MUSCLE (3.8) multiple sequence alignment

TBLA0A00270        MKSFK--RHIGNHYRITTLICIIT--FY---------FISHC-LKEGKDPRIYEELSDTN
Kpol_1045.70       -MVSN--RRFSKLFKVSLVLVAV--LTF---------VILRH---------HKDETAKVL
NDAI0A06500        MLMLSFPRRSLKIFKLSLLLILIA-LAI---------VLATT---------LGYE-ANPL
CAGL0I04532g       --MFN--RRFAKLVKLVLITVSIVGGLY---------YLSG--F-------IDGDTSTAL
AER018C            --MLR--RKYSKTLKLSLITVALG-ALF---------LVTNR-W-------LPGE---FP
KNAG0K01290        MNFVN--RRFVKLLRVAVFVVFGC-VLF---------IAATH-Y-------VYDG-ANSV
TPHA0A04380        MSVFS--KRFSKLLKFSIIIVVLF-LLFSYTHISESDLIPISIYDGIGLSDSDNDSKNSL
KLLA0E17755g       MVFTT--KRFQKVFKVVVAFALAV--VV---------LNSIHVY-------LKSE--IAT
Ecym_5314          --MLT--RRFSKTLRLTVLTLIVC-SLF---------LISNR-T-------ITGELSQSI
Kpol_1036.50       MVMIS--RRFSRVVKLSLLFSAIV-SIF---------LISQS-Y-------SNRNVAKSV
NDAI0G01790        -MFFT--RKFARLLKITTILCLLC--FFCI-------WIPSE-Y-------STNS-SISV
NCAS0E01590        MVLLR--RRFSRVFKLALLLSIVGAGLF---------FFNSGQY--------SES--ISV
TBLA0F00740        -MILT--RRFFKLLKLISAVIVLT-GLF---------IATNN-Y-------LDDAVSVSV
ZYRO0A04950g       MPLVT--RRYGKALRLALLGLLVC-LVF---------LGTTR-Y-------NGDH--AAA
TDEL0D04330        MALIT--KRYRKALKLATVVLVLC-VTF---------IATSR-F-------MDEG--LSV
KAFR0C00870        MAVVN--KRFSKLF---ILLVSIG-FFF---------LLTNRLY-------INND-SVSV
Skud_2.127         -MLLT--KRFSKLFKLAFIALILC-GLF---------VITNK-Y-------MDEN--TSV
Suva_2.142         -MLLT--KRFSKLFKLAFIALLLC-GLF---------VVTNK-Y-------MDEN--TSV
YBR015C            -MLLT--KRFSKLFKLTFIVLILC-GLF---------VITNK-Y-------MDEN--TSV
Smik_2.134         -MLLT--KRFAKLFKLTFLVLILC-GLF---------VVTNK-Y-------MDEN--TSV
SAKL0C10472g       MVLLT--KRFAKVFKLAAITTLCC-LLF---------ILTNK-Y-------ISQD--LPV
KLTH0G16038g       MVLLT--KRFNKIFRFSLVAALCC-LIF---------VLSTR-Y-------IDQD--LSS
Kwal_56.23117      MVFLT--KRFSKIFKLSLVAALCC-LAF---------MFSTK-Y-------FDKD--LTS
                          ..  .                                                

TBLA0A00270        QD----SYLQDYII---------------------SPASNWKSNLYLNNKLSNDVQIPDK
Kpol_1045.70       QN--YTDAVSSYIG---------------------DSIGSLTGSSTDTASSSSSTTTNDD
NDAI0A06500        SD--YKFHFEKSLF-----------PTNHHNSLANTNNKDDKHSLLSALVTSDENIDTPN
CAGL0I04532g       GNRLSQEYMDSFWK---------------------TYDSSKSSYGSSLLGGSGEKGETDF
AER018C            SV--YTEYLQNRLP---------------------NLGSFGKQQHMEEQESQTRQMIEEG
KNAG0K01290        SG--YGKHLQEHLS----------------------GTATVSAPSAKTAASAVAGGAGGG
TPHA0A04380        NE--YSNYLKGFLK---------------------QDNEGSVNYGANSHSGKGNSDKSKG
KLLA0E17755g       ND--YTSSLKEYTQQFIEEYEDTGSSYDDARQEASQQQGDKQGSQTNTNGDSNNKINGDK
Ecym_5314          -----HAYLEDWIV---------------------LNGGDGKDRQILQEVIDAINGEDET
Kpol_1036.50       TE--YKEYLQLFINQEQEEAQQTGIHDEVGPNSNSNNNDNRHIEGTITSTNTNTNTNTNN
NDAI0G01790        QE--YKEYLQGYIN---------------------KLPIQSNSNVNDDTQKEFQHLVSGE
NCAS0E01590        KD--YKEYLQNYIN---------------------SNSDPTPSSSPNAAKQPAANLKDES
TBLA0F00740        SD--YTQRLQSYINLSPEIVNSNNEKPPLTAEIISEDSSNVNHMATVTSTANNNNNINSN
ZYRO0A04950g       -----EEYLRKYLS---------------------GGQLEHALNSVAAHGSDAAAALR-Q
TDEL0D04330        SE--YQDYIKSYLG----------------------------NAQPADTISRNPAVDVGL
KAFR0C00870        KD--YKEYLQSYIN---------------------NNAGDSTDAQGTKGGDESVPAAS--
Skud_2.127         RE--YKSYLQDYLD---------------------SHSNKHPSTDAPVTDDSSSSKVNDN
Suva_2.142         KD--YKSHLQSYID----------------------SYANKDSSSPEDAAAAAAADDAAS
YBR015C            KE--YKEYLDRYVQ---------------------SYSNKYSSSSDAASADDSTPLRDND
Smik_2.134         KD--YKKYLLDNIN---------------------SYSSKHSSSSDNAGADDSSSLKGND
SAKL0C10472g       DE--YKSYLQNYID---------------------KYTSGSGNPPAVVPSPPQKGRDREP
KLTH0G16038g       LE--YVRYLQNYHE---------------------TYSGNGNKVEPEVETPPAPAANDKI
Kwal_56.23117      LE--YGKLVDTFMA-----------------------DAGYGKDAQEVAGSSSDGTADNN
                           .                                                   

TBLA0A00270        TISKENTKLDWNARRKLLKK-------SGKPI---------------------------L
Kpol_1045.70       NKETQLEDADDDDDDDELNFVQMEEKRLREN----------------------------M
NDAI0A06500        KYELDNVVALPKTTILSPETIGTSGTVASTEEKP---------------------STETI
CAGL0I04532g       RSP------------------------EAKLK---------------------------I
AER018C            EMRSKPSELLEEEAARTEQA-------ERKSQ---------------------------I
KNAG0K01290        VPAAAGAAAAALDSMK-------------------------------------------L
TPHA0A04380        SLAQGSKPPATSFSENAKTVEKNVNSSDRTKL---------------------------L
KLLA0E17755g       IKNNNNYYNENNNDGVVKDNVGASSTPSSKKK--------------------------QV
Ecym_5314          HRESASRSDNAEKSIPDKLLSHSTPTAEEESR------------------------QAKL
Kpol_1036.50       NNNNNNNNNNDNNNNNDNDNDNDKEKENGKKKNPIQINSMLDEHLSTDSIQDLDENTKSL
NDAI0G01790        NKED---------IPS-----------IKKNT---------------------------V
NCAS0E01590        NKNNNKKNGGSVGSPK-----------THDEK---------------------------M
TBLA0F00740        SKLSNPKSNSGSSSSKSNIKTQEDDEATRKQK---------------------------V
ZYRO0A04950g       GVGSDQQAVDQQHTQDHASTQSSTLGPDSTAK---------------------------L
TDEL0D04330        NAGREPIANGGNAK---------------------------------------------L
KAFR0C00870        -KGKNPVLMSTVES-------------NTKNR---------------------------L
Skud_2.127         AATRK------------------------------------------------------L
Suva_2.142         LKGNDNASTEK------------------------------------------------L
YBR015C            EAGNEK-----------------------------------------------------L
Smik_2.134         KVSNEK-----------------------------------------------------L
SAKL0C10472g       MTDVSRQPASKKEL-------------QRRQK---------------------------L
KLTH0G16038g       KSPSGGPVLSAQDQ-------------KRRQA---------------------------L
Kwal_56.23117      GIGAGAKVSTSSNE-------------KRKIA---------------------------M
                                                                              :

