MUSCLE (3.8) multiple sequence alignment

KLLA0E04027g       ------------------MSRIVKEYMGLQKRLQT-----------PEFSWISFLAPV-D
AFR314W            ------------------MRRILREYKQLQKQLAL-------------HPAVLSLAPVGE
Ecym_1234          ----------MVHRANNRASRMLAEYKQIREQLQS-------------HESILMLCPAGD
KNAG0B00780        -----------------MSQRVLREYRRLVAAGGA--------------ANESNLHPT-D
KAFR0C01990        -----------------MESRILKEYKD-SRSLQS--------------QYILALDPI-S
TBLA0C04500        ------------------MSRIIKEYNHIRKLNAL-------------PDNMTTLHPVSN
KLTH0F14894g       -----------------MSQRLAKEYRALSKTLGRD----------PEYAYIISLAPV-S
Kwal_55.21246      -----------------MSQRLAKEYKTLLKTLKED----------PAYSHIRKLRPV-S
CAGL0I10450g       ------------------MARISKELLKIRKALEHG-----------DSEFLVDLAPV-D
Skud_7.444         ------------------MSRIAKEYGDIQKTLASN-----DPIVNPYQGLIESLNPI-D
Suva_7.421         ------------------MSRITKEYRLIRKTLASD-----DPTVNPYRGIIESLNPT-D
Smik_6.229         ------------------MSRITKEYRVILKTLASD-----DPIVNPYRGIIRSLNPI-D
YGR133W            MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASD-----DPIANPYRGIIESLNPI-D
Kpol_480.13        ----------------MSERRLLKEYQVVKKELGN------------HKNIISSLEPI-D
TPHA0D04260        ----------------MSLKRLLKEKRLIEKELSG------------YSESIELLEPV-A
SAKL0F02706g       ----------------MSLQRITKEFKSVRKTLAED----------PSYNHILKLEPK-D
NDAI0G00910        ------------------MSRIIKEYKTIQKQLNNN----RNNQDDEFNNIIVSLAPI-D
NCAS0E00780        ------------------MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPI-S
ZYRO0D09878g       ------------------MSRAAKEYKTITKVLKEG--------DEVYSQLIVGMEP---
TDEL0D05630        ------------------MARIAREYKHIQATLGSE------------SSLVVSLEPI--
                                       *   *                             : *   

KLLA0E04027g       -DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLF--EPRT---VA-HP
AFR314W            ENGDLHRWEAHFQGPENTPYAGFTFTLRINVP-ETYPNEP-PKCSF--PPHH---IC-HP
Ecym_1234          -GGSLSKWEAQFCGPENTPYADFTFTLSIEIP-EMYPNEP-PNCRF--PPNH---IC-HP
KNAG0B00780        -PADLTHWEATLEGPQGTPYEGHSFPLRVTVP-DKYPTLP-PSVCF--PKRT---MP-HP
KAFR0C01990        -TDDLTHWECTIKGPLHSPFANHTFKLRIDIP-QTYPLTT-PICKF--EPFA---MP-HP
TBLA0C04500        ATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP-TEYPSIP-PVIKF--NKNS---IPPHC
KLTH0F14894g       -EENLRKWESLITGPPDTPYFGHEFTLQIEAS-EAYPLEP-PKVQF--QARC---MP-HC
Kwal_55.21246      -DDNLYVWEADITGPSDTPYQGHEFSLLITIP-SAYPLEP-PKVQF--NARC---VP-HC
CAGL0I10450g       -DSDLSRWFAVIKGPAETPYYPYEFKLAIEVP-ASYPMVP-PTIKFVSDAKAGIRVPPHC
Skud_7.444         -ETDLSKWEAIIIGPTHTPYEHYRFRILIDVP-SSYPMAP-PNIRF--DRNN---IL-HC
Suva_7.421         -ETDLSKWEATICGPEHTPYERYQFRMLIDVP-DSYPMAP-PKIMF--EKDA---IL-HC
Smik_6.229         -ETDLSRWEAKIYGPSHTPYENYQFHILIDVP-SSYPMTP-PRINF--EQND---IL-HC
YGR133W            -ETDLSKWEAIISGPSDTPYENHQFRILIEVP-SSYPMNP-PKISF--MQNN---IL-HC
Kpol_480.13        -SDDLTNWTATILGPPNTPYHGHSFDLRIHLT-PEYPLKP-PQVTF--SAYK---MP-HC
TPHA0D04260        -FENFLKWRAVLKGPVNTPYHKHSFKLLIELP-SEYPLVP-PAITF--EPYS---MP-HC
SAKL0F02706g       -TGNMYHWIADISGPPETPYASAVFALDVELP-IQYPLEP-PRVKF--LPGSRNNIC-HC
NDAI0G00910        PDQDLTKWEAVIKGPQGTPYYGFNFILYITIP-QEYPTVP-PFFEF--QPRS---MP-HC
NCAS0E00780        -TSDLTHWQAQIKGPQGTPYANHEFQLQIECP-PTYPIEP-PIIHF--QPLS---MP-HC
ZYRO0D09878g       -KEDLTRWEALIRGPSGTPYEGCNFRLHLSLP-QEYPMSP-PYVKF--EPYA---MP-HA
TDEL0D05630        -DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLG-DRYPTTP-PQVTF--ARRS---MP-HC
                      .:  *   : **  :*:    : : :      **    *   *         :  * 

