MUSCLE (3.8) multiple sequence alignment

CAGL0I04554g       -------------------------------------MLTGVLFTILYFLSHFSGPSSAD
Ecym_5313          MIEGSCCLIRTVMSLSNSPMSVKKHSRFLTKKAGRILLVTTVLFIVSFLLFQHSTTGNSL
Kpol_1045.69       ------------------------MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTD
TPHA0H00630        -------------------------MSLMNKRNVRILSITGLLLFVVFLFVQNDNWLL--
AER017C            -------------------MLPKSNSKFISRRGMRMLLVTGVLLVLTYFIIQNGTTSDQF
NDAI0G01800        ------------------------MAVVLNKRNIRVLITTCVLIVIGVFVFQNANAST-Y
NCAS0E01600        ------------------------MAIVLNKRNIRVVGITAALLCLVFFIIQSANNSAFT
KLLA0E17733g       ---------------------------MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRS
Skud_2.126         ------------------------MAIVINKRNVRVLVITNILLILVFLVVRSSNADASE
Suva_2.141         ------------------------MAIVINKRNVRVLVITNLLLVLVFLVIRNSSTSAGE
Smik_2.133         ------------------------MAIVINKRNVRVLVITNLLLILVFLVVRNSNANVNE
YBR014C            ------------------------MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNE
Suva_4.238         -------------------------MILSNKRNARILSITMLLLLLVFFIAQNANFLAIE
Skud_4.242         -------------------------MIPPNKRNARILSITMLLLLLVFFIVQNANFLTIE
Smik_4.223         -------------------------MVHSNKRNARILSITMLLLLLVFFVAQNANFLTLE
YDL010W            -------------------------MIPSNKRNARILSITTLLLLLVFFVAQNANFLT--
KNAG0J01260        ------------------------MAITLNKRNIRALSVTLLLLLLVLFVTQNARNVSVT
TBLA0F00750        --------------------------------------MTCLLLLLVFFVIQNANSISFN
ZYRO0A04928g       ------------------------MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIG
TDEL0D04320        ------------------------MSVSLKKRNLRVLSVTALLLLLVFFVVQNANSISFG
KAFR0A01230        ------------------------MAVILNKRNIRIVSVTSILLLLVFFVIRDANSIT-L
SAKL0C10494g       ---------------------------MLTKRNLRVLTITGFLVFLIFFIVQNANTVAVA
Kwal_56.23114      ---------------------------MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSS--
KLTH0G16060g       ---------------------------MLSKRNLRVFVFTGVLLVLIYFIIQNAHTTV--
                                                          *  :. :  :. .        

CAGL0I04554g       SAFRQVGPGSRNSKGGGNLGPPIMEAEMNGNTNNIEKAEAG---NKAMDTTSNSGTSNEN
Ecym_5313          FNSPFPGEGRKQPKRPIAEED------IATEANSNKDGQIS---NRKNDHVVDVTTVNDK
Kpol_1045.69       PSGL-ISDAFESTSVKGMIDSDNVRVGGKVRYSSDDLVKGT---AKDDKVNAEIDKIKEE
TPHA0H00630        -----------------------------------ESVVSD---SSASAPSRTAERVRNN
AER017C            VTPIAPRPVPNAPSVQDTVEA------EEPSVQLLSKGAEG--AVAASKEDVDVARAQQQ
NDAI0G01800        TSSKALKSTITDTNSIVQAHG-------------EDENIPALKNVDNSPVSTEITSEEDS
NCAS0E01600        TESPSKQSNKPALNSLVGAHG------DDLNIPATHNVLQD---NVESAPTVETESESNN
KLLA0E17733g       YVGKESSNLANDAKVESDINN-------------IQEGIAE---TKSNAVVADTSNAVKN
Skud_2.126         AVKIIHPGSLATFDQSGNAPG-------------TPESADK---AVTNKQDKEVGETNED
Suva_2.141         SGVNYHPGSLVTFDESGNAPG-------------TPESIHG---SVANKQDKEVDEVNEN
Smik_2.133         STITPHGTSLATYNDAGNAPG-------------THKSVHD---SDANKQVKEPDETNEN
YBR014C            SITTHHPDSLVTFDNSGNAPG-------------THQSVHD----TVNTQDKEAEEVDKN
Suva_4.238         TKEEEKPPQLLDIDKNSISGR------SSRRIASVPTSTTN---KGNSEVDEEINEIKQK
Skud_4.242         TKEEKPFQVFSTNMDSLSVGS-------SKKLATEPTSAIK---KGSSEVDEEINEIKQK
Smik_4.223         TKERESSELFDSEMNNLAAES-------TRKYVAVPTSATN---KGSSEVDEEINEIKQK
YDL010W            VEIKEETSKAFSTNMDNMAGG------SSREYAAMPTSTTN---KGSSEVDEEINEIKQK
KNAG0J01260        VDDRQVLEGVPLVNYANVEDP------------------------------VSVAAVKPK
TBLA0F00750        ADSITNSLVSSTGNSNTHPDSNALKNNNIKDDKTRKISDKSSEKGNDAGVDAQFDKIKQE
ZYRO0A04928g       -ESSSLANANSNEDQTLTSAGTSINKESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQE
TDEL0D04320        EEELKAATFVNPVASGLTSAGTAVH--NNDEIVVDKESGKKGKDQESALVDAEIDKIKQE
KAFR0A01230        SQSISNSETVAKTDLDGASAS----------------NKKK---TDNSEATEEIDRIKQE
SAKL0C10494g       NKNSGRANGVPPSSKLIHSDG------DEQEVAVQKQQEKE-----DSAVNAEIAQIQQE
Kwal_56.23114      ----DVGKAINRKPETLIGDG-----------VVAKAKETT---KIDEDVDQAIRNIQEE
KLTH0G16060g       TSGNSSLSGQTASGAVIHSKG-------------NHKSSGE----VDPSVDKEIQEIKNE