TBLA0A00270        KSIFQKL---IISSSSSGQNNIQLS-PNCPIKRPV-ASKSIREDEWEYLTFNNLNQCLII
Kpol_1045.70       KTFYSKVYDLLRSAGPEGTSDRKYG-QDCPLDSDI-GQRKNDVHKWNVLTQDNLSKCLQI
NDAI0A06500        HKFFDQVFNYINEFSPETKLDIKYN-PSRLVTDAI-GSRRNDVKNFFKLSRNSLYDCLQI
CAGL0I04532g       KDFYKTVFEHILDYSPAGKTAREFD-DSCFDSGDI-STRPDSYKNWKKLSYHQLSHCMKI
AER018C            FAFYQKVFELLAEHSPSGQISHKSG-RQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKM
KNAG0K01290        KKFYSRVFQNIIDFSPSGATKKQYK-PECRLEGDI-GSRPDDYSNFDRLGYDNLVNCLNL
TPHA0A04380        KEFYSQVFDSIRKYSPVGKCARKYK-ESCILTDNI-PDRPENSEHWFKLTKKALENCLEF
KLLA0E17755g       QGFYGQVFKYLKEFGPVGVNIATYN-QKCSLNGDI-GYRQENTDQWWKLTTEELNNCLQL
Ecym_5314          RGFYEKVFNMLSKHAPSGSSSKIRG-ENCQLTKDI-GGRLEDQKWWYKLSYEHLSKCLQV
Kpol_1036.50       KQFYGRVFELIQAHSPLGKSKRNYK-EACLLNGDI-GDRPEFYEVWYKLSMKELGNCLEI
NDAI0G01790        EDFYNVVFQNIIDYSPSGKTARNYS-SKCKLDQGI-ASRPDSYKDWEKLSMQNLLNCLEV
NCAS0E01590        KAFFNTVFQHIIDYSPKGKTKKIYNKEKCLLDGDV-GSRPENYKDWYKLSYKNLGNCLEV
TBLA0F00740        YKFYQDIFNILKNTTIPGKSDRVYK-LECQLKGDV-GTRPDNYKEWYKLTSKELSNCLEV
ZYRO0A04950g       KRFYEEVFTHLKNFSPEGKSQRIYK-EDCPLHGDI-GFRPENYDEWPTLAHDSLENCLEI
TDEL0D04330        KKFYEQVFEDLKNYSPSSKSAREYS-KQCSLSGDI-GFRPENYNEWFKLTERELSQCLVV
KAFR0C00870        REFYNEVFQYFINYSPSGKSARHYQ-DACQLSEKM-GNRPHEYASWYKLSYTELNKCLSI
Skud_2.127         KDFYDKVFNFLILDSPTGKSARNYG-KACLLNGDI-GDRPDQYEELHKLSAKQLSKCLEL
Suva_2.142         KSFYNNVFNFLMLDSPSGKSKRVYN-EKCPLKGDI-GDRPDQYKDLYKLSAKELAKCLEL
YBR015C            KSFYNNVFNFLMVDSPKGSTAKQYN-EACLLKGDI-GDRPDHYKDLYKLSAKELSKCLEL
Smik_2.134         KSFYNNVFNFLMLDSPTGKSARKYN-EACQLSGDI-GDRPDQYEELYKLSANELSKCLEL
SAKL0C10472g       QDFYSQVFKYLHLYSPKGKSTRVYD-PRCKLDGDI-GARLDDYDNWFKLTSEELGQCLML
KLTH0G16038g       QEFYKQVFKNLRQHSPTGSSSRQYD-EKCQLNGDI-GARANDYNSWSKLTSKNLGNCLKL
Kwal_56.23117      RKFYTDVFNSLKKHSPTGVSKREYG-AQCKLSGDI-GARADDYDNWSKLTSKNLGQCLIV
                     ::  :   :                       :   .         *    *  *: .

TBLA0A00270        DDTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNE
Kpol_1045.70       DEESLAMLKNSHRKYIDGLKELG-SSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKIN
NDAI0A06500        SDQEIDMLKNYHQGFTNSIAPLE-LPKNTYQNDGIVIVGGGKYSLLSLLAIKTLRKFNTT
CAGL0I04532g       SPSEINHLRGNHKSYVDKINELV-LPKGSYKGEGIVTVGGGKFTLMALTMIKALRTLGTT
AER018C            TQKDKQMVSDKHMHYVDALSNLK-LSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTS
KNAG0K01290        SGADISNLRHSHKSFVDSLD-VT-LPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTT
TPHA0A04380        TPDEFKMLKSTHDNFVNSISKLT-LPKQGYSKQGIVMVGGGKFSMLAFLIIKTLRNLGTT
KLLA0E17755g       SQEQRLMLKEAHSNYVHALSKLV-LPKDTYSGDGIVTVGGGKFSMMAFLIIKTVRNFGTT
Ecym_5314          SRKDRKMLKKKHSDYVADLASLV-LPLDSYTGNGIVTVGGGKFSVLAFLMITTLRNVGTT
Kpol_1036.50       SKAEMSKLKAKHAKYIADISSLS-LPRNSFRGKGIVIVGGGKFSLLSFLIINAIRNQGTT
NDAI0G01790        SPEEFTNLSTSHHNFVEHVNKLV-LPKGTYNNDGIVMVGGGKFTFMAYLVLKTLRNQGTT
NCAS0E01590        SDTEFTNLKTSHASFTENLNKLV-LPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTT
TBLA0F00740        PYETAKMLQESHADYVDKIGSLV-LPKVAYGGKGIVTVGGGKFSVLAFLIIRTLRNLGTS
ZYRO0A04950g       SPEEVTMLKKNHAAYVDVLGSLR-LPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELGTT
TDEL0D04330        SNADVAKLRQSHSDYVKALGSLV-LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTT
KAFR0C00870        SKSDVLNLKTSHKEFVENLGKLV-LPKNSYKGNGIVTVGGGKFSLMSLLVIRTLRNLGTT
Skud_2.127         SPDEISRLTKSHRDYVEHIATLL-LPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNRGTN
Suva_2.142         SPDEVSKLKKSHKDYVEHIASLI-LPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTT
YBR015C            SPDEVASLTKSHKDYVEHIATLV-SPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTT
Smik_2.134         SQDEVARLTKSHKDYVDHIASLA-LPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTT
SAKL0C10472g       STREKAMLKENHAKFVENLSSLV-LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTT
KLTH0G16038g       SNKEKTMLKETHYDFVESLKSLV-LPKGTYKGDGIVTVGGGKFSMLSFLIIKTLRNLGTH
Kwal_56.23117      SDKEKRMLKEKHRGYVESLESLV-LPKGAYKGDGIVTVGGGKFSMLAFLIIKTLRNLHTS
                          :   *  :   :  :   .   :   **. :.*** :.::      :*     

TBLA0A00270        IPVEIFIPPTPQKDSLSNFDFKQSESDFC-NKISKELNTNCIFISDIIDEEDF-HLPELT
Kpol_1045.70       LPIEVFIPPMDE-G----------DDELC-NTLLPKYNAKCIFLSDFLPEDKINEDIKID
NDAI0A06500        LPVEVYISQDEE-G----------DLEFC-DEILPQYNAKCISIKNILSNDLI-NTFKFA
CAGL0I04532g       LPVEVFIPPDE--G----------ESTFC-ESVLPQYNAKCIYISDILPDDMI-QKFTFK
AER018C            LPVEVLIPPGEE-E----------EYDYC-SKLLPEVGAKCIYLKDVLPPAVI-NNHYFE
KNAG0K01290        LPVEVFIPPNEG-P----------ETEFC-TELLPKYNAKCIFIDRILPDEMI-QKFDFR
TPHA0A04380        LPVEVFIPPVDEAE----------KDDFC-KDVLPNFNAKCIFISDVLPEEQI-KTFDFK
KLLA0E17755g       LPVEVFIPPSDE-G----------DDEFC-NVLLPQYNAKCIYLSDAFPPDLI-EKSDFK
Ecym_5314          LPVEVLIPPNEE-S----------EHEFC-NNVLPEFNAKCIYLSDVLPKSVL-TSFEVK
Kpol_1036.50       LPVEVFMPNDKG-E----------DAEFC--KLLPELNAKCIYLSDVLPEETI-DQFKFG
NDAI0G01790        LPVEIFIPPIDTVK----------EETFCKSEMLSELSAKCIYMSNILPQEMI-EKFDFK
NCAS0E01590        LPIEVFIPPNEVEG----------ESEFC-SQTISDLDAKCIYISDILPKDMV-SKFEFK
TBLA0F00740        LPVEVFIPPSDE-G----------ETDFC-NNVLPQYNAKCIYMTDILPKEFV-DEFEFK
ZYRO0A04950g       LPVEVFIPPSDL-G----------ENQFC-DEILPQYNAKCVYLSDVLPPNVI-ANSQFT
TDEL0D04330        LPVEVFIPPSDE-G----------ETDLC-ETVFSKYNAKCIFLSDILPAPSL-KKFQFT
KAFR0C00870        LPVEVFIPPQEEKG----------EMEFC-NKILPQYHAKCIYISDILPQQMI-DNFEFA
Skud_2.127         LPVEVLIPPGDE-G----------ESEFC-NKILPKYNSKCIYVSDILPVETI-KKFHFE
Suva_2.142         LPVEVLIPPGDE-G----------ETEFC-SKILPKYNAKCIYISDILPAETI-EKFVFK
YBR015C            LPVEVLIPPGDE-G----------ETEFC-NKILPKYNSKCIYVSDILPRETI-EKFVFK
Smik_2.134         LPVEVLIPPGDE-G----------ESEFC-NKILPNYNAKCIYVSDILPLETI-EKFTFK
SAKL0C10472g       LPVEVLIPPKDE-G----------ETDFC-DVLLPKYNAKCIYISDVLPQSLV-DNFEFK
KLTH0G16038g       LPVEVFIPPNDE-G----------EEEFC-NTLLPKYNAKCIYISDVLPEDII-ENFDFK
Kwal_56.23117      LPVEVFIPPADE-G----------ETFFC-NELLPQYNAKCIYISDVLPQEII-DNFEFK
                   :*:*: :.                .   *      .  ::*: :   :    .     . 