KLLA0E04027g       NVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDA-DYEA
AFR314W            NIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTT-DRAA
Ecym_1234          NIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSV-DKQA
KNAG0B00780        NVKWDTGEVCLDTLAGG-WTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA
KAFR0C01990        NVNFETGEICLDILDTN-WSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKA
TBLA0C04500        NVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA
KLTH0F14894g       NVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSA
Kwal_55.21246      NVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLACLRRAGDYSA
CAGL0I10450g       NVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA
Skud_7.444         NIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA
Suva_7.421         NINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRA
Smik_6.229         NVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESA
YGR133W            NVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSA
Kpol_480.13        NIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSA
TPHA0D04260        NVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSA
SAKL0F02706g       NVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEA
NDAI0G00910        NVNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSA
NCAS0E00780        NVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA
ZYRO0D09878g       NVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNA
TDEL0D05630        NVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSA
                   *:.  :* :*:. *    *:*   :   : *:  **  *  .***::::. :    *  *

KLLA0E04027g       YVQIVRYRLEEARLARV------
AFR314W            YDGVVNYRLRTRPQP--------
Ecym_1234          YQGLVTYRLCSRTL---------
KNAG0B00780        YDGIIKYRLAHSSIK--------
KAFR0C01990        YHDLISYHLNNSAK---------
TBLA0C04500        YNSLIKYYLYNFPKPELICDCEI
KLTH0F14894g       HNSLIAYYLNGGSRGHCGHVSER
Kwal_55.21246      HNGLVAYYLNGGSRGSL------
CAGL0I10450g       YNGIIRYFLTEIDSP--------
Skud_7.444         YQGIIRYFLAERDRN--------
Suva_7.421         YQGIVKYFLAERERNNHT-----
Smik_6.229         YQGIVKYFLAERERSRYH-----
YGR133W            YQGIVKYFLAERERINNH-----
Kpol_480.13        YYGLIEYYLNNKSDK--------
TPHA0D04260        YHGLINYYLQEDTATH-------
SAKL0F02706g       YEGLIKYYIGMNGV---------
NDAI0G00910        YNGLINYYLNINVV---------
NCAS0E00780        YNGLLNYYLSASPSPSTTK----
ZYRO0D09878g       YYGLVHYYIKS------------
TDEL0D05630        YYGLVNYYLQS------------
                   :  :: * :              

