MUSCLE (3.8) multiple sequence alignment

Ecym_1235          ---------------------------------------------MSRFLENIANIAVPI
TBLA0D02950        -------------------------------------------MSGIKIAEKLAKIAIPL
AFR313C            ---------------------------------------------MSRLADSLVRLTLPL
KLLA0D16302g       ---------------------------------------------MSRVADVMARIAIPV
KNAG0B00790        ---------------------------------------------MSKAINVLSKMAIPA
KAFR0C01980        --------------------------------------------MSTRAINVVTKLAIPS
CAGL0I10472g       -----------------------------------------MSQQANNFVRLITKVAIPV
Suva_7.420         ------------------------------------------MSNPSRFIDIITKVALPI
Skud_7.443         ------------------------------------------MSNASRLIDVITKVALPI
Smik_6.228         ------------------------------------------MSNPSRLIDIITKVALPI
YGR132C            ------------------------------------------MSNSAKLIDVITKVALPI
NDAI0G00920        ------------------------------MSGP-----GFNPQQTQKFFNLLTKVALPI
NCAS0E00790        MCMYVYIGLSFSEIRLKIQRRTGERDNKSTTTEPSKHKMAFNPQQGTKLLNVITRVALPL
TPHA0D03290        --------------------------------------------MSTKVLDRLIKIAVPL
Kpol_1017.5        ---------------------------------------------MSKIIDTVAKVALPI
SAKL0F02728g       ---------------------------------------------MSKLADSLARIALPI
KLTH0F14872g       ---------------------------------------------MSRLADSLAKIALPL
Kwal_55.21240      ---------------------------------------------MSRFADSLAKIALPL
ZYRO0D09900g       --------------------------------------------MSSRLAETVAKVAIPL
TDEL0D05620        ---------------------------------------------MSRLVENLARVAIPL
                                                                  .    : .:::* 

Ecym_1235          ---GVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKP
TBLA0D02950        ---GVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKP
AFR313C            TPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKP
KLLA0D16302g       ---GLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKP
KNAG0B00790        ---GLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKP
KAFR0C01980        ---GLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKP
CAGL0I10472g       ---GIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKP
Suva_7.420         ---GLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
Skud_7.443         ---GIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
Smik_6.228         ---GIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
YGR132C            ---GIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
NDAI0G00920        ---GLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKP
NCAS0E00790        ---GILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKP
TPHA0D03290        ---GIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKP
Kpol_1017.5        ---GIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKP
SAKL0F02728g       ---GIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKP
KLTH0F14872g       ---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKP
Kwal_55.21240      ---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKP
ZYRO0D09900g       ---GIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKP
TDEL0D05620        ---GIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKP
                      .:     :  :***.** *.:****:.**:  ::*******.****.::::*:*:**

Ecym_1235          KNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQ
TBLA0D02950        KNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQ
AFR313C            RNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQ
KLLA0D16302g       KNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQ
KNAG0B00790        KSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQ
KAFR0C01980        KSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQ
CAGL0I10472g       KSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQ
Suva_7.420         KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQ
Skud_7.443         KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQ
Smik_6.228         KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQ
YGR132C            KSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQ
NDAI0G00920        KSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ
NCAS0E00790        KSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ
TPHA0D03290        KSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQ
Kpol_1017.5        KSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQ
SAKL0F02728g       KNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQ
KLTH0F14872g       KNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQ
Kwal_55.21240      KNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQ
ZYRO0D09900g       KSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAR
TDEL0D05620        KGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQ
                   ..*:*****.*:*:*:****:****::  *. **..** ****.*****.*****:***.