TBLA0A00270        ESTTLLLALLTSSFDDTLVLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTY
Kpol_1045.70       GYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYY
NDAI0A06500        GYQYKSLAVLSSSFENLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDFWRRTTHPSYY
CAGL0I04532g       GYQFKSLAMITSSFENLLLLDADNIPVKKIDHIFESQIFRSAGLILWPDFWRRTTMPAYY
AER018C            GYQLKSAAIIASSFKDLLLLDADNIPILNLDDIFQSKPYVEHGLVLWPDFWRRSTSPDYY
KNAG0K01290        GYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYY
TPHA0A04380        GYQFKSLALISSSFEDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVYY
KLLA0E17755g       GYQFKSLAIIASSFKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYY
Ecym_5314          GYQLKSFAIIASSFQNLLLLDADNLPIKNLDDIFESKPYKSTGLVLWPDFWRRTTSPIYY
Kpol_1036.50       GYQFKSIALLLSSFDDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPDFWRRTTTPFYY
NDAI0G01790        GYQFKSLAIIASSFENLLLLDADNFPIKSLDKIFKHEPYNSTGLVMWPDFWRRTTQPIYY
NCAS0E01590        GYQFKSLAIIASSFENLLLLDADNTPIKNLNTIFKQEPYASRGLVLWPDFWRRTTQPIYY
TBLA0F00740        GYQFKSLAMIASSFDDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYY
ZYRO0A04950g       GYQFKSLSLIASSFEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYY
TDEL0D04330        GYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFY
KAFR0C00870        GYQFKSLAIIASSFENLLLLDADNFPIKPLDHIFEEEPYVSTGLVLWPDFWRRTTQPLYY
Skud_2.127         GYQFKSLALIASSFENLLLLDADNFPIKSLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYY
Suva_2.142         GYQFKSLALITSSFENLLLLDADNFPIKSLDNIFLEEPYVSTGLVMWPDFWRRTTHPLYY
YBR015C            GYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYY
Smik_2.134         GYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYY
SAKL0C10472g       GYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYY
KLTH0G16038g       GYQFKSISIIASSFENLLLLDADNFPIKALDNIFEEEPYKSTGMVLWPDFWRRTTNPAYY
Kwal_56.23117      GYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPYKSKGMVLWPDFWRRTTNPIYY
                          ::  ***.: *.*...* *:  :: :*    :    :: **.:***:  *  *

TBLA0A00270        DIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFL
Kpol_1045.70       DILDRDISQNERVRNNLDDITPPSVYT----EDLKNHKDIPMHDFEGTLPDVSTESGQLM
NDAI0A06500        DIAHIFVNKSSRIRNSYDDVTPSNVYT----DYSKSLDEIPFHDFEGTLPDLSTESGQLL
CAGL0I04532g       EIANLPYNQNKRVRNAFDDITPPEVYT----KPDGDLSEVPFHDMEGTLPDPSTESGQLL
AER018C            EIARVQVDYNRRVRNHIDNLTPASVYT----QNMKDLSSIPMHDMEGTLPDPSTESGQLL
KNAG0K01290        DIAGVPVNLKNRVRNSFDDLTPPEVYT----ENMNDLSGVPFHDLEGTMPDVSTESGQLM
TPHA0A04380        QIADVPVDYTKRVRNSIDDLTPPEIYT----EN---LDTVPLHDLQGTIPDPSTESGQLL
KLLA0E17755g       SIANTPIS-SERIRNTMDDVTPPSVYT----KDLKDLSDVPLHDLDGTIPDASTESGQLM
Ecym_5314          EVAGIPINYNKRVRNSIDDVTPASVYT----SNPYSLSTVPMHDLEGAIPDMSTESGQLM
Kpol_1036.50       KIAGITVNSKKRVRNSIDDITPPEVYT----ENMGNLVNVPLHDLEGSIPDGSTESGQLM
NDAI0G01790        KLADIYVNVLKRVRNDIDDITPTKVYS----DDNFDFTKIPFHDFEGTMPDDSTESGQLM
NCAS0E01590        KIAGIPVNLQKRVRNDIDDLTPVGVYT----KP--DMVDIPFHDFEGTMPDVSTESGQLM
TBLA0F00740        SIADVPVNEKKRVRNTFDDLTPVEIYT----EDISDLSDVPFHDLEGTLPDVSTESGQLM
ZYRO0A04950g       DIADITVNRRKRIRNCFDDLTPPEVYT----KNTKSMDDIPFHDFEGTIPDVSTESGQLM
TDEL0D04330        DIAGIQVDRKKRVRNCFDDLTPPEVYT----KNLGDLSNVPFHDLEGSIPEVSTESGQLM
KAFR0C00870        EIADVSVDFKTRVRNSIDDITPPPVYT----KDMNDLSNIPLHDLKGTIPDVSTESGQLM
Skud_2.127         EIAGIPVNMNKRVRNSQDDITPPAVYT----KDLKNLDDVPLSDLDGTIPDVSTESGQLM
Suva_2.142         DIAGIPVNKERRVRNSQDDITPPAVYT----KDLKDLDAVPLSDMEGAIPDVSTESGQLM
YBR015C            DIAGIAVDKKKRVRNSRDDITPPAVYT----KDLKDLSDVPLSDLDGTIPDVSTESGQLM
Smik_2.134         EIADITVNMKNRVRNSQDDLTPPAIYT----KNSNDLGGVPLSDLDGTIPDVSTESGQLM
SAKL0C10472g       DIADIPISYNKRVRNCIDNITPPELYT----EDMEDLSNVPLHDLDGTIPDVSTESGQLM
KLTH0G16038g       EIADIAVNYKKRVRNCMDDITPPQAYT----KDMKNLENVPLHDLEGTIPDVSTESGQLM
Kwal_56.23117      DIADIEVNYKKRVRNCMDDVTPPAVYT----KDMSDLSNVPLHDLEGTIPDVSTESGQLM
                   .:     .   *:*   *::**   *:    .       :*: *:.*::*:  *...*::

TBLA0A00270        IKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPF
Kpol_1045.70       INKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVG
NDAI0A06500        LNKKEHLKAILLALYYNVNGPNWYYPIFSQGVAGEGDKETFLAGANFYNLTYYQVKTYPR
CAGL0I04532g       ISKAKHLPTLLLSLYYNVNGPNWYYPIFSQRTAGEGDKETFISAASFYSLSYYQVKTSVG
AER018C            IDKERHLSTVLLSLYYNVNGETWYYPLFSQGAPGEGDKETFIAAANFYRKPYYQVRTSTG
KNAG0K01290        VNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTS
TPHA0A04380        INKKQHVPTLLLSLYYNINGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTG
KLLA0E17755g       INKLKHFPTVLLSLYYNVYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPR
Ecym_5314          ISKRTHLGTALLSLYYNVNGPTWYYPLFSQGASGEGDKETFIAAASFYQLPFYQVRTVTG
Kpol_1036.50       INKSKHLATILLSLYYNVNGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFYQVKTNTG
NDAI0G01790        INKSKHLPTVLLALYYNVNGPNWYYPIFSQNAHGEGDKETFIAAATFYRLPFYQVRTKVG
NCAS0E01590        VNKSKHLATVLLALYYNVNGPNWYYPIFSQKAAGEGDKETFIAGANFYDLPYYQVKSKVG
TBLA0F00740        INKEKHIATVLLALYYNFNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVG
ZYRO0A04950g       ISKSTHLPTILLALYYNVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATG
TDEL0D04330        ISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATG
KAFR0C00870        ISKSKHLPTVLLALYYNVNGPSWYYPIFSQKASGEGDKETFLAAANFYDLPYYQIRTEVG
Skud_2.127         INKSKQLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGEPFYQVRTRTG
Suva_2.142         INKSKHLATALLSLFYNVNGINWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKTKTG
YBR015C            INKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVRTRTG
Smik_2.134         INKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTG
SAKL0C10472g       ISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATA
KLTH0G16038g       IRKSRHLPTILLSLYYNVNGPTWYYPIFSQKASGEGDKETFIAAANFYGLPFYQVKSVTA
Kwal_56.23117      IRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEGDKETFIAAANFYDLPFYQVKSVTA
                   : *  :. : **:::*.. * .*** :  *     ..*: :  .*     .:**:.    

TBLA0A00270        LDGIVKTKERPMFS-STLYHDFQQDFAFYTFAKMNIKSTYDL---KDSND---IQFDPSY
Kpol_1045.70       TDGYTRP--GGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPN-----TKQ---DKIDKEY
NDAI0A06500        VSGHFNKEDGSYRGVAILQSDFVDDYKRYSHAMDDINSKYKD---LSPNE---IKLDEDY
CAGL0I04532g       VDGYFRHDGSGYRGVGMLQHDFIQDSKQYMEAFEYSNTKYNN-LRSEKGS---ISYDPSY
AER018C            AEGYH--TKKGFSGVAMLQHDFREDYRRYEAAREDVKTKYAK-------S---QQYDPEY
KNAG0K01290        VDGYF--ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSY
TPHA0A04380        VDGYHQADNKGFRGVAMLQHDFVQDYKRFLKAKDKIQSIYKT-----VES---RIFDKNY
KLLA0E17755g       VDGYHRHNNEGFRGVCMLQHDFAQDYKRYRQAQNEIGTKYTN------EP---DDYDPKY
Ecym_5314          VDGYH--RSSGYRGVAMLQHDFRQDYERYTHSKEDTEAKYAA------GS---AAYESSY
Kpol_1036.50       VDGYHQADNKGFRGVAMLQFDFHQDYLRYKRAKEAIEYQYQD-----KNL---RTYDKRY
NDAI0G01790        ADGYH--TKDRFQGVAMAQHDFIQDYEHYQIAQREIKKRYSN-----VKD---IKYDAEY
NCAS0E01590        VDGYH--RKEGFRGVAMLQHDFVQDYNRYKLASADIAREYSN-----PSS---VVFDKSY
TBLA0F00740        VDGYHQSDDKGFRGVAMLQHDFVQDYERYERARNEIDIKYGG----AKKV---MKYDYNY
ZYRO0A04950g       VEGYHRANNEGFRGVAMLQHDLNQDYLRYQAAADAIEAKYGG---KTAKS---IKYDKLY
TDEL0D04330        VEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGA-----QAK---ISYDSSY
KAFR0C00870        VDGYHQPENKGFRGVAMLQHDFAQDYKRYVKAKEEVRLKYGK--DRYSSK---IKYDPNY
Skud_2.127         VEGYH--ENKDFHGVAMLQHDFVQDYSRYLIASKKTNDKYNT--MKSSAS---IKFDKSY
Suva_2.142         VEGYH--DSDGFHGVAMLQHDFVQDYSRYLTASKTINNKYKDLIIKSSAP---IKFDKDY
YBR015C            VEGYH--DEDGFHGVAMLQHDFVQDYGRYLNAMESIGNKYGG--TKSADA---IKFDKNY
Smik_2.134         VEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKD--IKSSAA---IKYDKNY
SAKL0C10472g       VDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG---KTSNS---IHLDKDY
KLTH0G16038g       VDGYHQPDNKGFRGVAMLQHDFVQDYSRYKWAKSDIENKYAG---KVPQF---IKQDTSY
Kwal_56.23117      VDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEIRSHFAG---KDTQY---AKYDPSY
                    .*          .      *  :*      :       :                :  *