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E04027g
------------------MSRIVKEYMGLQKRLQT-----------PEFSWISFLAPV-D
-DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLF--EPRT---VA-HP
NVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDA-DYEA
YVQIVRYRLEEARLARV------
>AFR314W
------------------MRRILREYKQLQKQLAL-------------HPAVLSLAPVGE
ENGDLHRWEAHFQGPENTPYAGFTFTLRINVP-ETYPNEP-PKCSF--PPHH---IC-HP
NIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTT-DRAA
YDGVVNYRLRTRPQP--------
>Ecym_1234
----------MVHRANNRASRMLAEYKQIREQLQS-------------HESILMLCPAGD
-GGSLSKWEAQFCGPENTPYADFTFTLSIEIP-EMYPNEP-PNCRF--PPNH---IC-HP
NIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSV-DKQA
YQGLVTYRLCSRTL---------
>KNAG0B00780
-----------------MSQRVLREYRRLVAAGGA--------------ANESNLHPT-D
-PADLTHWEATLEGPQGTPYEGHSFPLRVTVP-DKYPTLP-PSVCF--PKRT---MP-HP
NVKWDTGEVCLDTLAGG-WTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA
YDGIIKYRLAHSSIK--------
>KAFR0C01990
-----------------MESRILKEYKD-SRSLQS--------------QYILALDPI-S
-TDDLTHWECTIKGPLHSPFANHTFKLRIDIP-QTYPLTT-PICKF--EPFA---MP-HP
NVNFETGEICLDILDTN-WSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKA
YHDLISYHLNNSAK---------
>TBLA0C04500
------------------MSRIIKEYNHIRKLNAL-------------PDNMTTLHPVSN
ATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP-TEYPSIP-PVIKF--NKNS---IPPHC
NVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA
YNSLIKYYLYNFPKPELICDCEI
>KLTH0F14894g
-----------------MSQRLAKEYRALSKTLGRD----------PEYAYIISLAPV-S
-EENLRKWESLITGPPDTPYFGHEFTLQIEAS-EAYPLEP-PKVQF--QARC---MP-HC
NVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSA
HNSLIAYYLNGGSRGHCGHVSER
>Kwal_55.21246
-----------------MSQRLAKEYKTLLKTLKED----------PAYSHIRKLRPV-S
-DDNLYVWEADITGPSDTPYQGHEFSLLITIP-SAYPLEP-PKVQF--NARC---VP-HC
NVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLACLRRAGDYSA
HNGLVAYYLNGGSRGSL------
>CAGL0I10450g
------------------MARISKELLKIRKALEHG-----------DSEFLVDLAPV-D
-DSDLSRWFAVIKGPAETPYYPYEFKLAIEVP-ASYPMVP-PTIKFVSDAKAGIRVPPHC
NVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA
YNGIIRYFLTEIDSP--------
>Skud_7.444
------------------MSRIAKEYGDIQKTLASN-----DPIVNPYQGLIESLNPI-D
-ETDLSKWEAIIIGPTHTPYEHYRFRILIDVP-SSYPMAP-PNIRF--DRNN---IL-HC
NIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA
YQGIIRYFLAERDRN--------
>Suva_7.421
------------------MSRITKEYRLIRKTLASD-----DPTVNPYRGIIESLNPT-D
-ETDLSKWEATICGPEHTPYERYQFRMLIDVP-DSYPMAP-PKIMF--EKDA---IL-HC
NINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRA
YQGIVKYFLAERERNNHT-----
>Smik_6.229
------------------MSRITKEYRVILKTLASD-----DPIVNPYRGIIRSLNPI-D
-ETDLSRWEAKIYGPSHTPYENYQFHILIDVP-SSYPMTP-PRINF--EQND---IL-HC
NVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESA
YQGIVKYFLAERERSRYH-----
>YGR133W
MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASD-----DPIANPYRGIIESLNPI-D
-ETDLSKWEAIISGPSDTPYENHQFRILIEVP-SSYPMNP-PKISF--MQNN---IL-HC
NVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSA
YQGIVKYFLAERERINNH-----
>Kpol_480.13
----------------MSERRLLKEYQVVKKELGN------------HKNIISSLEPI-D
-SDDLTNWTATILGPPNTPYHGHSFDLRIHLT-PEYPLKP-PQVTF--SAYK---MP-HC
NIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSA
YYGLIEYYLNNKSDK--------
>TPHA0D04260
----------------MSLKRLLKEKRLIEKELSG------------YSESIELLEPV-A
-FENFLKWRAVLKGPVNTPYHKHSFKLLIELP-SEYPLVP-PAITF--EPYS---MP-HC
NVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSA
YHGLINYYLQEDTATH-------
>SAKL0F02706g
----------------MSLQRITKEFKSVRKTLAED----------PSYNHILKLEPK-D
-TGNMYHWIADISGPPETPYASAVFALDVELP-IQYPLEP-PRVKF--LPGSRNNIC-HC
NVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEA
YEGLIKYYIGMNGV---------
>NDAI0G00910
------------------MSRIIKEYKTIQKQLNNN----RNNQDDEFNNIIVSLAPI-D
PDQDLTKWEAVIKGPQGTPYYGFNFILYITIP-QEYPTVP-PFFEF--QPRS---MP-HC
NVNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSA
YNGLINYYLNINVV---------
>NCAS0E00780
------------------MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPI-S
-TSDLTHWQAQIKGPQGTPYANHEFQLQIECP-PTYPIEP-PIIHF--QPLS---MP-HC
NVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA
YNGLLNYYLSASPSPSTTK----
>ZYRO0D09878g
------------------MSRAAKEYKTITKVLKEG--------DEVYSQLIVGMEP---
-KEDLTRWEALIRGPSGTPYEGCNFRLHLSLP-QEYPMSP-PYVKF--EPYA---MP-HA
NVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNA
YYGLVHYYIKS------------
>TDEL0D05630
------------------MARIAREYKHIQATLGSE------------SSLVVSLEPI--
-DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLG-DRYPTTP-PQVTF--ARRS---MP-HC
NVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSA
YYGLVNYYLQS------------