Ecym_1235          FDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQES
TBLA0D02950        FDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
AFR313C            FNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQES
KLLA0D16302g       FDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDA
KNAG0B00790        FDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDA
KAFR0C01980        FDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDA
CAGL0I10472g       FDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
Suva_7.420         FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
Skud_7.443         FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
Smik_6.228         FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
YGR132C            FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
NDAI0G00920        FDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
NCAS0E00790        FDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
TPHA0D03290        FDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDA
Kpol_1017.5        FDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDA
SAKL0F02728g       FDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDA
KLTH0F14872g       FDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDA
Kwal_55.21240      FDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDA
ZYRO0D09900g       YDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDA
TDEL0D05620        FDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
                   ::*:******* :*: *. *:  *:  * :.****:****.** :***:** ******::

Ecym_1235          ERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAG
TBLA0D02950        ERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAG
AFR313C            DRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLAN
KLLA0D16302g       ERARFLVEKAEQERKAAVIRA---------------------------EVKLNLQTTF--
KNAG0B00790        ERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLEASKEIARTLSR
KAFR0C01980        ERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSK
CAGL0I10472g       ERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLAN
Suva_7.420         ERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLAN
Skud_7.443         ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
Smik_6.228         ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
YGR132C            ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
NDAI0G00920        ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
NCAS0E00790        ERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLAN
TPHA0D03290        ERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLEASKEIAKTLSQ
Kpol_1017.5        ERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQ
SAKL0F02728g       ERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLAN
KLTH0F14872g       ERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIAKTLAN
Kwal_55.21240      ERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIAKTLAN
ZYRO0D09900g       ERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLEASKDIAQTLAN
TDEL0D05620        ERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAA
                   :**.::*: *** * .:****                           *..  :  *:  

Ecym_1235          SSNITYLPSS-SKGGSHDACG--TPSSLLLNLGR-
TBLA0D02950        SPHVTYLPGG----GNQAEDA--SKNSLLLNLGR-
AFR313C            SPNVTYLPSK----GQAADSG--APNSLLLNLGR-
KLLA0D16302g       -------PRH-------------------------
KNAG0B00790        SSNVTYLPSAGAGGKHGREDG--SGNTLLLNIGR-
KAFR0C01980        SSNITYLPGG--KGREGDEKT--PPNSLLLNIGR-
CAGL0I10472g       SNNITYLPSN-HAGGDKDDKG--SPNTLLLNLGRS
Suva_7.420         SSNVIYLPSQHAGSGNSEYSG--SPNSLLLNIGR-
Skud_7.443         SSNVVYLPSQHSGNGSGDSSG--SPNSLLLNIGR-
Smik_6.228         SSNVVYLPSQHSGNGNSESSG--SPNSLLLNIGR-
YGR132C            SSNVVYLPSQHSGGGNSESSG--SPNSLLLNIGR-
NDAI0G00920        SPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR-
NCAS0E00790        SPNITYLPGQ--QGGRGNDSG--SPNSLLLNIGR-
TPHA0D03290        SSNVTYLPSGSSSNGNNESAG--TPNSLLLNLGR-
Kpol_1017.5        SSNVTYLPNG-HGNARGGSDG--TPNTLLLNLGR-
SAKL0F02728g       SSNVTYLPSN--GAGGAEQQG--SPNSLLLNLGR-
KLTH0F14872g       SSNVTYLPSS----HSASEQG--SPNSLLLNLGR-
Kwal_55.21240      SSNVTYLPSN-QQGAESNSGG--SSNSLLLNLGR-
ZYRO0D09900g       SSNVTYLPSQQSGGGQ---EG--TSQSLLLNLGRT
TDEL0D05620        SSNITYLPGK----AHGNTEG--SQNSLLLNIR--
                          *                           