TBLA0A00270        TY-EKFSNNYMDVGW----EAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLM
Kpol_1045.70       SP-FDFTDKFFEDEH------ADPVIDVMFVHAHLPKFEPVALWEENDLMQD-GSHVRSY
NDAI0A06500        DL-QNFLDKYFELEG--------KQADVMFIHANFPKFDPVDLESGSSFIHE-GKHFRSF
CAGL0I04532g       DP-NEFFDKFFSRKK--PDGGDESKADVMFVHCNLPKFDPYVSWDTNDLVYQ-TKHFRSF
AER018C            TV-EGFYKKYFEDPN-------QPPVDVMFVHANLPKFEPLKMSEKQLLMEN-GSHFRSY
KNAG0K01290        SL-EDFKNKYFREDS---------HNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSY
TPHA0A04380        SL-EDYYKNYILKTN-SFDKNDEGEVDIMFVHSNLPKFDPISLWKQNELIVN-GEHIRGY
KLLA0E17755g       NYQENYLGKYFTNDP----------VDVMFVHSHLPKFDPVELALSQDLIQD-GKHIRSY
Ecym_5314          NV-NDFYNTYFGTYN------SQEPLDVMFVHSNLPKLEPLSL--STDLMED-GQHIRSY
Kpol_1036.50       SL-NDFYRKYIMIND--DRNGGTSEADVMFVHSNLPKFDPVGLWRGQDLIEH-GKHIRSF
NDAI0G01790        AV-QKFYDEFFNKDT-----TKYGEIDIMFLHSNLPKFDPLKLWEDSALIDETGKHFRSF
NCAS0E01590        TV-QKFYDKYFDNTD--------EDIDVMFIHSNLPKFDPLPLWKDNDLIED-GKPVRSY
TBLA0F00740        SP-DDFYKTYFDSGDDSNVNQPIKEVDIMFVHSNLPKFDPFTLWDENDLTLD-GSHFRSY
ZYRO0A04950g       SL-DNFYKTFFGSEN-----SALKECDVMFAHSHAPKFDPYGLWTQNELVQD-GKHFRSY
TDEL0D04330        SL-HEFYKTYFGADE----PNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSY
KAFR0C00870        DV-DSFYRTYFDSGS-EPGQGGAQEVDVMFIHSNLPKFEPLTSWKTSDLIID-GKHIRSF
Skud_2.127         SF-ENYFEEFFENED----TNAKNHVDVMFIHSNLPKFDPYDLSETNFLTID-KKPARSY
Suva_2.142         SL-EKYIKEFFDNED----SHAKDHVDVMFIHSNLPKFDPYDLSKSNFLTTD-NKPARSF
YBR015C            SL-EKYTEEFFDNED----LNAKNHVDVMFIHSNFPKFDPYDLSKSNFLTTN-GKPARSY
Smik_2.134         SL-EKYTKEFFDNED----LKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTD-DKPARSF
SAKL0C10472g       TP-ESFYRKYFEGDD-------IKEVDIMFVHSNLPKFDPLTLWREKDLIVN-GKHIRSY
KLTH0G16038g       SP-DAMYKTYFEPED-------LKEVDIMFVHSNLPKFDPYTLWNDKDLIVD-GKHIRSY
Kwal_56.23117      SP-DAVYKKFFSDDN-------IGETDIMFVHSNLPKFDPYQLWHDQDLIVD-GKHIRSY
                            ::                :** *.:  . :*        :     .     

TBLA0A00270        TWNIAIFEKQNIELESFKTMHEYLC---EKA--YYFDYLEDEYVDETNALPGMCLFIKQR
Kpol_1045.70       T-KYDKLNHYDLEMENFKALEELLC---LEKP-FEFKYLKDKLSDDKEKWQGLCKYIKDR
NDAI0A06500        D-NLKDIKYYDLELETFKILNNIIC---VER--KHFKYIDDK---GVEERGKVCKYIEDR
CAGL0I04532g       N-NKKVIAQFDIELENFKFFNETLCPYENGK--GKFKYLDNKL--SEERWPQMCDYISKR
AER018C            S-HLDKLHNYDIELESFRVLNEYLC---VRK--VQLKFYKDKLS-RPAKWNSMCKYVEDR
KNAG0K01290        T-NLRKFGDFDIELENFKIFKNFFC---GDQKVSYFSYLYDALEKTPTGWNDMCEYINKR
TPHA0A04380        R-AIEKLNNYDIELENFKTFNQYLC---VEK--TKFVHVEKHLE-NEQDRKSMCDYIKSR
KLLA0E17755g       R-NLKRMNGYDLELEVFKTFKEYVC---DKR--VHFKYFEKAVK-LESNWGIICNYVNER
Ecym_5314          S-NLKRLHGYDIELRSFQTFNEYLC---DKR--VKFKYYEKTLI-DEESWTSMCDYIKGR
Kpol_1036.50       R-NLQRLNNYDIELENFTIFYKHLC---LKR--RSFKYLEDELGDNEEDWKDMCKYIKDR
NDAI0G01790        S-DPKIVKKYDIEYENFKIIKDVIC---DKG--IHFSYLDEELQEKPQDWVSMCQYIKDR
NCAS0E01590        T-NLRKLGYHDIEYENFKTLKELLC---EKN--VDFKYLADEFKSNPQARMSFCKYITDR
TBLA0F00740        L-KLPHLTHYDLEYENFKIFHQSLC---VLK--NQFKYLEDKFQGKESNRESMCNYIMDR
ZYRO0A04950g       T-SLEKINNYDLELSAIDSIHKFVC---LDK--VNFKYLSEKIQ-SKQEHQEMCDYISKR
TDEL0D04330        T-ALSKINRYDLELENFKAINEYVC---VKR--TNVKYLNENLA-TSAEWASMCDYIRDR
KAFR0C00870        T-NLKRLKNYDIELENFKIYHEVLC---EQG--LHFKYLDDALGNNKNDKSSMCKYISDR
Skud_2.127         T-ALHKIQNYDIELENFKALKEYVC---TNK--NPFKYLDDALGEDKVKWKKMCDYITER
Suva_2.142         T-SLGKIHKYDIELENFKALHEYVC---VNK--NPFKYLDDALGQDEKGWKKMCDYIAKR
YBR015C            T-ALKKVKNYDIELENFKVLNEYVC---VNK--NPFKYLDDLLGQDKTEWKRVCGYITDR
Smik_2.134         T-ALHKVQNYDIELENFKVLKEYVC---DKK--NPFKYLDDKLGEDKKEWRRMCDYIAKR
SAKL0C10472g       T-NLKRLNGYDLELESFKVFQDYLC---VQR--SHFKYLDEHLQ-EEAQWQSMCDYIHNR
KLTH0G16038g       T-NLRRLNNYDLELENFKVFKEYLC---VSR--TKFKYLDDSLQGDERQWKSMCGYIKER
Kwal_56.23117      R-NLKRLNGYDLELENFKIFNEYLC---TTQ--ARFKYLDDKLNGDQRNWKDMCSYIGER
                         .   ::*   :    . .*          . .  .           .* ::  *

TBLA0A00270        LDFLQSSADDAKKTIDARIKFEEKMMEYDKLKNQLSLEDKLIKARIEKILSTKRLREKEV
Kpol_1045.70       HIFMEKTHEEHFS-----------------------------------------------
NDAI0A06500        LKFLEETHEEAITPKS--------------------------------------------
CAGL0I04532g       LQYLKESHNEALGLEKATEA----------------------------------------
AER018C            LKFLESTHEEALRKT---------------------------------------------
KNAG0K01290        LVFLEKTHLEAVNKKD--------------------------------------------
TPHA0A04380        LEYLEKTHDSIFKKD---------------------------------------------
KLLA0E17755g       LVYLIESHSEAMEGRF--------------------------------------------
Ecym_5314          LSFLERTHDEALNKN---------------------------------------------
Kpol_1036.50       VTFLNMSHQRAITPNTD-------------------------------------------
NDAI0G01790        YIFLKDTHQDATSPVVNT------------------------------------------
NCAS0E01590        YKYLEETHQEALSASE--------------------------------------------
TBLA0F00740        LKYLTDTHEMALKGPISA------------------------------------------
ZYRO0A04950g       REFLLSTHQQAISK----------------------------------------------
TDEL0D04330        LAYLQSTHVQAVSPSK--------------------------------------------
KAFR0C00870        LDFLQSTHEAAISN----------------------------------------------
Skud_2.127         LEFLESTHDKAIADK---------------------------------------------
Suva_2.142         LQFLESTHEKAIAGK---------------------------------------------
YBR015C            LAFLESTHDKAIAGK---------------------------------------------
Smik_2.134         LQFLESTHDKVIAGN---------------------------------------------
SAKL0C10472g       LKFLDSTHKDAVSVA---------------------------------------------
KLTH0G16038g       LNFLDQTHSDAINAS---------------------------------------------
Kwal_56.23117      LKYLEQTHLDAIHAP---------------------------------------------
                     ::  :                                                     

