---------HMVEVKFAISG-----------
-ISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ
DCILRDGVGYIKDLSAV------------------------------------------A
PNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNIL
ALKSGEHAFSAT-
>ZYRO0B01958g
MNAISYLSNLSSTPSNP-----------------ISSSSSSSSS----------SSHGVL
VES------------EEEQEDNDEVNQFQNENDEGES-----------------------
---------------IFLKPFHLIWFVITSPLILIEYGLKSKQK-----------VESTS
RKG---------------EIIRKKEVDD-DLAEDEMFLQRDTVKGGL-------------
--------------------------------RGKAFGTKKMGRFLFPKKLVPQSILFAE
RKKRLVVDLDETLIHSATRSVSHSNSAQG---------HMVEVRFPPSS-----------
-ISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRH
NCVVREGVGYIKDLSVV-------------------------------------------
-TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSIL
GLKNGEKALG---
>TDEL0A03050
MNAVSYISDQLSK---------------------RDKNGKTEDV----------EDKVAV
QKR------------EKIVRRRS------------------------------------K
FTSYAWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYGLKSRLQ-R---------KSTKR
STG-------------TLQSISELEEDD-LAGGDEIFLQRDAVKGSLAPA----------
---------------------KYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAE
KRKRLVVDLDETLIHSASRTTSHSNSAQG---------HMVEIRFAISG-----------
-VSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRN
NCILRDGVGYIKDLSIV-----------------------------------------CG
PTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDIL
ALKNSEQAFLS--
>AGL070W
MNSLSYLTGATQHAAG------------------KGDGRWPGSE----------RGLAKV
REE------------QDAARAGVG-----------------------------------A
GAAWVWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEAD-GA--------PGPEA
AEE---------------EQLAEAVEDD-DLAGESMVLQEDSVKSS--------------
----------------------------RPSTSRSSYTSTRLGKFLFPKKLIPQSILQTD
RKKLLVLDLDETLIHSMSRSTSSVSNSQG---------HMVEVTFAASG-----------
-VSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRS
DCLLRDGVGYVKDLSII-------------------------------------------
-SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNIL
SLKNGERAFI---
>Ecym_7257
MNSLSYLTGSSQPTSSS-----------------KEELRFPFSE----------SSLPNV
TEE------------QEVENGEVSQDSKG------------------------------G
RPSWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSKDGS-VEEEE-----VIPTN
SQG---------------SGGGEVIEDD-DLVGESMVLHEDSIKSS--------------
----------------------------RPSTSRSSYTSTRLGKFLFPKKLIPQSILQTD
RKKVLVLDLDETLIHSMSRSTSSSNTSQG---------HMVEVTFSVSG-----------
-VSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYRS
DCILRDGIGYVKDLTMI-------------------------------------------
-SKNLQDTIIVDNSPVSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNIL
SLKNGEHAFV---
>Kpol_348.8
MNALSYISSNLITPIEEE----------------ELPSGSQSED----------VQTYTN
DVS------------DTCVSSQTQIISKVEDVLNED-----------------------N
QRSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPK-SSA-------NLDTM
SKS---------------KNLNILVEED-LSGGGEIILQRDTLNGSLL------------
-------------KSRANQQHSHQSRHAKSSSSSVGLISKKIGRFLFPKKLIPRSILHSG
RKKKLVLDLDETLIHSISRSTPNSNNAQA---------HLVEVKFPISG-----------
-ISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRN
DCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQL
QNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNIL
SLKNGERAFNVNN
>TPHA0G03500
MNTISYISNSLITSI---------------------------------------REEGGK
EEQ------------EELQPALPDEKP---------------------------------
----FWFVLLFLPRLLLVKPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSI
ANNNAFYVTKGRKRTEQLQNLDSVLEDD--MKGGEMILQRDTVKGSLLNASNL-------
------------YKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRFLFPKKLIPRSILHSG
RKKKLVLDLDETLIHSISRSNSNSNNAQA---------HLVEVKFQISG-----------
-ISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRN
HCILRDGVGYIKDLSII------------------------------NDTNDDHGNELVR
ANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNIL
SLKNGERAFDIN-