MUSCLE (3.8) multiple sequence alignment

TBLA0C04490        MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA
TBLA0D02960        MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA
Suva_7.419         MLSVADNIVRIINAIFLIISIGLVSGLISSQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA
Skud_7.442         MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTN-GSSRVNFCMFAAAYGLITDSFYGFLA
Smik_6.227         MLSAADNLIRIINAVFLIISIGLISGLISTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA
YGR131W            MLSAADNLVRIINAVFLIISIGLISGLIGTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA
AFR312W            MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRN-SHSRVNFGLFTAVFALVTDSFYSIVA
Ecym_1236          MLSILDNSLRAANFLFLIIVLALTGSLINGQNR-SHSRVNFGLFTAIFALLFDSLYSVLA
Kpol_1017.6        MLSLADNIMRAINFCFFVICMGLIGSLLATEKG-HSSRVNYCMFVPPFAVVTDSFYGILA
TPHA0D03280        MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA
TDEL0D05610        MLAIVDNALRLVNFAFLVILLGLVGELISSEDG-HSSRVNFCMFAAAFGIVTDSFYGILA
ZYRO0D09966g       MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA
KLLA0D16280g       MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDH-SSSRVNFAIFAAVFGIVFDSLYALIA
SAKL0F02750g       MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA
KLTH0F14850g       MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA
Kwal_55.21238      MLSILDNSLRAANFVFLLIVLGLTGSLAATRDN-NNPQVNFAVFAAAFGLLFDTLYAIPA
NDAI0B05880        MLSKVDNILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAF
NCAS0F03560        MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNH-GSSRVNYCMFAAAFGLLTDSFFGMAA