                                                                              .

CAGL0I04554g       A-QLPGSKDQTDSNSNS--------------LS----NKEGQEDAEEAADAEYSPAKEFQ
Ecym_5313          A--------------KK--------------PS----SNQPNIAEDSSDNIGYNPADRYQ
Kpol_1045.69       V-GLPFNDNNNNNIANKKLTTDNNKNNVVNEKSTVQNNAAQRAVQGGSEPVKFDPAQEYA
TPHA0H00630        E--------------------------------------APRPIVGGSSSGKFDPAQEYI
AER017C            S------------------------------------------------KVLFDAAKTYN
NDAI0G01800        K------------------------------------INADSSIVQAEAEVPFDVAKEYT
NCAS0E01600        NMELD---------ESA--------------DS----AQEKD---ASTTAPDFDVAKEYA
KLLA0E17733g       MAGPN---------------------------G----VKDSD---FAAEVETYNAEAEYK
Skud_2.126         S-----------------------------------------------KGVTFDAAAEYG
Suva_2.141         S-----------------------------------------------KEVKFDAATEYE
Smik_2.133         S-----------------------------------------------EEAQFDAAAEYD
YBR014C            S-----------------------------------------------GDAEFDAAAEYN
Suva_4.238         V-GLQ--QPIASADDSL--------------SA----IKSDK---GTGTGKGFNVQQEYS
Skud_4.242         V-GLQ--QPIASADDSL--------------SA----LKSDK---GSGTGKGFNVQKEYS
Smik_4.223         V-GLQ--RPILSDDDSL--------------SA----IKSDK---QSGTGKLFNVQKEYS
YDL010W            V-GLQ--QPIASVDDSL--------------SA----IKNDK---GSRITKAFNVQKEYS
KNAG0J01260        I-------------------------------------GTDRSGQAPEPAGVFSPAVEYD
TBLA0F00750        V-GLDTGKTTQGGLPSS--------------IG----TATDNKISNNDENGTFDAAKEYA
ZYRO0A04928g       V-GIGKTDDLETGSSGS--------------ISGGGVVGKGGSASEHAQQTEFDPVKEYA
TDEL0D04320        V-NSGSGASKDNSISQK--------------AG----SGSKD---GTVSEGEFDPAKEYS
KAFR0A01230        I-GITDDSPVP--------------------------ATNANEQNEENTAVTFNAAKEYA
SAKL0C10494g       IAGNQGGGGSNSGR-----------------------TGNKVSAAKDSSSVEFNAAKEYA
Kwal_56.23114      V-----------------------------------GIKEGSSGKSEPTRKAFDPAMEYQ
KLTH0G16060g       V-----------GIKGD--------------DG----ASSGT---DFTQEKEFDPAKEYQ
                                                                       :.    : 

CAGL0I04554g       KLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYSYIKKLTGR
Ecym_5313          KILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQFYISQQTGR
Kpol_1045.69       IISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH
TPHA0H00630        NIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH
AER017C            EILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVTKTTAR
NDAI0G01800        SILQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQTGR
NCAS0E01600        AILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQGYIKEETGR
KLLA0E17733g       NILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTGR
Skud_2.126         KILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELKDYIGDKTGR
Suva_2.141         TILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR
Smik_2.133         KILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREHTSELQEHIEKSTGR
YBR014C            KIMEQSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGR
Suva_4.238         LMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR
Skud_4.242         LMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIRLMTGR
Smik_4.223         LMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKLKTGR
YDL010W            LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR
KNAG0J01260        SILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPELQKYIAEKTGR
TBLA0F00750        MILDLSPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKKTDR
ZYRO0A04928g       MILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIELDRHHNGAELQKYVEQKTGR
TDEL0D04320        MILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR
KAFR0A01230        SILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQAYIKEKTGR
SAKL0C10494g       SILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAELQKYIGDVTGR
Kwal_56.23114      QILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR
KLTH0G16060g       YILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQKHIGSLTGR
                    :     .::::*: *. .  :  *:   : : *    :::*   .   *   :   * .

