MUSCLE (3.8) multiple sequence alignment

TBLA0D02920        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD
KNAG0B00760        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD
KLTH0G02376g       MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG
Kwal_47.18898      MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG
AFR318W            MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD
Ecym_1230          MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD
CAGL0I10406g       MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD
KAFR0C02020        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD
NCAS0E00760        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD
TDEL0D05670        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD
ZYRO0D09746g       MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD
NDAI0G00890        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD
Kpol_480.10        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Skud_7.446         MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
YGR135W            MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Suva_7.423         MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Smik_6.231         MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TPHA0A05700        MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD
KLLA0E03917g       MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD
SAKL0F02530g       MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD
                   *****:****************************.**::  :*:*: ****:** ****.

TBLA0D02920        ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ
KNAG0B00760        TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ
KLTH0G02376g       SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ
Kwal_47.18898      SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ
AFR318W            TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ
Ecym_1230          TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ
CAGL0I10406g       TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ
KAFR0C02020        TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
NCAS0E00760        TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ
TDEL0D05670        TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ
ZYRO0D09746g       TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ
NDAI0G00890        TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Kpol_480.10        TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ
Skud_7.446         TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ
YGR135W            TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Suva_7.423         TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ
Smik_6.231         TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
TPHA0A05700        TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ
KLLA0E03917g       TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ
SAKL0F02530g       TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ
                      **:*.*.*.  :******:*****:* **  .*.**  *.*:****:**..:**:**

TBLA0D02920        SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY
KNAG0B00760        SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KLTH0G02376g       GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
Kwal_47.18898      GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
AFR318W            GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY
Ecym_1230          GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY
CAGL0I10406g       GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KAFR0C02020        GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
NCAS0E00760        GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
TDEL0D05670        GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
ZYRO0D09746g       GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
NDAI0G00890        GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Kpol_480.10        GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Skud_7.446         GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
YGR135W            GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Suva_7.423         GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Smik_6.231         GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
TPHA0A05700        GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF
KLLA0E03917g       GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY
SAKL0F02530g       GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
                   .***:*****:*.****** *   * **:********:******:****.*.*****:::

TBLA0D02920        KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL
KNAG0B00760        KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRG-KEEGQVIQKIYKPSEIKQLL
KLTH0G02376g       KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKL-DN-GKIAQKIFKPQEIETLL
Kwal_47.18898      KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKL-EN-GKIAQKIFKPREIETLL
AFR318W            KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRN-AD-GKVVQKIYKLGEIKDLL
Ecym_1230          KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQD-SN-GKLVQKIYKPSEIKELL
CAGL0I10406g       KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKK-GETEEFEQKIFKPAEIKQLL
KAFR0C02020        KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKG-KTNDKIYQKIFTPDEIKSLL
NCAS0E00760        KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKG-TTTDEVYQKIYKPEELKELL
TDEL0D05670        KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKA-PD-GKLYQKIFKPEEIQSLL
ZYRO0D09746g       KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG-EN-GKLYQKVFKPEEIQTLL
NDAI0G00890        KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKG-KNDGEVYQKIYKPDEIKELL
Kpol_480.10        KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG-EN-DKIYQKIFKPEEIKQLL
Skud_7.446         KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKG-PNDGEVYQKIFKPQEIKDLL
YGR135W            KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKG-ANDGEVYQKIFKPQEIKDIL
Suva_7.423         KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG-ANDGEVYQKIFKPQEIKDLL
Smik_6.231         KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG-VNDGEVYQKIFKPQEIKDLL
TPHA0A05700        KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG-EN-NKVYQKIYKPEEIKQLL
KLLA0E03917g       KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKD-AE-GKIYQKIYKPTEIATLL
SAKL0F02530g       KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKG-SN-GQLYQKIYKPQEIQTLL
                   *: : .. * .*.******.**.* *: :.:*:: :        :. **::.  *:  :*