NDAI0G00930        MLSVADNLLRLLNAMFLVICIGLNSALLNTQQG-HNSRINYCMFTCVYCLLTDSFFGILA
NCAS0E00800        MLGVADNLLRILNAVFLVICIGLNSALLNTKTH-NNSRINYCMFTCAYCLTTDSIYGIFA
KAFR0G03700        MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA
KAFR0C01970        MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA
KNAG0A07950        MLALADIFLRLVNFVFLVICMGLISALLNTQHG-HSSRINYCMFTAAYGITTDSFYGVVA
KNAG0B00800        MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA
Suva_16.478        MLAPVDNILRIINFLFLVISIGLISSLLNTQSG-NSSRINYCMFAVAYAIVTDSLYGVFA
Skud_16.444        MLAPADNILRIINFLFLVIVIGLISSLLNTQDR-NSSRVNFCMFAAAYGIFTDSLYGVFA
Smik_16.402        MLALADNILRIINFLFLVISIALISSLLNTQDK-HSSRVNYCMFACAYGIFTDSLYGVFA
YPR149W            MLALADNILRIINFLFLVISIGLISSLLNTQHR-HSSRVNYCMFACAYGIFTDSLYGVFA
CAGL0I10494g       MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA
CAGL0L08448g       MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA
                   **      .*  .  *:::  .: . *         ..:*: :*   : :  * ::.   

TBLA0C04490        NFWPSPFA-WPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSN-KITQGSTER
TBLA0D02960        NLVPEPFA-FPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRREN-YIIQGSERR
Suva_7.419         NLWS-SLT-YPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNN-KITQGSGSR
Skud_7.442         NFWS-SLT-YPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQN-NITQGSSSR
Smik_6.227         NFWS-SLT-YPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQN-KITQASSSR
YGR131W            NFWT-SLT-YPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQN-KIIQGSSSR
AFR312W            NFIS-AFA-WPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGN-TISEQSTDR
Ecym_1236          NFIS-ALA-WPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGN-DISEGREGR
Kpol_1017.6        NIWTTPFA-WPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNN-KIIQGSTDR
TPHA0D03280        NIWSTPLA-WPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSN-NITQGSTDR
TDEL0D05610        NIWE-VFA-WPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSN-NITQGSTQR
ZYRO0D09966g       NIFV-PFA-FPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSN-KITQGSTSR
KLLA0D16280g       NFIS-ALA-WPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGN-KIAEGSKDR
SAKL0F02750g       NLFS-AFA-WPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSN-NITQGSTDR
KLTH0F14850g       NFVS-ALA-WPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSN-TVTQGSTDR
Kwal_55.21238      NFIS-ALA-WPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNN-KVTQGSSDR
NDAI0B05880        NMFD-ALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSN-SITQGSENR
NCAS0F03560        NLID-FLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESN-KIIQGSGIR
NDAI0G00930        NFFE-FLS-FPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRN-KITQGSGNR
NCAS0E00800        NFFD-ILA-LPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSN-KITQGFKNR
KAFR0G03700        NFFE-QLA-WPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSN-KIVRGSETR
KAFR0C01970        NFFQ-VLA-WPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSN-KIVRGSGQR
KNAG0A07950        NFWE-PLS-WPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKN-KIVQGSENR
KNAG0B00800        NFWE-PLA-WPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERN-HIIQGSENR
Suva_16.478        NFFE-PLA-WPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASN-SITQGSGNR
Skud_16.444        NFFE-PLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSN-GITQGSGTR
Smik_16.402        NFIE-PLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSN-KITQGSGTR
YPR149W            NFIE-PLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSN-KITQGSGTR
CAGL0I10494g       NFFE-PLA-WPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTR
CAGL0L08448g       NFFE-ILA-WPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENN-KIIQGSERR
                   *:    ::  * :    *.**  * : *           .* .  :   :  :      *

TBLA0C04490        CRLAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPE----ERGGASFRNS--RR-RLA
TBLA0D02960        CREAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQT---GYGGGYGGRSFGRRPRTRA
Suva_7.419         CHQAKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFG------NSFGRRRA--RR----
Skud_7.442         CHQSQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFN------TGYGRRRA--RR----
Smik_6.227         CHQSQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFN------SGFGRRRA--RR----
YGR131W            CHQSQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSN------TGFSRRRA--RR----
AFR312W            CRKVQASSTFLFFSFFIFLAKAVFSGLNIFSSGAFSSG---------GSKRG---G----
Ecym_1236          CRKVQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSG---------SGRKT--GG----
Kpol_1017.6        CRKAQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFS-----TPSIGRRRHHTANIGVP
TPHA0D03280        CRKAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSM-------SFGRRRG-GAGVGVP
TDEL0D05610        CRLAQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSR------TTLTSRRR--KS----
ZYRO0D09966g       CREAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSS------SGFSSRRR--RT----
KLLA0D16280g       CRKAQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS---------SNRKT--------
SAKL0F02750g       CRKAQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSG--------SGSRRA--------
KLTH0F14850g       CRKAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAG---------SSRRT--------
Kwal_55.21238      CRKAQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTS---------SGRKS--------
NDAI0B05880        CRMSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSG------TWAGSRSK--RR--TN
NCAS0F03560        CRVSQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSG-------SFMSRRK--RRSGAG
NDAI0G00930        CRESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNT--------FTSRRR--RR----
NCAS0E00800        CRESQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQH--------IGRRRR--RN----
KAFR0G03700        CRVAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSG----SSFGFGSRRK--RRSAGT
KAFR0C01970        CREAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSG-----SSRFISRRK--KH----
KNAG0A07950        CRQAQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGV----
KNAG0B00800        CRISQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTA-----SSKFGRRRRHGGGVGVP
Suva_16.478        CREAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG-------SFSKRRR--TG----
Skud_16.444        CRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG-------SFSKRRR--TG----
Smik_16.402        CRQAQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSG-------SFSKRRR--TG----
YPR149W            CRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG-------SFSKRRR--TG----
CAGL0I10494g       CRQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK---------LRRKH--HT----
CAGL0L08448g       CRESQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTK--------FIRRRR--NN-A--
                   *.  :*  .* :*:  ::: :   :       * :              .          