CAGL0I04554g       NTVPNLIANGDSKGGFDDMLALHNSNELESKLIEWGVGE-LQVSKV--------------
Ecym_5313          KTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKK-VTVTPKQ---KST-------
Kpol_1045.69       NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYS-VVVKAIE---KPSNS-----
TPHA0H00630        TTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFS-VIVSSKDAAPKPNKK-----
AER017C            STVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGK-HAVTQKQ---RPSNS-----
NDAI0G01800        GTVPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGA-YEVQATE---TASNKDATSV
NCAS0E01600        GTVPNLIVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGD-LEVTQTT---PDAVDA----
KLLA0E17733g       STVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGST-LSVKKAA---AAT-------
Skud_2.126         STVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDK-FTVKATS---QSERT-----
Suva_2.141         RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGA-FTVEAVP---PSEST-----
Smik_2.133         RTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGK-FTVEAIS---PSQSD-----
YBR014C            RTVPNVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGA-FTVKANS---QSESA-----
Suva_4.238         GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGK-FTVEQRE---KPSNN-----
Skud_4.242         GAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGK-FSVEQRE---KPSNN-----
Smik_4.223         GTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGK-FSVEQHE---KPSNN-----
YDL010W            GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGK-FSVEQRE---KPSNN-----
KNAG0J01260        STVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSA-VNVIQV--------------
TBLA0F00750        STVPNMIVNGISRGGRDEIVALNDEGKLLEALNDWSDNT-FTVKQAE---KPSNN-----
ZYRO0A04928g       STVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQGT-FTVLQLD---RPSNN-----
TDEL0D04320        ATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGD-FTVKQLE---KPSNN-----
KAFR0A01230        GTVPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGN-FQVKQIE---KPSNN-----
SAKL0C10494g       STVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWGGKQ-LTVSKNQ---KPSNN-----
Kwal_56.23114      ATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKE---KPSNN-----
KLTH0G16060g       STVPNVIINGVSRGGCDDFEKLQEKGELLSSLKTWCDKA-LTVSKKE---KPSNN-----
                    :***.:    * **  .:  *     :   :          *                 

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0I04554g
-------------------------------------MLTGVLFTILYFLSHFSGPSSAD
SAFRQVGPGSRNSKGGGNLGPPIMEAEMNGNTNNIEKAEAG---NKAMDTTSNSGTSNEN
A-QLPGSKDQTDSNSNS--------------LS----NKEGQEDAEEAADAEYSPAKEFQ
KLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYSYIKKLTGR
NTVPNLIANGDSKGGFDDMLALHNSNELESKLIEWGVGE-LQVSKV--------------
>Ecym_5313
MIEGSCCLIRTVMSLSNSPMSVKKHSRFLTKKAGRILLVTTVLFIVSFLLFQHSTTGNSL
FNSPFPGEGRKQPKRPIAEED------IATEANSNKDGQIS---NRKNDHVVDVTTVNDK
A--------------KK--------------PS----SNQPNIAEDSSDNIGYNPADRYQ
KILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQFYISQQTGR
KTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKK-VTVTPKQ---KST-------
>Kpol_1045.69
------------------------MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTD
PSGL-ISDAFESTSVKGMIDSDNVRVGGKVRYSSDDLVKGT---AKDDKVNAEIDKIKEE
V-GLPFNDNNNNNIANKKLTTDNNKNNVVNEKSTVQNNAAQRAVQGGSEPVKFDPAQEYA
IISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH
NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYS-VVVKAIE---KPSNS-----
>TPHA0H00630
-------------------------MSLMNKRNVRILSITGLLLFVVFLFVQNDNWLL--