TBLA0A00270        YFKKKPRINLKENGTPDWDSELFFEEIEESSVTDLDAEKDVDETATVDELITEEEIEFQK
Kpol_1045.70       ------------------------------------------------------------
NDAI0A06500        ------------------------------------------------------------
CAGL0I04532g       ------------------------------------------------------------
AER018C            ------------------------------------------------------------
KNAG0K01290        ------------------------------------------------------------
TPHA0A04380        ------------------------------------------------------------
KLLA0E17755g       ------------------------------------------------------------
Ecym_5314          ------------------------------------------------------------
Kpol_1036.50       ------------------------------------------------------------
NDAI0G01790        ------------------------------------------------------------
NCAS0E01590        ------------------------------------------------------------
TBLA0F00740        ------------------------------------------------------------
ZYRO0A04950g       ------------------------------------------------------------
TDEL0D04330        ------------------------------------------------------------
KAFR0C00870        ------------------------------------------------------------
Skud_2.127         ------------------------------------------------------------
Suva_2.142         ------------------------------------------------------------
YBR015C            ------------------------------------------------------------
Smik_2.134         ------------------------------------------------------------
SAKL0C10472g       ------------------------------------------------------------
KLTH0G16038g       ------------------------------------------------------------
Kwal_56.23117      ------------------------------------------------------------
                                                                               

TBLA0A00270        LQDLEEDKNGGKFAKMRKKKSNILEGSFKHKKEQPPIFGIERNGRLELVKLDEMLEIILL
Kpol_1045.70       ------------------------------------------------------------
NDAI0A06500        ------------------------------------------------------------
CAGL0I04532g       ------------------------------------------------------------
AER018C            ------------------------------------------------------------
KNAG0K01290        ------------------------------------------------------------
TPHA0A04380        ------------------------------------------------------------
KLLA0E17755g       ------------------------------------------------------------
Ecym_5314          ------------------------------------------------------------
Kpol_1036.50       ------------------------------------------------------------
NDAI0G01790        ------------------------------------------------------------
NCAS0E01590        ------------------------------------------------------------
TBLA0F00740        ------------------------------------------------------------
ZYRO0A04950g       ------------------------------------------------------------
TDEL0D04330        ------------------------------------------------------------
KAFR0C00870        ------------------------------------------------------------
Skud_2.127         ------------------------------------------------------------
Suva_2.142         ------------------------------------------------------------
YBR015C            ------------------------------------------------------------
Smik_2.134         ------------------------------------------------------------
SAKL0C10472g       ------------------------------------------------------------
KLTH0G16038g       ------------------------------------------------------------
Kwal_56.23117      ------------------------------------------------------------
                                                                               

TBLA0A00270        DSKVKFDAQNRGAIREKDDLSLFNDIDKQEENSDQKIEGTGVKGAPKKDGKLNLRDDPVM
Kpol_1045.70       ------------------------------------------------------------
NDAI0A06500        ------------------------------------------------------------
CAGL0I04532g       ------------------------------------------------------------
AER018C            ------------------------------------------------------------
KNAG0K01290        ------------------------------------------------------------
TPHA0A04380        ------------------------------------------------------------
KLLA0E17755g       ------------------------------------------------------------
Ecym_5314          ------------------------------------------------------------
Kpol_1036.50       ------------------------------------------------------------
NDAI0G01790        ------------------------------------------------------------
NCAS0E01590        ------------------------------------------------------------
TBLA0F00740        ------------------------------------------------------------
ZYRO0A04950g       ------------------------------------------------------------
TDEL0D04330        ------------------------------------------------------------
KAFR0C00870        ------------------------------------------------------------
Skud_2.127         ------------------------------------------------------------
Suva_2.142         ------------------------------------------------------------
YBR015C            ------------------------------------------------------------
Smik_2.134         ------------------------------------------------------------
SAKL0C10472g       ------------------------------------------------------------
KLTH0G16038g       ------------------------------------------------------------
Kwal_56.23117      ------------------------------------------------------------
                                                                               

TBLA0A00270        QELVRKKKQELMEENKRKNGVNVIKYAPIPEGQDVPKGFNPMEKAAVKKKLEKDLKLKNK
Kpol_1045.70       ------------------------------------------------------------
NDAI0A06500        ------------------------------------------------------------
CAGL0I04532g       ------------------------------------------------------------
AER018C            ------------------------------------------------------------
KNAG0K01290        ------------------------------------------------------------
TPHA0A04380        ------------------------------------------------------------
KLLA0E17755g       ------------------------------------------------------------
Ecym_5314          ------------------------------------------------------------
Kpol_1036.50       ------------------------------------------------------------
NDAI0G01790        ------------------------------------------------------------
NCAS0E01590        ------------------------------------------------------------
TBLA0F00740        ------------------------------------------------------------
ZYRO0A04950g       ------------------------------------------------------------
TDEL0D04330        ------------------------------------------------------------
KAFR0C00870        ------------------------------------------------------------
Skud_2.127         ------------------------------------------------------------
Suva_2.142         ------------------------------------------------------------
YBR015C            ------------------------------------------------------------
Smik_2.134         ------------------------------------------------------------
SAKL0C10472g       ------------------------------------------------------------
KLTH0G16038g       ------------------------------------------------------------
Kwal_56.23117      ------------------------------------------------------------
                                                                               

TBLA0A00270        FVGRPKGKAELNAPTSPEETKGKISTKYNNFEKS
Kpol_1045.70       ----------------------------------
NDAI0A06500        ----------------------------------
CAGL0I04532g       ----------------------------------
AER018C            ----------------------------------
KNAG0K01290        ----------------------------------
TPHA0A04380        ----------------------------------
KLLA0E17755g       ----------------------------------
Ecym_5314          ----------------------------------
Kpol_1036.50       ----------------------------------
NDAI0G01790        ----------------------------------
NCAS0E01590        ----------------------------------
TBLA0F00740        ----------------------------------
ZYRO0A04950g       ----------------------------------
TDEL0D04330        ----------------------------------
KAFR0C00870        ----------------------------------
Skud_2.127         ----------------------------------
Suva_2.142         ----------------------------------
YBR015C            ----------------------------------
Smik_2.134         ----------------------------------
SAKL0C10472g       ----------------------------------
KLTH0G16038g       ----------------------------------
Kwal_56.23117      ----------------------------------
                                                     