TBLA0C04490        TQQNSAMRRRAFQQI
TBLA0D02960        PPQMNKGGI-SISQV
Suva_7.419         -----QMGIPTISQV
Skud_7.442         -----QMGVPTISQV
Smik_6.227         -----QLGVPTISQV
YGR131W            -----QMGIPTISQV
AFR312W            -------GVPTISQV
Ecym_1236          -------GVPTISQV
Kpol_1017.6        GASSPQVGVPNISQV
TPHA0D03280        GAASPQIGVPNISQV
TDEL0D05610        ----AQVGVPTISQV
ZYRO0D09966g       --QQANVGVPTISQV
KLLA0D16280g       -----QVGVPTISQV
SAKL0F02750g       -----NVGVPTISQV
KLTH0F14850g       ----GNVGVPTISQV
Kwal_55.21238      ----ANVGVPTISQV
NDAI0B05880        RSGANEVGVPTISQV
NCAS0F03560        VGGTTGGGVPTISEV
NDAI0G00930        -NGAAEVGVPSISQV
NCAS0E00800        ---AAEIGVPSISQV
KAFR0G03700        GVPTTSTGVPTVSEV
KAFR0C01970        --ATDVGGVPNISQV
KNAG0A07950        -----PQGVPNISTV
KNAG0B00800        ETS----GVPSISQV
Suva_16.478        -----QVGVPTISQV
Skud_16.444        -----QVGVPTISQV
Smik_16.402        -----QVGVPTISQV
YPR149W            -----QVGVPTISQV
CAGL0I10494g       -----EVGVPSISQV
CAGL0L08448g       -----EVGVPSVSQV
                              .. :

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0C04490
MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA
NFWPSPFA-WPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSN-KITQGSTER
CRLAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPE----ERGGASFRNS--RR-RLA
TQQNSAMRRRAFQQI
>TBLA0D02960
MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA
NLVPEPFA-FPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRREN-YIIQGSERR
CREAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQT---GYGGGYGGRSFGRRPRTRA
PPQMNKGGI-SISQV
>Suva_7.419
MLSVADNIVRIINAIFLIISIGLVSGLISSQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA
NLWS-SLT-YPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNN-KITQGSGSR
CHQAKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFG------NSFGRRRA--RR----
-----QMGIPTISQV
>Skud_7.442
MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTN-GSSRVNFCMFAAAYGLITDSFYGFLA
NFWS-SLT-YPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQN-NITQGSSSR
CHQSQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFN------TGYGRRRA--RR----
-----QMGVPTISQV
>Smik_6.227
MLSAADNLIRIINAVFLIISIGLISGLISTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA
NFWS-SLT-YPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQN-KITQASSSR
CHQSQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFN------SGFGRRRA--RR----
-----QLGVPTISQV
>YGR131W
MLSAADNLVRIINAVFLIISIGLISGLIGTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA
NFWT-SLT-YPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQN-KIIQGSSSR
CHQSQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSN------TGFSRRRA--RR----
-----QMGIPTISQV
>AFR312W
MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRN-SHSRVNFGLFTAVFALVTDSFYSIVA
NFIS-AFA-WPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGN-TISEQSTDR
CRKVQASSTFLFFSFFIFLAKAVFSGLNIFSSGAFSSG---------GSKRG---G----
-------GVPTISQV
>Ecym_1236
MLSILDNSLRAANFLFLIIVLALTGSLINGQNR-SHSRVNFGLFTAIFALLFDSLYSVLA
NFIS-ALA-WPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGN-DISEGREGR
CRKVQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSG---------SGRKT--GG----
-------GVPTISQV
>Kpol_1017.6
MLSLADNIMRAINFCFFVICMGLIGSLLATEKG-HSSRVNYCMFVPPFAVVTDSFYGILA
NIWTTPFA-WPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNN-KIIQGSTDR
CRKAQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFS-----TPSIGRRRHHTANIGVP
GASSPQVGVPNISQV
>TPHA0D03280
MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA
NIWSTPLA-WPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSN-NITQGSTDR
CRKAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSM-------SFGRRRG-GAGVGVP
GAASPQIGVPNISQV
>TDEL0D05610
MLAIVDNALRLVNFAFLVILLGLVGELISSEDG-HSSRVNFCMFAAAFGIVTDSFYGILA
NIWE-VFA-WPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSN-NITQGSTQR
CRLAQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSR------TTLTSRRR--KS----
----AQVGVPTISQV
>ZYRO0D09966g
MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA
NIFV-PFA-FPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSN-KITQGSTSR
CREAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSS------SGFSSRRR--RT----
--QQANVGVPTISQV
>KLLA0D16280g
MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDH-SSSRVNFAIFAAVFGIVFDSLYALIA