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_1235
---------------------------------------------MSRFLENIANIAVPI
---GVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKP
KNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQ
FDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQES
ERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAG
SSNITYLPSS-SKGGSHDACG--TPSSLLLNLGR-
>TBLA0D02950
-------------------------------------------MSGIKIAEKLAKIAIPL
---GVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKP
KNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAG
SPHVTYLPGG----GNQAEDA--SKNSLLLNLGR-
>AFR313C
---------------------------------------------MSRLADSLVRLTLPL
TPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKP
RNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQ
FNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQES
DRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLAN
SPNVTYLPSK----GQAADSG--APNSLLLNLGR-
>KLLA0D16302g
---------------------------------------------MSRVADVMARIAIPV
---GLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKP
KNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQ
FDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDA
ERARFLVEKAEQERKAAVIRA---------------------------EVKLNLQTTF--
-------PRH-------------------------
>KNAG0B00790
---------------------------------------------MSKAINVLSKMAIPA
---GLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKP
KSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDA
ERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLEASKEIARTLSR
SSNVTYLPSAGAGGKHGREDG--SGNTLLLNIGR-
>KAFR0C01980
--------------------------------------------MSTRAINVVTKLAIPS
---GLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKP
KSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDA
ERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSK
SSNITYLPGG--KGREGDEKT--PPNSLLLNIGR-
>CAGL0I10472g
-----------------------------------------MSQQANNFVRLITKVAIPV
---GIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKP
KSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLAN
SNNITYLPSN-HAGGDKDDKG--SPNTLLLNLGRS
>Suva_7.420
------------------------------------------MSNPSRFIDIITKVALPI
---GLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLAN
SSNVIYLPSQHAGSGNSEYSG--SPNSLLLNIGR-
>Skud_7.443
------------------------------------------MSNASRLIDVITKVALPI
---GIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
SSNVVYLPSQHSGNGSGDSSG--SPNSLLLNIGR-
>Smik_6.228
------------------------------------------MSNPSRLIDIITKVALPI
---GIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
SSNVVYLPSQHSGNGNSESSG--SPNSLLLNIGR-
>YGR132C
------------------------------------------MSNSAKLIDVITKVALPI
---GIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP
KSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
SSNVVYLPSQHSGGGNSESSG--SPNSLLLNIGR-
>NDAI0G00920
------------------------------MSGP-----GFNPQQTQKFFNLLTKVALPI
---GLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKP
KSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ
FDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN
SPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR-
>NCAS0E00790
MCMYVYIGLSFSEIRLKIQRRTGERDNKSTTTEPSKHKMAFNPQQGTKLLNVITRVALPL
---GILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKP
KSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ
FDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLAN
SPNITYLPGQ--QGGRGNDSG--SPNSLLLNIGR-
>TPHA0D03290
--------------------------------------------MSTKVLDRLIKIAVPL
---GIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKP
KSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQ
FDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDA
ERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLEASKEIAKTLSQ
SSNVTYLPSGSSSNGNNESAG--TPNSLLLNLGR-
>Kpol_1017.5
---------------------------------------------MSKIIDTVAKVALPI
---GIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKP
KSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQ
FDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDA
ERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQ
SSNVTYLPNG-HGNARGGSDG--TPNTLLLNLGR-
>SAKL0F02728g
---------------------------------------------MSKLADSLARIALPI
---GIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKP
KNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQ
FDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDA
ERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLAN
SSNVTYLPSN--GAGGAEQQG--SPNSLLLNLGR-
>KLTH0F14872g
---------------------------------------------MSRLADSLAKIALPL
---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKP
KNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQ
FDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDA
ERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIAKTLAN
SSNVTYLPSS----HSASEQG--SPNSLLLNLGR-
>Kwal_55.21240
---------------------------------------------MSRFADSLAKIALPL
---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKP
KNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQ
FDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDA
ERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIAKTLAN
SSNVTYLPSN-QQGAESNSGG--SSNSLLLNLGR-
>ZYRO0D09900g
--------------------------------------------MSSRLAETVAKVAIPL
---GIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKP
KSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAR
YDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDA
ERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLEASKDIAQTLAN
SSNVTYLPSQQSGGGQ---EG--TSQSLLLNLGRT
>TDEL0D05620
---------------------------------------------MSRLVENLARVAIPL
---GIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKP
KGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQ
FDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA
ERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAA
SSNITYLPGK----AHGNTEG--SQNSLLLNIR--