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A00270
MKSFK--RHIGNHYRITTLICIIT--FY---------FISHC-LKEGKDPRIYEELSDTN
QD----SYLQDYII---------------------SPASNWKSNLYLNNKLSNDVQIPDK
TISKENTKLDWNARRKLLKK-------SGKPI---------------------------L
KSIFQKL---IISSSSSGQNNIQLS-PNCPIKRPV-ASKSIREDEWEYLTFNNLNQCLII
DDTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNE
IPVEIFIPPTPQKDSLSNFDFKQSESDFC-NKISKELNTNCIFISDIIDEEDF-HLPELT
ESTTLLLALLTSSFDDTLVLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTY
DIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFL
IKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPF
LDGIVKTKERPMFS-STLYHDFQQDFAFYTFAKMNIKSTYDL---KDSND---IQFDPSY
TY-EKFSNNYMDVGW----EAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLM
TWNIAIFEKQNIELESFKTMHEYLC---EKA--YYFDYLEDEYVDETNALPGMCLFIKQR
LDFLQSSADDAKKTIDARIKFEEKMMEYDKLKNQLSLEDKLIKARIEKILSTKRLREKEV
YFKKKPRINLKENGTPDWDSELFFEEIEESSVTDLDAEKDVDETATVDELITEEEIEFQK
LQDLEEDKNGGKFAKMRKKKSNILEGSFKHKKEQPPIFGIERNGRLELVKLDEMLEIILL
DSKVKFDAQNRGAIREKDDLSLFNDIDKQEENSDQKIEGTGVKGAPKKDGKLNLRDDPVM
QELVRKKKQELMEENKRKNGVNVIKYAPIPEGQDVPKGFNPMEKAAVKKKLEKDLKLKNK
FVGRPKGKAELNAPTSPEETKGKISTKYNNFEKS
>Kpol_1045.70
-MVSN--RRFSKLFKVSLVLVAV--LTF---------VILRH---------HKDETAKVL
QN--YTDAVSSYIG---------------------DSIGSLTGSSTDTASSSSSTTTNDD
NKETQLEDADDDDDDDELNFVQMEEKRLREN----------------------------M
KTFYSKVYDLLRSAGPEGTSDRKYG-QDCPLDSDI-GQRKNDVHKWNVLTQDNLSKCLQI
DEESLAMLKNSHRKYIDGLKELG-SSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKIN
LPIEVFIPPMDE-G----------DDELC-NTLLPKYNAKCIFLSDFLPEDKINEDIKID
GYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYY
DILDRDISQNERVRNNLDDITPPSVYT----EDLKNHKDIPMHDFEGTLPDVSTESGQLM
INKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVG
TDGYTRP--GGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPN-----TKQ---DKIDKEY
SP-FDFTDKFFEDEH------ADPVIDVMFVHAHLPKFEPVALWEENDLMQD-GSHVRSY
T-KYDKLNHYDLEMENFKALEELLC---LEKP-FEFKYLKDKLSDDKEKWQGLCKYIKDR
HIFMEKTHEEHFS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>NDAI0A06500
MLMLSFPRRSLKIFKLSLLLILIA-LAI---------VLATT---------LGYE-ANPL
SD--YKFHFEKSLF-----------PTNHHNSLANTNNKDDKHSLLSALVTSDENIDTPN
KYELDNVVALPKTTILSPETIGTSGTVASTEEKP---------------------STETI
HKFFDQVFNYINEFSPETKLDIKYN-PSRLVTDAI-GSRRNDVKNFFKLSRNSLYDCLQI
SDQEIDMLKNYHQGFTNSIAPLE-LPKNTYQNDGIVIVGGGKYSLLSLLAIKTLRKFNTT
LPVEVYISQDEE-G----------DLEFC-DEILPQYNAKCISIKNILSNDLI-NTFKFA
GYQYKSLAVLSSSFENLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDFWRRTTHPSYY
DIAHIFVNKSSRIRNSYDDVTPSNVYT----DYSKSLDEIPFHDFEGTLPDLSTESGQLL
LNKKEHLKAILLALYYNVNGPNWYYPIFSQGVAGEGDKETFLAGANFYNLTYYQVKTYPR
VSGHFNKEDGSYRGVAILQSDFVDDYKRYSHAMDDINSKYKD---LSPNE---IKLDEDY
DL-QNFLDKYFELEG--------KQADVMFIHANFPKFDPVDLESGSSFIHE-GKHFRSF
D-NLKDIKYYDLELETFKILNNIIC---VER--KHFKYIDDK---GVEERGKVCKYIEDR
LKFLEETHEEAITPKS--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>CAGL0I04532g
--MFN--RRFAKLVKLVLITVSIVGGLY---------YLSG--F-------IDGDTSTAL
GNRLSQEYMDSFWK---------------------TYDSSKSSYGSSLLGGSGEKGETDF
RSP------------------------EAKLK---------------------------I
KDFYKTVFEHILDYSPAGKTAREFD-DSCFDSGDI-STRPDSYKNWKKLSYHQLSHCMKI
SPSEINHLRGNHKSYVDKINELV-LPKGSYKGEGIVTVGGGKFTLMALTMIKALRTLGTT
LPVEVFIPPDE--G----------ESTFC-ESVLPQYNAKCIYISDILPDDMI-QKFTFK
GYQFKSLAMITSSFENLLLLDADNIPVKKIDHIFESQIFRSAGLILWPDFWRRTTMPAYY
EIANLPYNQNKRVRNAFDDITPPEVYT----KPDGDLSEVPFHDMEGTLPDPSTESGQLL
ISKAKHLPTLLLSLYYNVNGPNWYYPIFSQRTAGEGDKETFISAASFYSLSYYQVKTSVG
VDGYFRHDGSGYRGVGMLQHDFIQDSKQYMEAFEYSNTKYNN-LRSEKGS---ISYDPSY
DP-NEFFDKFFSRKK--PDGGDESKADVMFVHCNLPKFDPYVSWDTNDLVYQ-TKHFRSF
N-NKKVIAQFDIELENFKFFNETLCPYENGK--GKFKYLDNKL--SEERWPQMCDYISKR
LQYLKESHNEALGLEKATEA----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>AER018C
--MLR--RKYSKTLKLSLITVALG-ALF---------LVTNR-W-------LPGE---FP
SV--YTEYLQNRLP---------------------NLGSFGKQQHMEEQESQTRQMIEEG
EMRSKPSELLEEEAARTEQA-------ERKSQ---------------------------I
FAFYQKVFELLAEHSPSGQISHKSG-RQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKM
TQKDKQMVSDKHMHYVDALSNLK-LSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTS
LPVEVLIPPGEE-E----------EYDYC-SKLLPEVGAKCIYLKDVLPPAVI-NNHYFE
GYQLKSAAIIASSFKDLLLLDADNIPILNLDDIFQSKPYVEHGLVLWPDFWRRSTSPDYY
EIARVQVDYNRRVRNHIDNLTPASVYT----QNMKDLSSIPMHDMEGTLPDPSTESGQLL
IDKERHLSTVLLSLYYNVNGETWYYPLFSQGAPGEGDKETFIAAANFYRKPYYQVRTSTG
AEGYH--TKKGFSGVAMLQHDFREDYRRYEAAREDVKTKYAK-------S---QQYDPEY
TV-EGFYKKYFEDPN-------QPPVDVMFVHANLPKFEPLKMSEKQLLMEN-GSHFRSY
S-HLDKLHNYDIELESFRVLNEYLC---VRK--VQLKFYKDKLS-RPAKWNSMCKYVEDR
LKFLESTHEEALRKT---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>KNAG0K01290
MNFVN--RRFVKLLRVAVFVVFGC-VLF---------IAATH-Y-------VYDG-ANSV
SG--YGKHLQEHLS----------------------GTATVSAPSAKTAASAVAGGAGGG
VPAAAGAAAAALDSMK-------------------------------------------L
KKFYSRVFQNIIDFSPSGATKKQYK-PECRLEGDI-GSRPDDYSNFDRLGYDNLVNCLNL
SGADISNLRHSHKSFVDSLD-VT-LPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTT
LPVEVFIPPNEG-P----------ETEFC-TELLPKYNAKCIFIDRILPDEMI-QKFDFR
GYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYY
DIAGVPVNLKNRVRNSFDDLTPPEVYT----ENMNDLSGVPFHDLEGTMPDVSTESGQLM
VNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTS
VDGYF--ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSY
SL-EDFKNKYFREDS---------HNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSY
T-NLRKFGDFDIELENFKIFKNFFC---GDQKVSYFSYLYDALEKTPTGWNDMCEYINKR
LVFLEKTHLEAVNKKD--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>TPHA0A04380
MSVFS--KRFSKLLKFSIIIVVLF-LLFSYTHISESDLIPISIYDGIGLSDSDNDSKNSL
NE--YSNYLKGFLK---------------------QDNEGSVNYGANSHSGKGNSDKSKG
SLAQGSKPPATSFSENAKTVEKNVNSSDRTKL---------------------------L
KEFYSQVFDSIRKYSPVGKCARKYK-ESCILTDNI-PDRPENSEHWFKLTKKALENCLEF
TPDEFKMLKSTHDNFVNSISKLT-LPKQGYSKQGIVMVGGGKFSMLAFLIIKTLRNLGTT
LPVEVFIPPVDEAE----------KDDFC-KDVLPNFNAKCIFISDVLPEEQI-KTFDFK
GYQFKSLALISSSFEDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVYY
QIADVPVDYTKRVRNSIDDLTPPEIYT----EN---LDTVPLHDLQGTIPDPSTESGQLL
INKKQHVPTLLLSLYYNINGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTG
VDGYHQADNKGFRGVAMLQHDFVQDYKRFLKAKDKIQSIYKT-----VES---RIFDKNY
SL-EDYYKNYILKTN-SFDKNDEGEVDIMFVHSNLPKFDPISLWKQNELIVN-GEHIRGY
R-AIEKLNNYDIELENFKTFNQYLC---VEK--TKFVHVEKHLE-NEQDRKSMCDYIKSR
LEYLEKTHDSIFKKD---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>KLLA0E17755g
MVFTT--KRFQKVFKVVVAFALAV--VV---------LNSIHVY-------LKSE--IAT
ND--YTSSLKEYTQQFIEEYEDTGSSYDDARQEASQQQGDKQGSQTNTNGDSNNKINGDK
IKNNNNYYNENNNDGVVKDNVGASSTPSSKKK--------------------------QV
QGFYGQVFKYLKEFGPVGVNIATYN-QKCSLNGDI-GYRQENTDQWWKLTTEELNNCLQL
SQEQRLMLKEAHSNYVHALSKLV-LPKDTYSGDGIVTVGGGKFSMMAFLIIKTVRNFGTT
LPVEVFIPPSDE-G----------DDEFC-NVLLPQYNAKCIYLSDAFPPDLI-EKSDFK
GYQFKSLAIIASSFKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYY
SIANTPIS-SERIRNTMDDVTPPSVYT----KDLKDLSDVPLHDLDGTIPDASTESGQLM
INKLKHFPTVLLSLYYNVYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPR
VDGYHRHNNEGFRGVCMLQHDFAQDYKRYRQAQNEIGTKYTN------EP---DDYDPKY
NYQENYLGKYFTNDP----------VDVMFVHSHLPKFDPVELALSQDLIQD-GKHIRSY
R-NLKRMNGYDLELEVFKTFKEYVC---DKR--VHFKYFEKAVK-LESNWGIICNYVNER
LVYLIESHSEAMEGRF--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>Ecym_5314
--MLT--RRFSKTLRLTVLTLIVC-SLF---------LISNR-T-------ITGELSQSI
-----HAYLEDWIV---------------------LNGGDGKDRQILQEVIDAINGEDET
HRESASRSDNAEKSIPDKLLSHSTPTAEEESR------------------------QAKL
RGFYEKVFNMLSKHAPSGSSSKIRG-ENCQLTKDI-GGRLEDQKWWYKLSYEHLSKCLQV
SRKDRKMLKKKHSDYVADLASLV-LPLDSYTGNGIVTVGGGKFSVLAFLMITTLRNVGTT
LPVEVLIPPNEE-S----------EHEFC-NNVLPEFNAKCIYLSDVLPKSVL-TSFEVK
GYQLKSFAIIASSFQNLLLLDADNLPIKNLDDIFESKPYKSTGLVLWPDFWRRTTSPIYY
EVAGIPINYNKRVRNSIDDVTPASVYT----SNPYSLSTVPMHDLEGAIPDMSTESGQLM
ISKRTHLGTALLSLYYNVNGPTWYYPLFSQGASGEGDKETFIAAASFYQLPFYQVRTVTG
VDGYH--RSSGYRGVAMLQHDFRQDYERYTHSKEDTEAKYAA------GS---AAYESSY
NV-NDFYNTYFGTYN------SQEPLDVMFVHSNLPKLEPLSL--STDLMED-GQHIRSY
S-NLKRLHGYDIELRSFQTFNEYLC---DKR--VKFKYYEKTLI-DEESWTSMCDYIKGR
LSFLERTHDEALNKN---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>Kpol_1036.50
MVMIS--RRFSRVVKLSLLFSAIV-SIF---------LISQS-Y-------SNRNVAKSV
TE--YKEYLQLFINQEQEEAQQTGIHDEVGPNSNSNNNDNRHIEGTITSTNTNTNTNTNN
NNNNNNNNNNDNNNNNDNDNDNDKEKENGKKKNPIQINSMLDEHLSTDSIQDLDENTKSL
KQFYGRVFELIQAHSPLGKSKRNYK-EACLLNGDI-GDRPEFYEVWYKLSMKELGNCLEI
SKAEMSKLKAKHAKYIADISSLS-LPRNSFRGKGIVIVGGGKFSLLSFLIINAIRNQGTT
LPVEVFMPNDKG-E----------DAEFC--KLLPELNAKCIYLSDVLPEETI-DQFKFG
GYQFKSIALLLSSFDDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPDFWRRTTTPFYY
KIAGITVNSKKRVRNSIDDITPPEVYT----ENMGNLVNVPLHDLEGSIPDGSTESGQLM
INKSKHLATILLSLYYNVNGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFYQVKTNTG
VDGYHQADNKGFRGVAMLQFDFHQDYLRYKRAKEAIEYQYQD-----KNL---RTYDKRY
SL-NDFYRKYIMIND--DRNGGTSEADVMFVHSNLPKFDPVGLWRGQDLIEH-GKHIRSF
R-NLQRLNNYDIELENFTIFYKHLC---LKR--RSFKYLEDELGDNEEDWKDMCKYIKDR
VTFLNMSHQRAITPNTD-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>NDAI0G01790
-MFFT--RKFARLLKITTILCLLC--FFCI-------WIPSE-Y-------STNS-SISV
QE--YKEYLQGYIN---------------------KLPIQSNSNVNDDTQKEFQHLVSGE
NKED---------IPS-----------IKKNT---------------------------V
EDFYNVVFQNIIDYSPSGKTARNYS-SKCKLDQGI-ASRPDSYKDWEKLSMQNLLNCLEV
SPEEFTNLSTSHHNFVEHVNKLV-LPKGTYNNDGIVMVGGGKFTFMAYLVLKTLRNQGTT
LPVEIFIPPIDTVK----------EETFCKSEMLSELSAKCIYMSNILPQEMI-EKFDFK
GYQFKSLAIIASSFENLLLLDADNFPIKSLDKIFKHEPYNSTGLVMWPDFWRRTTQPIYY
KLADIYVNVLKRVRNDIDDITPTKVYS----DDNFDFTKIPFHDFEGTMPDDSTESGQLM
INKSKHLPTVLLALYYNVNGPNWYYPIFSQNAHGEGDKETFIAAATFYRLPFYQVRTKVG
ADGYH--TKDRFQGVAMAQHDFIQDYEHYQIAQREIKKRYSN-----VKD---IKYDAEY
AV-QKFYDEFFNKDT-----TKYGEIDIMFLHSNLPKFDPLKLWEDSALIDETGKHFRSF
S-DPKIVKKYDIEYENFKIIKDVIC---DKG--IHFSYLDEELQEKPQDWVSMCQYIKDR
YIFLKDTHQDATSPVVNT------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>NCAS0E01590
MVLLR--RRFSRVFKLALLLSIVGAGLF---------FFNSGQY--------SES--ISV
KD--YKEYLQNYIN---------------------SNSDPTPSSSPNAAKQPAANLKDES
NKNNNKKNGGSVGSPK-----------THDEK---------------------------M
KAFFNTVFQHIIDYSPKGKTKKIYNKEKCLLDGDV-GSRPENYKDWYKLSYKNLGNCLEV
SDTEFTNLKTSHASFTENLNKLV-LPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTT
LPIEVFIPPNEVEG----------ESEFC-SQTISDLDAKCIYISDILPKDMV-SKFEFK
GYQFKSLAIIASSFENLLLLDADNTPIKNLNTIFKQEPYASRGLVLWPDFWRRTTQPIYY
KIAGIPVNLQKRVRNDIDDLTPVGVYT----KP--DMVDIPFHDFEGTMPDVSTESGQLM
VNKSKHLATVLLALYYNVNGPNWYYPIFSQKAAGEGDKETFIAGANFYDLPYYQVKSKVG
VDGYH--RKEGFRGVAMLQHDFVQDYNRYKLASADIAREYSN-----PSS---VVFDKSY
TV-QKFYDKYFDNTD--------EDIDVMFIHSNLPKFDPLPLWKDNDLIED-GKPVRSY
T-NLRKLGYHDIEYENFKTLKELLC---EKN--VDFKYLADEFKSNPQARMSFCKYITDR
YKYLEETHQEALSASE--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>TBLA0F00740
-MILT--RRFFKLLKLISAVIVLT-GLF---------IATNN-Y-------LDDAVSVSV
SD--YTQRLQSYINLSPEIVNSNNEKPPLTAEIISEDSSNVNHMATVTSTANNNNNINSN
SKLSNPKSNSGSSSSKSNIKTQEDDEATRKQK---------------------------V
YKFYQDIFNILKNTTIPGKSDRVYK-LECQLKGDV-GTRPDNYKEWYKLTSKELSNCLEV
PYETAKMLQESHADYVDKIGSLV-LPKVAYGGKGIVTVGGGKFSVLAFLIIRTLRNLGTS
LPVEVFIPPSDE-G----------ETDFC-NNVLPQYNAKCIYMTDILPKEFV-DEFEFK
GYQFKSLAMIASSFDDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYY
SIADVPVNEKKRVRNTFDDLTPVEIYT----EDISDLSDVPFHDLEGTLPDVSTESGQLM
INKEKHIATVLLALYYNFNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVG
VDGYHQSDDKGFRGVAMLQHDFVQDYERYERARNEIDIKYGG----AKKV---MKYDYNY
SP-DDFYKTYFDSGDDSNVNQPIKEVDIMFVHSNLPKFDPFTLWDENDLTLD-GSHFRSY
L-KLPHLTHYDLEYENFKIFHQSLC---VLK--NQFKYLEDKFQGKESNRESMCNYIMDR
LKYLTDTHEMALKGPISA------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>ZYRO0A04950g
MPLVT--RRYGKALRLALLGLLVC-LVF---------LGTTR-Y-------NGDH--AAA
-----EEYLRKYLS---------------------GGQLEHALNSVAAHGSDAAAALR-Q
GVGSDQQAVDQQHTQDHASTQSSTLGPDSTAK---------------------------L
KRFYEEVFTHLKNFSPEGKSQRIYK-EDCPLHGDI-GFRPENYDEWPTLAHDSLENCLEI
SPEEVTMLKKNHAAYVDVLGSLR-LPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELGTT
LPVEVFIPPSDL-G----------ENQFC-DEILPQYNAKCVYLSDVLPPNVI-ANSQFT
GYQFKSLSLIASSFEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYY
DIADITVNRRKRIRNCFDDLTPPEVYT----KNTKSMDDIPFHDFEGTIPDVSTESGQLM
ISKSTHLPTILLALYYNVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATG
VEGYHRANNEGFRGVAMLQHDLNQDYLRYQAAADAIEAKYGG---KTAKS---IKYDKLY
SL-DNFYKTFFGSEN-----SALKECDVMFAHSHAPKFDPYGLWTQNELVQD-GKHFRSY
T-SLEKINNYDLELSAIDSIHKFVC---LDK--VNFKYLSEKIQ-SKQEHQEMCDYISKR
REFLLSTHQQAISK----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>TDEL0D04330
MALIT--KRYRKALKLATVVLVLC-VTF---------IATSR-F-------MDEG--LSV
SE--YQDYIKSYLG----------------------------NAQPADTISRNPAVDVGL
NAGREPIANGGNAK---------------------------------------------L
KKFYEQVFEDLKNYSPSSKSAREYS-KQCSLSGDI-GFRPENYNEWFKLTERELSQCLVV
SNADVAKLRQSHSDYVKALGSLV-LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTT
LPVEVFIPPSDE-G----------ETDLC-ETVFSKYNAKCIFLSDILPAPSL-KKFQFT
GYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFY
DIAGIQVDRKKRVRNCFDDLTPPEVYT----KNLGDLSNVPFHDLEGSIPEVSTESGQLM
ISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATG
VEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGA-----QAK---ISYDSSY
SL-HEFYKTYFGADE----PNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSY
T-ALSKINRYDLELENFKAINEYVC---VKR--TNVKYLNENLA-TSAEWASMCDYIRDR
LAYLQSTHVQAVSPSK--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>KAFR0C00870
MAVVN--KRFSKLF---ILLVSIG-FFF---------LLTNRLY-------INND-SVSV
KD--YKEYLQSYIN---------------------NNAGDSTDAQGTKGGDESVPAAS--
-KGKNPVLMSTVES-------------NTKNR---------------------------L