NFIS-ALA-WPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGN-KIAEGSKDR
CRKAQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS---------SNRKT--------
-----QVGVPTISQV
>SAKL0F02750g
MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA
NLFS-AFA-WPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSN-NITQGSTDR
CRKAQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSG--------SGSRRA--------
-----NVGVPTISQV
>KLTH0F14850g
MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA
NFVS-ALA-WPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSN-TVTQGSTDR
CRKAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAG---------SSRRT--------
----GNVGVPTISQV
>Kwal_55.21238
MLSILDNSLRAANFVFLLIVLGLTGSLAATRDN-NNPQVNFAVFAAAFGLLFDTLYAIPA
NFIS-ALA-WPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNN-KVTQGSSDR
CRKAQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTS---------SGRKS--------
----ANVGVPTISQV
>NDAI0B05880
MLSKVDNILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAF
NMFD-ALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSN-SITQGSENR
CRMSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSG------TWAGSRSK--RR--TN
RSGANEVGVPTISQV
>NCAS0F03560
MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNH-GSSRVNYCMFAAAFGLLTDSFFGMAA
NLID-FLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESN-KIIQGSGIR
CRVSQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSG-------SFMSRRK--RRSGAG
VGGTTGGGVPTISEV
>NDAI0G00930
MLSVADNLLRLLNAMFLVICIGLNSALLNTQQG-HNSRINYCMFTCVYCLLTDSFFGILA
NFFE-FLS-FPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRN-KITQGSGNR
CRESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNT--------FTSRRR--RR----
-NGAAEVGVPSISQV
>NCAS0E00800
MLGVADNLLRILNAVFLVICIGLNSALLNTKTH-NNSRINYCMFTCAYCLTTDSIYGIFA
NFFD-ILA-LPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSN-KITQGFKNR
CRESQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQH--------IGRRRR--RN----
---AAEIGVPSISQV
>KAFR0G03700
MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA
NFFE-QLA-WPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSN-KIVRGSETR
CRVAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSG----SSFGFGSRRK--RRSAGT
GVPTTSTGVPTVSEV
>KAFR0C01970
MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA
NFFQ-VLA-WPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSN-KIVRGSGQR
CREAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSG-----SSRFISRRK--KH----
--ATDVGGVPNISQV
>KNAG0A07950
MLALADIFLRLVNFVFLVICMGLISALLNTQHG-HSSRINYCMFTAAYGITTDSFYGVVA
NFWE-PLS-WPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKN-KIVQGSENR
CRQAQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGV----
-----PQGVPNISTV
>KNAG0B00800
MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA
NFWE-PLA-WPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERN-HIIQGSENR
CRISQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTA-----SSKFGRRRRHGGGVGVP
ETS----GVPSISQV
>Suva_16.478
MLAPVDNILRIINFLFLVISIGLISSLLNTQSG-NSSRINYCMFAVAYAIVTDSLYGVFA
NFFE-PLA-WPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASN-SITQGSGNR
CREAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG-------SFSKRRR--TG----
-----QVGVPTISQV
>Skud_16.444
MLAPADNILRIINFLFLVIVIGLISSLLNTQDR-NSSRVNFCMFAAAYGIFTDSLYGVFA
NFFE-PLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSN-GITQGSGTR
CRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG-------SFSKRRR--TG----
-----QVGVPTISQV
>Smik_16.402
MLALADNILRIINFLFLVISIALISSLLNTQDK-HSSRVNYCMFACAYGIFTDSLYGVFA
NFIE-PLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSN-KITQGSGTR
CRQAQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSG-------SFSKRRR--TG----
-----QVGVPTISQV
>YPR149W
MLALADNILRIINFLFLVISIGLISSLLNTQHR-HSSRVNYCMFACAYGIFTDSLYGVFA
NFIE-PLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSN-KITQGSGTR
CRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG-------SFSKRRR--TG----
-----QVGVPTISQV
>CAGL0I10494g
MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA
NFFE-PLA-WPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTR
CRQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK---------LRRKH--HT----
-----EVGVPSISQV
>CAGL0L08448g
MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA
NFFE-ILA-WPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENN-KIIQGSERR
CRESQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTK--------FIRRRR--NN-A--
-----EVGVPSVSQV