TBLA0D02920        IKFGINKK---NDEDEDVEMK-
KNAG0B00760        VKSGITKK-DAEDGDADVEMK-
KLTH0G02376g       NKTGVTKK---ENDDE------
Kwal_47.18898      NETGINKK---ENEEE------
AFR318W            EKTGINKQ---EEKED------
Ecym_1230          QKSGIMKQ---EENAD------
CAGL0I10406g       IKTGISKK---SDEDEDVEMS-
KAFR0C02020        VKTGISKK---ENEDEDTEMKL
NCAS0E00760        LKTGITKK-SEDEDDEDEEMK-
TDEL0D05670        VKHGITKKHHDDEQDDE-----
ZYRO0D09746g       VKNGITKA--GEDEDEE-----
NDAI0G00890        IKTGVTKK--KDDETEE-----
Kpol_480.10        LKTGITKKEGEEDDDDDIEMK-
Skud_7.446         VKTGISKK--DEDDEADQEMK-
YGR135W            VKTGITKK--DEDEEADEDMK-
Suva_7.423         VKTGITKK--DEDEEADEEMK-
Smik_6.231         VKTGITKK--DEDEEADEEMK-
TPHA0A05700        SKAGITKK---SEDGEDTAMN-
KLLA0E03917g       EKTEIVKK---DDD--------
SAKL0F02530g       SKTGITKK---DDEDES-----
                    :  : *    .:         

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0D02920
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD
ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ
SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY
KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL
IKFGINKK---NDEDEDVEMK-
>KNAG0B00760
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD
TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ
SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRG-KEEGQVIQKIYKPSEIKQLL
VKSGITKK-DAEDGDADVEMK-
>KLTH0G02376g
MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG
SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ
GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKL-DN-GKIAQKIFKPQEIETLL
NKTGVTKK---ENDDE------
>Kwal_47.18898
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG
SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ
GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKL-EN-GKIAQKIFKPREIETLL
NETGINKK---ENEEE------
>AFR318W
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD
TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY
KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRN-AD-GKVVQKIYKLGEIKDLL
EKTGINKQ---EEKED------
>Ecym_1230
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD
TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY
KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQD-SN-GKLVQKIYKPSEIKELL
QKSGIMKQ---EENAD------
>CAGL0I10406g
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD
TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ
GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKK-GETEEFEQKIFKPAEIKQLL
IKTGISKK---SDEDEDVEMS-
>KAFR0C02020
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD
TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKG-KTNDKIYQKIFTPDEIKSLL
VKTGISKK---ENEDEDTEMKL
>NCAS0E00760
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD
TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKG-TTTDEVYQKIYKPEELKELL
LKTGITKK-SEDEDDEDEEMK-
>TDEL0D05670
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD
TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKA-PD-GKLYQKIFKPEEIQSLL
VKHGITKKHHDDEQDDE-----
>ZYRO0D09746g
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD
TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG-EN-GKLYQKVFKPEEIQTLL
VKNGITKA--GEDEDEE-----
>NDAI0G00890
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD
TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKG-KNDGEVYQKIYKPDEIKELL
IKTGVTKK--KDDETEE-----
>Kpol_480.10
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG-EN-DKIYQKIFKPEEIKQLL
LKTGITKKEGEEDDDDDIEMK-
>Skud_7.446
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKG-PNDGEVYQKIFKPQEIKDLL
VKTGISKK--DEDDEADQEMK-
>YGR135W
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKG-ANDGEVYQKIFKPQEIKDIL
VKTGITKK--DEDEEADEDMK-
>Suva_7.423
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG-ANDGEVYQKIFKPQEIKDLL
VKTGITKK--DEDEEADEEMK-
>Smik_6.231
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG-VNDGEVYQKIFKPQEIKDLL
VKTGITKK--DEDEEADEEMK-
>TPHA0A05700
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ
GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF
KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG-EN-NKVYQKIYKPEEIKQLL
SKAGITKK---SEDGEDTAMN-
>KLLA0E03917g
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD
TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY
KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKD-AE-GKIYQKIYKPTEIATLL
EKTEIVKK---DDD--------
>SAKL0F02530g
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD
TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKG-SN-GQLYQKIYKPQEIQTLL
SKTGITKK---DDEDES-----