REFYNEVFQYFINYSPSGKSARHYQ-DACQLSEKM-GNRPHEYASWYKLSYTELNKCLSI
SKSDVLNLKTSHKEFVENLGKLV-LPKNSYKGNGIVTVGGGKFSLMSLLVIRTLRNLGTT
LPVEVFIPPQEEKG----------EMEFC-NKILPQYHAKCIYISDILPQQMI-DNFEFA
GYQFKSLAIIASSFENLLLLDADNFPIKPLDHIFEEEPYVSTGLVLWPDFWRRTTQPLYY
EIADVSVDFKTRVRNSIDDITPPPVYT----KDMNDLSNIPLHDLKGTIPDVSTESGQLM
ISKSKHLPTVLLALYYNVNGPSWYYPIFSQKASGEGDKETFLAAANFYDLPYYQIRTEVG
VDGYHQPENKGFRGVAMLQHDFAQDYKRYVKAKEEVRLKYGK--DRYSSK---IKYDPNY
DV-DSFYRTYFDSGS-EPGQGGAQEVDVMFIHSNLPKFEPLTSWKTSDLIID-GKHIRSF
T-NLKRLKNYDIELENFKIYHEVLC---EQG--LHFKYLDDALGNNKNDKSSMCKYISDR
LDFLQSTHEAAISN----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>Skud_2.127
-MLLT--KRFSKLFKLAFIALILC-GLF---------VITNK-Y-------MDEN--TSV
RE--YKSYLQDYLD---------------------SHSNKHPSTDAPVTDDSSSSKVNDN
AATRK------------------------------------------------------L
KDFYDKVFNFLILDSPTGKSARNYG-KACLLNGDI-GDRPDQYEELHKLSAKQLSKCLEL
SPDEISRLTKSHRDYVEHIATLL-LPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNRGTN
LPVEVLIPPGDE-G----------ESEFC-NKILPKYNSKCIYVSDILPVETI-KKFHFE
GYQFKSLALIASSFENLLLLDADNFPIKSLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYY
EIAGIPVNMNKRVRNSQDDITPPAVYT----KDLKNLDDVPLSDLDGTIPDVSTESGQLM
INKSKQLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGEPFYQVRTRTG
VEGYH--ENKDFHGVAMLQHDFVQDYSRYLIASKKTNDKYNT--MKSSAS---IKFDKSY
SF-ENYFEEFFENED----TNAKNHVDVMFIHSNLPKFDPYDLSETNFLTID-KKPARSY
T-ALHKIQNYDIELENFKALKEYVC---TNK--NPFKYLDDALGEDKVKWKKMCDYITER
LEFLESTHDKAIADK---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>Suva_2.142
-MLLT--KRFSKLFKLAFIALLLC-GLF---------VVTNK-Y-------MDEN--TSV
KD--YKSHLQSYID----------------------SYANKDSSSPEDAAAAAAADDAAS
LKGNDNASTEK------------------------------------------------L
KSFYNNVFNFLMLDSPSGKSKRVYN-EKCPLKGDI-GDRPDQYKDLYKLSAKELAKCLEL
SPDEVSKLKKSHKDYVEHIASLI-LPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTT
LPVEVLIPPGDE-G----------ETEFC-SKILPKYNAKCIYISDILPAETI-EKFVFK
GYQFKSLALITSSFENLLLLDADNFPIKSLDNIFLEEPYVSTGLVMWPDFWRRTTHPLYY
DIAGIPVNKERRVRNSQDDITPPAVYT----KDLKDLDAVPLSDMEGAIPDVSTESGQLM
INKSKHLATALLSLFYNVNGINWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKTKTG
VEGYH--DSDGFHGVAMLQHDFVQDYSRYLTASKTINNKYKDLIIKSSAP---IKFDKDY
SL-EKYIKEFFDNED----SHAKDHVDVMFIHSNLPKFDPYDLSKSNFLTTD-NKPARSF
T-SLGKIHKYDIELENFKALHEYVC---VNK--NPFKYLDDALGQDEKGWKKMCDYIAKR
LQFLESTHEKAIAGK---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>YBR015C
-MLLT--KRFSKLFKLTFIVLILC-GLF---------VITNK-Y-------MDEN--TSV
KE--YKEYLDRYVQ---------------------SYSNKYSSSSDAASADDSTPLRDND
EAGNEK-----------------------------------------------------L
KSFYNNVFNFLMVDSPKGSTAKQYN-EACLLKGDI-GDRPDHYKDLYKLSAKELSKCLEL
SPDEVASLTKSHKDYVEHIATLV-SPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTT
LPVEVLIPPGDE-G----------ETEFC-NKILPKYNSKCIYVSDILPRETI-EKFVFK
GYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYY
DIAGIAVDKKKRVRNSRDDITPPAVYT----KDLKDLSDVPLSDLDGTIPDVSTESGQLM
INKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVRTRTG
VEGYH--DEDGFHGVAMLQHDFVQDYGRYLNAMESIGNKYGG--TKSADA---IKFDKNY
SL-EKYTEEFFDNED----LNAKNHVDVMFIHSNFPKFDPYDLSKSNFLTTN-GKPARSY
T-ALKKVKNYDIELENFKVLNEYVC---VNK--NPFKYLDDLLGQDKTEWKRVCGYITDR
LAFLESTHDKAIAGK---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>Smik_2.134
-MLLT--KRFAKLFKLTFLVLILC-GLF---------VVTNK-Y-------MDEN--TSV
KD--YKKYLLDNIN---------------------SYSSKHSSSSDNAGADDSSSLKGND
KVSNEK-----------------------------------------------------L
KSFYNNVFNFLMLDSPTGKSARKYN-EACQLSGDI-GDRPDQYEELYKLSANELSKCLEL
SQDEVARLTKSHKDYVDHIASLA-LPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTT
LPVEVLIPPGDE-G----------ESEFC-NKILPNYNAKCIYVSDILPLETI-EKFTFK
GYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYY
EIADITVNMKNRVRNSQDDLTPPAIYT----KNSNDLGGVPLSDLDGTIPDVSTESGQLM
INKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTG
VEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKD--IKSSAA---IKYDKNY
SL-EKYTKEFFDNED----LKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTD-DKPARSF
T-ALHKVQNYDIELENFKVLKEYVC---DKK--NPFKYLDDKLGEDKKEWRRMCDYIAKR
LQFLESTHDKVIAGN---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>SAKL0C10472g
MVLLT--KRFAKVFKLAAITTLCC-LLF---------ILTNK-Y-------ISQD--LPV
DE--YKSYLQNYID---------------------KYTSGSGNPPAVVPSPPQKGRDREP
MTDVSRQPASKKEL-------------QRRQK---------------------------L
QDFYSQVFKYLHLYSPKGKSTRVYD-PRCKLDGDI-GARLDDYDNWFKLTSEELGQCLML
STREKAMLKENHAKFVENLSSLV-LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTT
LPVEVLIPPKDE-G----------ETDFC-DVLLPKYNAKCIYISDVLPQSLV-DNFEFK
GYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYY
DIADIPISYNKRVRNCIDNITPPELYT----EDMEDLSNVPLHDLDGTIPDVSTESGQLM
ISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATA
VDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG---KTSNS---IHLDKDY
TP-ESFYRKYFEGDD-------IKEVDIMFVHSNLPKFDPLTLWREKDLIVN-GKHIRSY
T-NLKRLNGYDLELESFKVFQDYLC---VQR--SHFKYLDEHLQ-EEAQWQSMCDYIHNR
LKFLDSTHKDAVSVA---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>KLTH0G16038g
MVLLT--KRFNKIFRFSLVAALCC-LIF---------VLSTR-Y-------IDQD--LSS
LE--YVRYLQNYHE---------------------TYSGNGNKVEPEVETPPAPAANDKI
KSPSGGPVLSAQDQ-------------KRRQA---------------------------L
QEFYKQVFKNLRQHSPTGSSSRQYD-EKCQLNGDI-GARANDYNSWSKLTSKNLGNCLKL
SNKEKTMLKETHYDFVESLKSLV-LPKGTYKGDGIVTVGGGKFSMLSFLIIKTLRNLGTH
LPVEVFIPPNDE-G----------EEEFC-NTLLPKYNAKCIYISDVLPEDII-ENFDFK
GYQFKSISIIASSFENLLLLDADNFPIKALDNIFEEEPYKSTGMVLWPDFWRRTTNPAYY
EIADIAVNYKKRVRNCMDDITPPQAYT----KDMKNLENVPLHDLEGTIPDVSTESGQLM
IRKSRHLPTILLSLYYNVNGPTWYYPIFSQKASGEGDKETFIAAANFYGLPFYQVKSVTA
VDGYHQPDNKGFRGVAMLQHDFVQDYSRYKWAKSDIENKYAG---KVPQF---IKQDTSY
SP-DAMYKTYFEPED-------LKEVDIMFVHSNLPKFDPYTLWNDKDLIVD-GKHIRSY
T-NLRRLNNYDLELENFKVFKEYLC---VSR--TKFKYLDDSLQGDERQWKSMCGYIKER
LNFLDQTHSDAINAS---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>Kwal_56.23117
MVFLT--KRFSKIFKLSLVAALCC-LAF---------MFSTK-Y-------FDKD--LTS
LE--YGKLVDTFMA-----------------------DAGYGKDAQEVAGSSSDGTADNN
GIGAGAKVSTSSNE-------------KRKIA---------------------------M
RKFYTDVFNSLKKHSPTGVSKREYG-AQCKLSGDI-GARADDYDNWSKLTSKNLGQCLIV
SDKEKRMLKEKHRGYVESLESLV-LPKGAYKGDGIVTVGGGKFSMLAFLIIKTLRNLHTS
LPVEVFIPPADE-G----------ETFFC-NELLPQYNAKCIYISDVLPQEII-DNFEFK
GYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPYKSKGMVLWPDFWRRTTNPIYY
DIADIEVNYKKRVRNCMDDVTPPAVYT----KDMSDLSNVPLHDLEGTIPDVSTESGQLM
IRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEGDKETFIAAANFYDLPFYQVKSVTA
VDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEIRSHFAG---KDTQY---AKYDPSY
SP-DAVYKKFFSDDN-------IGETDIMFVHSNLPKFDPYQLWHDQDLIVD-GKHIRSY
R-NLKRLNGYDLELENFKIFNEYLC---TTQ--ARFKYLDDKLNGDQRNWKDMCSYIGER
LKYLEQTHLDAIHAP---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------