-----------------------------------ESVVSD---SSASAPSRTAERVRNN
E--------------------------------------APRPIVGGSSSGKFDPAQEYI
NIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH
TTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFS-VIVSSKDAAPKPNKK-----
>AER017C
-------------------MLPKSNSKFISRRGMRMLLVTGVLLVLTYFIIQNGTTSDQF
VTPIAPRPVPNAPSVQDTVEA------EEPSVQLLSKGAEG--AVAASKEDVDVARAQQQ
S------------------------------------------------KVLFDAAKTYN
EILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVTKTTAR
STVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGK-HAVTQKQ---RPSNS-----
>NDAI0G01800
------------------------MAVVLNKRNIRVLITTCVLIVIGVFVFQNANAST-Y
TSSKALKSTITDTNSIVQAHG-------------EDENIPALKNVDNSPVSTEITSEEDS
K------------------------------------INADSSIVQAEAEVPFDVAKEYT
SILQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQTGR
GTVPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGA-YEVQATE---TASNKDATSV
>NCAS0E01600
------------------------MAIVLNKRNIRVVGITAALLCLVFFIIQSANNSAFT
TESPSKQSNKPALNSLVGAHG------DDLNIPATHNVLQD---NVESAPTVETESESNN
NMELD---------ESA--------------DS----AQEKD---ASTTAPDFDVAKEYA
AILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQGYIKEETGR
GTVPNLIVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGD-LEVTQTT---PDAVDA----
>KLLA0E17733g
---------------------------MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRS
YVGKESSNLANDAKVESDINN-------------IQEGIAE---TKSNAVVADTSNAVKN
MAGPN---------------------------G----VKDSD---FAAEVETYNAEAEYK
NILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTGR
STVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGST-LSVKKAA---AAT-------
>Skud_2.126
------------------------MAIVINKRNVRVLVITNILLILVFLVVRSSNADASE
AVKIIHPGSLATFDQSGNAPG-------------TPESADK---AVTNKQDKEVGETNED
S-----------------------------------------------KGVTFDAAAEYG
KILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELKDYIGDKTGR
STVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDK-FTVKATS---QSERT-----
>Suva_2.141
------------------------MAIVINKRNVRVLVITNLLLVLVFLVIRNSSTSAGE
SGVNYHPGSLVTFDESGNAPG-------------TPESIHG---SVANKQDKEVDEVNEN
S-----------------------------------------------KEVKFDAATEYE
TILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGR
RTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGA-FTVEAVP---PSEST-----
>Smik_2.133
------------------------MAIVINKRNVRVLVITNLLLILVFLVVRNSNANVNE
STITPHGTSLATYNDAGNAPG-------------THKSVHD---SDANKQVKEPDETNEN
S-----------------------------------------------EEAQFDAAAEYD
KILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREHTSELQEHIEKSTGR
RTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGK-FTVEAIS---PSQSD-----
>YBR014C
------------------------MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNE
SITTHHPDSLVTFDNSGNAPG-------------THQSVHD----TVNTQDKEAEEVDKN
S-----------------------------------------------GDAEFDAAAEYN
KIMEQSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGR
RTVPNVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGA-FTVKANS---QSESA-----
>Suva_4.238
-------------------------MILSNKRNARILSITMLLLLLVFFIAQNANFLAIE
TKEEEKPPQLLDIDKNSISGR------SSRRIASVPTSTTN---KGNSEVDEEINEIKQK
V-GLQ--QPIASADDSL--------------SA----IKSDK---GTGTGKGFNVQQEYS
LMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR
GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGK-FTVEQRE---KPSNN-----
>Skud_4.242
-------------------------MIPPNKRNARILSITMLLLLLVFFIVQNANFLTIE
TKEEKPFQVFSTNMDSLSVGS-------SKKLATEPTSAIK---KGSSEVDEEINEIKQK
V-GLQ--QPIASADDSL--------------SA----LKSDK---GSGTGKGFNVQKEYS
LMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIRLMTGR
GAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGK-FSVEQRE---KPSNN-----
>Smik_4.223
-------------------------MVHSNKRNARILSITMLLLLLVFFVAQNANFLTLE
TKERESSELFDSEMNNLAAES-------TRKYVAVPTSATN---KGSSEVDEEINEIKQK
V-GLQ--RPILSDDDSL--------------SA----IKSDK---QSGTGKLFNVQKEYS
LMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKLKTGR
GTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGK-FSVEQHE---KPSNN-----
>YDL010W
-------------------------MIPSNKRNARILSITTLLLLLVFFVAQNANFLT--
VEIKEETSKAFSTNMDNMAGG------SSREYAAMPTSTTN---KGSSEVDEEINEIKQK
V-GLQ--QPIASVDDSL--------------SA----IKNDK---GSRITKAFNVQKEYS
LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR
GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGK-FSVEQRE---KPSNN-----
>KNAG0J01260
------------------------MAITLNKRNIRALSVTLLLLLLVLFVTQNARNVSVT
VDDRQVLEGVPLVNYANVEDP------------------------------VSVAAVKPK
I-------------------------------------GTDRSGQAPEPAGVFSPAVEYD
SILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPELQKYIAEKTGR
STVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSA-VNVIQV--------------
>TBLA0F00750
--------------------------------------MTCLLLLLVFFVIQNANSISFN
ADSITNSLVSSTGNSNTHPDSNALKNNNIKDDKTRKISDKSSEKGNDAGVDAQFDKIKQE
V-GLDTGKTTQGGLPSS--------------IG----TATDNKISNNDENGTFDAAKEYA
MILDLSPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKKTDR
STVPNMIVNGISRGGRDEIVALNDEGKLLEALNDWSDNT-FTVKQAE---KPSNN-----
>ZYRO0A04928g
------------------------MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIG
-ESSSLANANSNEDQTLTSAGTSINKESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQE
V-GIGKTDDLETGSSGS--------------ISGGGVVGKGGSASEHAQQTEFDPVKEYA
MILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIELDRHHNGAELQKYVEQKTGR
STVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQGT-FTVLQLD---RPSNN-----
>TDEL0D04320
------------------------MSVSLKKRNLRVLSVTALLLLLVFFVVQNANSISFG
EEELKAATFVNPVASGLTSAGTAVH--NNDEIVVDKESGKKGKDQESALVDAEIDKIKQE
V-NSGSGASKDNSISQK--------------AG----SGSKD---GTVSEGEFDPAKEYS
MILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR
ATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGD-FTVKQLE---KPSNN-----
>KAFR0A01230
------------------------MAVILNKRNIRIVSVTSILLLLVFFVIRDANSIT-L
SQSISNSETVAKTDLDGASAS----------------NKKK---TDNSEATEEIDRIKQE
I-GITDDSPVP--------------------------ATNANEQNEENTAVTFNAAKEYA
SILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQAYIKEKTGR
GTVPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGN-FQVKQIE---KPSNN-----
>SAKL0C10494g
---------------------------MLTKRNLRVLTITGFLVFLIFFIVQNANTVAVA
NKNSGRANGVPPSSKLIHSDG------DEQEVAVQKQQEKE-----DSAVNAEIAQIQQE
IAGNQGGGGSNSGR-----------------------TGNKVSAAKDSSSVEFNAAKEYA
SILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAELQKYIGDVTGR
STVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWGGKQ-LTVSKNQ---KPSNN-----
>Kwal_56.23114
---------------------------MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSS--
----DVGKAINRKPETLIGDG-----------VVAKAKETT---KIDEDVDQAIRNIQEE
V-----------------------------------GIKEGSSGKSEPTRKAFDPAMEYQ
QILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR
ATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKE---KPSNN-----
>KLTH0G16060g
---------------------------MLSKRNLRVFVFTGVLLVLIYFIIQNAHTTV--
TSGNSSLSGQTASGAVIHSKG-------------NHKSSGE----VDPSVDKEIQEIKNE
V-----------GIKGD--------------DG----ASSGT---DFTQEKEFDPAKEYQ
YILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQKHIGSLTGR
STVPNVIINGVSRGGCDDFEKLQEKGELLSSLKTWCDKA-LTVSKKE---KPSNN-----